SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20048
         (771 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC052289-1|AAH52289.1|  421|Homo sapiens CPA4 protein protein.         40   0.010
AY358699-1|AAQ89062.1|  421|Homo sapiens CPA4 protein.                 40   0.010
AF095719-1|AAF23230.1|  421|Homo sapiens carboxypeptidase A3 pro...    40   0.010
X67318-1|CAA47732.1|  419|Homo sapiens carboxypeptidase a protein.     36   0.16 
BT007313-1|AAP35977.1|  419|Homo sapiens carboxypeptidase A1 (pa...    36   0.16 
BC005279-1|AAH05279.1|  419|Homo sapiens carboxypeptidase A1 (pa...    36   0.16 
BC042996-1|AAH42996.1|  436|Homo sapiens carboxypeptidase A5 pro...    33   1.5  
AY155229-1|AAO17155.1|  436|Homo sapiens carboxypeptidase A5 pro...    33   1.5  
AK131191-1|BAD18389.1|  403|Homo sapiens protein ( Homo sapiens ...    33   1.5  
AF384667-1|AAL37611.1|  436|Homo sapiens carboxypeptidase A5 pro...    33   1.5  
AK093288-1|BAC04122.1|  351|Homo sapiens protein ( Homo sapiens ...    32   2.0  
BC033684-1|AAH33684.1|  437|Homo sapiens carboxypeptidase A6 pro...    31   6.0  
AF221594-1|AAF91231.1|  315|Homo sapiens carboxypeptidase B prec...    31   6.0  
U19977-1|AAA74425.1|  417|Homo sapiens preprocarboxypeptidase A2...    30   8.0  
BT007403-1|AAP36067.1|  417|Homo sapiens carboxypeptidase A2 (pa...    30   8.0  
BC015140-1|AAH15140.1|  417|Homo sapiens carboxypeptidase A2 (pa...    30   8.0  
BC014571-1|AAH14571.1|  417|Homo sapiens carboxypeptidase A2 (pa...    30   8.0  
BC007009-1|AAH07009.1|  417|Homo sapiens carboxypeptidase A2 (pa...    30   8.0  

>BC052289-1|AAH52289.1|  421|Homo sapiens CPA4 protein protein.
          Length = 421

 Score = 39.9 bits (89), Expect = 0.010
 Identities = 20/59 (33%), Positives = 34/59 (57%)
 Frame = +2

Query: 509 KRESIDYNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMTWKQYHRLEDIYGFMDYLA 685
           + + ++Y V IEDLQ  ++ E+  + ++E   Q+R  +   +  YH LE IY  MD +A
Sbjct: 81  RSQGLEYAVTIEDLQALLDNEDDEMQHNEG--QERSSNNFNYGAYHSLEAIYHEMDNIA 137


>AY358699-1|AAQ89062.1|  421|Homo sapiens CPA4 protein.
          Length = 421

 Score = 39.9 bits (89), Expect = 0.010
 Identities = 20/59 (33%), Positives = 34/59 (57%)
 Frame = +2

Query: 509 KRESIDYNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMTWKQYHRLEDIYGFMDYLA 685
           + + ++Y V IEDLQ  ++ E+  + ++E   Q+R  +   +  YH LE IY  MD +A
Sbjct: 81  RSQGLEYAVTIEDLQALLDNEDDEMQHNEG--QERSSNNFNYGAYHSLEAIYHEMDNIA 137


>AF095719-1|AAF23230.1|  421|Homo sapiens carboxypeptidase A3
           protein.
          Length = 421

 Score = 39.9 bits (89), Expect = 0.010
 Identities = 20/59 (33%), Positives = 34/59 (57%)
 Frame = +2

Query: 509 KRESIDYNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMTWKQYHRLEDIYGFMDYLA 685
           + + ++Y V IEDLQ  ++ E+  + ++E   Q+R  +   +  YH LE IY  MD +A
Sbjct: 81  RSQGLEYAVTIEDLQALLDNEDDEMQHNEG--QERSSNNFNYGAYHSLEAIYHEMDNIA 137


>X67318-1|CAA47732.1|  419|Homo sapiens carboxypeptidase a protein.
          Length = 419

 Score = 35.9 bits (79), Expect = 0.16
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 2/65 (3%)
 Frame = +2

Query: 521 IDYNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMTWKQYHRLEDIYGFMDYLA--KPI 694
           I Y  +IED+Q  ++EE   +       + R      +  YH LE+IY F+D L    P 
Sbjct: 84  ISYETMIEDVQSLLDEEQEQMF--AFRSRARSTDTFNYATYHTLEEIYDFLDLLVAENPH 141

Query: 695 LLSSV 709
           L+S +
Sbjct: 142 LVSKI 146


>BT007313-1|AAP35977.1|  419|Homo sapiens carboxypeptidase A1
           (pancreatic) protein.
          Length = 419

 Score = 35.9 bits (79), Expect = 0.16
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 2/65 (3%)
 Frame = +2

Query: 521 IDYNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMTWKQYHRLEDIYGFMDYLA--KPI 694
           I Y  +IED+Q  ++EE   +       + R      +  YH LE+IY F+D L    P 
Sbjct: 84  ISYETMIEDVQSLLDEEQEQMF--AFRSRARSTDTFNYATYHTLEEIYDFLDLLVAENPH 141

Query: 695 LLSSV 709
           L+S +
Sbjct: 142 LVSKI 146


>BC005279-1|AAH05279.1|  419|Homo sapiens carboxypeptidase A1
           (pancreatic) protein.
          Length = 419

 Score = 35.9 bits (79), Expect = 0.16
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 2/65 (3%)
 Frame = +2

Query: 521 IDYNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMTWKQYHRLEDIYGFMDYLA--KPI 694
           I Y  +IED+Q  ++EE   +       + R      +  YH LE+IY F+D L    P 
Sbjct: 84  ISYETMIEDVQSLLDEEQEQMF--AFRSRARSTDTFNYATYHTLEEIYDFLDLLVAENPH 141

Query: 695 LLSSV 709
           L+S +
Sbjct: 142 LVSKI 146


>BC042996-1|AAH42996.1|  436|Homo sapiens carboxypeptidase A5
           protein.
          Length = 436

 Score = 32.7 bits (71), Expect = 1.5
 Identities = 14/50 (28%), Positives = 29/50 (58%)
 Frame = +2

Query: 527 YNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMTWKQYHRLEDIYGFMD 676
           Y+++I+D+Q  ++EE   +        +R  +  ++  YH LE+IY ++D
Sbjct: 103 YSIMIKDIQVLLDEERQAMAKSR--RLERSTNSFSYSSYHTLEEIYSWID 150


>AY155229-1|AAO17155.1|  436|Homo sapiens carboxypeptidase A5
           protein.
          Length = 436

 Score = 32.7 bits (71), Expect = 1.5
 Identities = 14/50 (28%), Positives = 29/50 (58%)
 Frame = +2

Query: 527 YNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMTWKQYHRLEDIYGFMD 676
           Y+++I+D+Q  ++EE   +        +R  +  ++  YH LE+IY ++D
Sbjct: 103 YSIMIKDIQVLLDEERQAMAKSR--RLERSTNSFSYSSYHTLEEIYSWID 150


>AK131191-1|BAD18389.1|  403|Homo sapiens protein ( Homo sapiens
           cDNA FLJ16014 fis, clone TESTI1000169, moderately
           similar to CARBOXYPEPTIDASE A1 PRECURSOR (EC 3.4.17.1).
           ).
          Length = 403

 Score = 32.7 bits (71), Expect = 1.5
 Identities = 14/50 (28%), Positives = 29/50 (58%)
 Frame = +2

Query: 527 YNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMTWKQYHRLEDIYGFMD 676
           Y+++I+D+Q  ++EE   +        +R  +  ++  YH LE+IY ++D
Sbjct: 103 YSIMIKDIQVLLDEERQAMAKSR--RLERSTNSFSYSSYHTLEEIYSWID 150


>AF384667-1|AAL37611.1|  436|Homo sapiens carboxypeptidase A5
           protein.
          Length = 436

 Score = 32.7 bits (71), Expect = 1.5
 Identities = 14/50 (28%), Positives = 29/50 (58%)
 Frame = +2

Query: 527 YNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMTWKQYHRLEDIYGFMD 676
           Y+++I+D+Q  ++EE   +        +R  +  ++  YH LE+IY ++D
Sbjct: 103 YSIMIKDIQVLLDEERQAMAKSR--RLERSTNSFSYSSYHTLEEIYSWID 150


>AK093288-1|BAC04122.1|  351|Homo sapiens protein ( Homo sapiens
           cDNA FLJ35969 fis, clone TESTI2013144, moderately
           similar to CARBOXYPEPTIDASE A1 PRECURSOR (EC 3.4.17.1).
           ).
          Length = 351

 Score = 32.3 bits (70), Expect = 2.0
 Identities = 14/50 (28%), Positives = 28/50 (56%)
 Frame = +2

Query: 527 YNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMTWKQYHRLEDIYGFMD 676
           Y+++I D+Q  ++EE   +        +R  +  ++  YH LE+IY ++D
Sbjct: 103 YSIMIRDIQVLLDEERQAMAKSR--RLERSTNSFSYSSYHTLEEIYSWID 150


>BC033684-1|AAH33684.1|  437|Homo sapiens carboxypeptidase A6
           protein.
          Length = 437

 Score = 30.7 bits (66), Expect = 6.0
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 1/58 (1%)
 Frame = +2

Query: 518 SIDYNVVIEDLQKRINEENPPLDNDEIELQDRRG-HRMTWKQYHRLEDIYGFMDYLAK 688
           +I Y V+IEDLQK + E+   L       ++RR      ++ YH LE+I  +M +L K
Sbjct: 102 NIQYKVLIEDLQKTL-EKGSSLHTQ----RNRRSLSGYNYEVYHSLEEIQNWMHHLNK 154


>AF221594-1|AAF91231.1|  315|Homo sapiens carboxypeptidase B
           precursor protein.
          Length = 315

 Score = 30.7 bits (66), Expect = 6.0
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 1/58 (1%)
 Frame = +2

Query: 518 SIDYNVVIEDLQKRINEENPPLDNDEIELQDRRG-HRMTWKQYHRLEDIYGFMDYLAK 688
           +I Y V+IEDLQK + E+   L       ++RR      ++ YH LE+I  +M +L K
Sbjct: 102 NIQYKVLIEDLQKTL-EKGSSLHTQ----RNRRSLSGYNYEVYHSLEEIQNWMHHLNK 154


>U19977-1|AAA74425.1|  417|Homo sapiens preprocarboxypeptidase A2
           protein.
          Length = 417

 Score = 30.3 bits (65), Expect = 8.0
 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 2/67 (2%)
 Frame = +2

Query: 515 ESIDYNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMTWKQYHRLEDIYGFMDYLA--K 688
           + I Y+++IED+Q  +++EN  +       +  R     +  YH LE+I   MD L    
Sbjct: 82  QGIAYSIMIEDVQVLLDKENEEM---LFNRRRERSGNFNFGAYHTLEEISQEMDNLVAEH 138

Query: 689 PILLSSV 709
           P L+S V
Sbjct: 139 PGLVSKV 145


>BT007403-1|AAP36067.1|  417|Homo sapiens carboxypeptidase A2
           (pancreatic) protein.
          Length = 417

 Score = 30.3 bits (65), Expect = 8.0
 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 2/67 (2%)
 Frame = +2

Query: 515 ESIDYNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMTWKQYHRLEDIYGFMDYLA--K 688
           + I Y+++IED+Q  +++EN  +       +  R     +  YH LE+I   MD L    
Sbjct: 82  QGIAYSIMIEDVQVLLDKENEEM---LFNRRRERSGNFNFGAYHTLEEISQEMDNLVAEH 138

Query: 689 PILLSSV 709
           P L+S V
Sbjct: 139 PGLVSKV 145


>BC015140-1|AAH15140.1|  417|Homo sapiens carboxypeptidase A2
           (pancreatic) protein.
          Length = 417

 Score = 30.3 bits (65), Expect = 8.0
 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 2/67 (2%)
 Frame = +2

Query: 515 ESIDYNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMTWKQYHRLEDIYGFMDYLA--K 688
           + I Y+++IED+Q  +++EN  +       +  R     +  YH LE+I   MD L    
Sbjct: 82  QGIAYSIMIEDVQVLLDKENEEM---LFNRRRERSGNFNFGAYHTLEEISQEMDNLVAEH 138

Query: 689 PILLSSV 709
           P L+S V
Sbjct: 139 PGLVSKV 145


>BC014571-1|AAH14571.1|  417|Homo sapiens carboxypeptidase A2
           (pancreatic) protein.
          Length = 417

 Score = 30.3 bits (65), Expect = 8.0
 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 2/67 (2%)
 Frame = +2

Query: 515 ESIDYNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMTWKQYHRLEDIYGFMDYLA--K 688
           + I Y+++IED+Q  +++EN  +       +  R     +  YH LE+I   MD L    
Sbjct: 82  QGIAYSIMIEDVQVLLDKENEEM---LFNRRRERSGNFNFGAYHTLEEISQEMDNLVAEH 138

Query: 689 PILLSSV 709
           P L+S V
Sbjct: 139 PGLVSKV 145


>BC007009-1|AAH07009.1|  417|Homo sapiens carboxypeptidase A2
           (pancreatic) protein.
          Length = 417

 Score = 30.3 bits (65), Expect = 8.0
 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 2/67 (2%)
 Frame = +2

Query: 515 ESIDYNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMTWKQYHRLEDIYGFMDYLA--K 688
           + I Y+++IED+Q  +++EN  +       +  R     +  YH LE+I   MD L    
Sbjct: 82  QGIAYSIMIEDVQVLLDKENEEM---LFNRRRERSGNFNFGAYHTLEEISQEMDNLVAEH 138

Query: 689 PILLSSV 709
           P L+S V
Sbjct: 139 PGLVSKV 145


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 103,452,705
Number of Sequences: 237096
Number of extensions: 2003734
Number of successful extensions: 4791
Number of sequences better than 10.0: 18
Number of HSP's better than 10.0 without gapping: 4628
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4785
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 9311505506
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -