SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20047
         (659 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC075795-1|AAH75795.1|  933|Homo sapiens CTNND1 protein protein.       33   0.90 
AY505564-1|AAR84236.1|  941|Homo sapiens catenin (cadherin-assoc...    33   0.90 
AF062343-1|AAC39828.1|  933|Homo sapiens p120 catenin isoform 1A...    33   0.90 
AF062341-1|AAC39826.1|  968|Homo sapiens p120 catenin isoform 1A...    33   0.90 
AF062339-1|AAC39824.1|  933|Homo sapiens p120 catenin isoform 1A...    33   0.90 
AF062328-1|AAC39813.1|  962|Homo sapiens p120 catenin isoform 1A...    33   0.90 
AF062324-1|AAC39809.1|  933|Homo sapiens p120 catenin isoform 1A...    33   0.90 
AF062321-1|AAC39806.1|  939|Homo sapiens p120 catenin isoform 1A...    33   0.90 
AF062317-1|AAC39802.1|  941|Homo sapiens p120 catenin isoform 1B...    33   0.90 
AB002382-1|BAA20838.2|  967|Homo sapiens KIAA0384 protein.             33   0.90 
U59309-1|AAB66354.1|  510|Homo sapiens fumarase precursor protein.     31   4.8  
U48857-1|AAD00071.1|  510|Homo sapiens fumarase protein.               31   4.8  
U44839-1|AAC50450.1|  690|Homo sapiens UHX1 protein protein.           31   4.8  
M15502-1|AAA52483.1|  468|Homo sapiens FH protein.                     31   4.8  
BT009839-1|AAP88841.1|  510|Homo sapiens fumarate hydratase prot...    31   4.8  
BC063668-1|AAH63668.1|  923|Homo sapiens USP11 protein protein.        31   4.8  
BC017444-1|AAH17444.1|  510|Homo sapiens fumarate hydratase prot...    31   4.8  
BC003108-1|AAH03108.1|  510|Homo sapiens fumarate hydratase prot...    31   4.8  
BC000350-1|AAH00350.4|  921|Homo sapiens USP11 protein protein.        31   4.8  
AL606476-1|CAI14951.1|  510|Homo sapiens fumarate hydratase prot...    31   4.8  
AL591898-5|CAI13908.1|  510|Homo sapiens fumarate hydratase prot...    31   4.8  
AL359764-5|CAI15144.1|  510|Homo sapiens fumarate hydratase prot...    31   4.8  
AL096791-3|CAD20056.1|  690|Homo sapiens ubiquitin specific pept...    31   4.8  
AB073597-1|BAC20463.1|  921|Homo sapiens deubiquitinating enzyme...    31   4.8  
BC067812-1|AAH67812.1|  526|Homo sapiens cyclin L1 protein.            30   8.4  
BC007081-1|AAH07081.1|  526|Homo sapiens cyclin L1 protein.            30   8.4  
AY358663-1|AAQ89026.1|  299|Homo sapiens CCNL1 protein.                30   8.4  
AF180920-1|AAD53184.1|  526|Homo sapiens cyclin L ania-6a protein.     30   8.4  

>BC075795-1|AAH75795.1|  933|Homo sapiens CTNND1 protein protein.
          Length = 933

 Score = 33.1 bits (72), Expect = 0.90
 Identities = 26/74 (35%), Positives = 35/74 (47%), Gaps = 4/74 (5%)
 Frame = +3

Query: 192 FERRSAVKDPERDHRSHREGKEFKEGHFRVNRLMSESTIDVNHQNGHMNGDAD---EKIS 362
           FE+ +   + ER H S  + +  +      N LM+  T+   HQNG   GDAD   +K S
Sbjct: 23  FEKLTRALEEERRHVS-AQLERVRVSPQDANPLMANGTLTRRHQNGRFVGDADLERQKFS 81

Query: 363 -RTLNRAVSTSHLL 401
              LN     SHLL
Sbjct: 82  DLKLNGPQDHSHLL 95


>AY505564-1|AAR84236.1|  941|Homo sapiens catenin
           (cadherin-associated protein), delta 1 protein.
          Length = 941

 Score = 33.1 bits (72), Expect = 0.90
 Identities = 26/74 (35%), Positives = 35/74 (47%), Gaps = 4/74 (5%)
 Frame = +3

Query: 192 FERRSAVKDPERDHRSHREGKEFKEGHFRVNRLMSESTIDVNHQNGHMNGDAD---EKIS 362
           FE+ +   + ER H S  + +  +      N LM+  T+   HQNG   GDAD   +K S
Sbjct: 23  FEKLTRALEEERRHVS-AQLERVRVSPQDANPLMANGTLTRRHQNGRFVGDADLERQKFS 81

Query: 363 -RTLNRAVSTSHLL 401
              LN     SHLL
Sbjct: 82  DLKLNGPQDHSHLL 95


>AF062343-1|AAC39828.1|  933|Homo sapiens p120 catenin isoform 1A
           protein.
          Length = 933

 Score = 33.1 bits (72), Expect = 0.90
 Identities = 26/74 (35%), Positives = 35/74 (47%), Gaps = 4/74 (5%)
 Frame = +3

Query: 192 FERRSAVKDPERDHRSHREGKEFKEGHFRVNRLMSESTIDVNHQNGHMNGDAD---EKIS 362
           FE+ +   + ER H S  + +  +      N LM+  T+   HQNG   GDAD   +K S
Sbjct: 23  FEKLTRALEEERRHVS-AQLERVRVSPQDANPLMANGTLTRRHQNGRFVGDADLERQKFS 81

Query: 363 -RTLNRAVSTSHLL 401
              LN     SHLL
Sbjct: 82  DLKLNGPQDHSHLL 95


>AF062341-1|AAC39826.1|  968|Homo sapiens p120 catenin isoform 1ABC
           protein.
          Length = 968

 Score = 33.1 bits (72), Expect = 0.90
 Identities = 26/74 (35%), Positives = 35/74 (47%), Gaps = 4/74 (5%)
 Frame = +3

Query: 192 FERRSAVKDPERDHRSHREGKEFKEGHFRVNRLMSESTIDVNHQNGHMNGDAD---EKIS 362
           FE+ +   + ER H S  + +  +      N LM+  T+   HQNG   GDAD   +K S
Sbjct: 23  FEKLTRALEEERRHVS-AQLERVRVSPQDANPLMANGTLTRRHQNGRFVGDADLERQKFS 81

Query: 363 -RTLNRAVSTSHLL 401
              LN     SHLL
Sbjct: 82  DLKLNGPQDHSHLL 95


>AF062339-1|AAC39824.1|  933|Homo sapiens p120 catenin isoform 1A
           protein.
          Length = 933

 Score = 33.1 bits (72), Expect = 0.90
 Identities = 26/74 (35%), Positives = 35/74 (47%), Gaps = 4/74 (5%)
 Frame = +3

Query: 192 FERRSAVKDPERDHRSHREGKEFKEGHFRVNRLMSESTIDVNHQNGHMNGDAD---EKIS 362
           FE+ +   + ER H S  + +  +      N LM+  T+   HQNG   GDAD   +K S
Sbjct: 23  FEKLTRALEEERRHVS-AQLERVRVSPQDANPLMANGTLTRRHQNGRFVGDADLERQKFS 81

Query: 363 -RTLNRAVSTSHLL 401
              LN     SHLL
Sbjct: 82  DLKLNGPQDHSHLL 95


>AF062328-1|AAC39813.1|  962|Homo sapiens p120 catenin isoform 1AB
           protein.
          Length = 962

 Score = 33.1 bits (72), Expect = 0.90
 Identities = 26/74 (35%), Positives = 35/74 (47%), Gaps = 4/74 (5%)
 Frame = +3

Query: 192 FERRSAVKDPERDHRSHREGKEFKEGHFRVNRLMSESTIDVNHQNGHMNGDAD---EKIS 362
           FE+ +   + ER H S  + +  +      N LM+  T+   HQNG   GDAD   +K S
Sbjct: 23  FEKLTRALEEERRHVS-AQLERVRVSPQDANPLMANGTLTRRHQNGRFVGDADLERQKFS 81

Query: 363 -RTLNRAVSTSHLL 401
              LN     SHLL
Sbjct: 82  DLKLNGPQDHSHLL 95


>AF062324-1|AAC39809.1|  933|Homo sapiens p120 catenin isoform 1A
           protein.
          Length = 933

 Score = 33.1 bits (72), Expect = 0.90
 Identities = 26/74 (35%), Positives = 35/74 (47%), Gaps = 4/74 (5%)
 Frame = +3

Query: 192 FERRSAVKDPERDHRSHREGKEFKEGHFRVNRLMSESTIDVNHQNGHMNGDAD---EKIS 362
           FE+ +   + ER H S  + +  +      N LM+  T+   HQNG   GDAD   +K S
Sbjct: 23  FEKLTRALEEERRHVS-AQLERVRVSPQDANPLMANGTLTRRHQNGRFVGDADLERQKFS 81

Query: 363 -RTLNRAVSTSHLL 401
              LN     SHLL
Sbjct: 82  DLKLNGPQDHSHLL 95


>AF062321-1|AAC39806.1|  939|Homo sapiens p120 catenin isoform 1AC
           protein.
          Length = 939

 Score = 33.1 bits (72), Expect = 0.90
 Identities = 26/74 (35%), Positives = 35/74 (47%), Gaps = 4/74 (5%)
 Frame = +3

Query: 192 FERRSAVKDPERDHRSHREGKEFKEGHFRVNRLMSESTIDVNHQNGHMNGDAD---EKIS 362
           FE+ +   + ER H S  + +  +      N LM+  T+   HQNG   GDAD   +K S
Sbjct: 23  FEKLTRALEEERRHVS-AQLERVRVSPQDANPLMANGTLTRRHQNGRFVGDADLERQKFS 81

Query: 363 -RTLNRAVSTSHLL 401
              LN     SHLL
Sbjct: 82  DLKLNGPQDHSHLL 95


>AF062317-1|AAC39802.1|  941|Homo sapiens p120 catenin isoform 1B
           protein.
          Length = 941

 Score = 33.1 bits (72), Expect = 0.90
 Identities = 26/74 (35%), Positives = 35/74 (47%), Gaps = 4/74 (5%)
 Frame = +3

Query: 192 FERRSAVKDPERDHRSHREGKEFKEGHFRVNRLMSESTIDVNHQNGHMNGDAD---EKIS 362
           FE+ +   + ER H S  + +  +      N LM+  T+   HQNG   GDAD   +K S
Sbjct: 23  FEKLTRALEEERRHVS-AQLERVRVSPQDANPLMANGTLTRRHQNGRFVGDADLERQKFS 81

Query: 363 -RTLNRAVSTSHLL 401
              LN     SHLL
Sbjct: 82  DLKLNGPQDHSHLL 95


>AB002382-1|BAA20838.2|  967|Homo sapiens KIAA0384 protein.
          Length = 967

 Score = 33.1 bits (72), Expect = 0.90
 Identities = 26/74 (35%), Positives = 35/74 (47%), Gaps = 4/74 (5%)
 Frame = +3

Query: 192 FERRSAVKDPERDHRSHREGKEFKEGHFRVNRLMSESTIDVNHQNGHMNGDAD---EKIS 362
           FE+ +   + ER H S  + +  +      N LM+  T+   HQNG   GDAD   +K S
Sbjct: 51  FEKLTRALEEERRHVS-AQLERVRVSPQDANPLMANGTLTRRHQNGRFVGDADLERQKFS 109

Query: 363 -RTLNRAVSTSHLL 401
              LN     SHLL
Sbjct: 110 DLKLNGPQDHSHLL 123


>U59309-1|AAB66354.1|  510|Homo sapiens fumarase precursor protein.
          Length = 510

 Score = 30.7 bits (66), Expect = 4.8
 Identities = 15/38 (39%), Positives = 24/38 (63%)
 Frame = +3

Query: 276 RVNRLMSESTIDVNHQNGHMNGDADEKISRTLNRAVST 389
           R+N+LM+ES + V   N H+  D   KI++T ++  ST
Sbjct: 444 RINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGST 481


>U48857-1|AAD00071.1|  510|Homo sapiens fumarase protein.
          Length = 510

 Score = 30.7 bits (66), Expect = 4.8
 Identities = 15/38 (39%), Positives = 24/38 (63%)
 Frame = +3

Query: 276 RVNRLMSESTIDVNHQNGHMNGDADEKISRTLNRAVST 389
           R+N+LM+ES + V   N H+  D   KI++T ++  ST
Sbjct: 444 RINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGST 481


>U44839-1|AAC50450.1|  690|Homo sapiens UHX1 protein protein.
          Length = 690

 Score = 30.7 bits (66), Expect = 4.8
 Identities = 13/35 (37%), Positives = 22/35 (62%), Gaps = 2/35 (5%)
 Frame = +1

Query: 109 VKHLCA--IISFLPIRISDCVTSFTMGDSLLKEDP 207
           VKH C   ++   P+R+ +C+  FT  ++L KE+P
Sbjct: 492 VKHDCVGYVMKKAPVRLQECIELFTTVETLEKENP 526


>M15502-1|AAA52483.1|  468|Homo sapiens FH protein.
          Length = 468

 Score = 30.7 bits (66), Expect = 4.8
 Identities = 15/38 (39%), Positives = 24/38 (63%)
 Frame = +3

Query: 276 RVNRLMSESTIDVNHQNGHMNGDADEKISRTLNRAVST 389
           R+N+LM+ES + V   N H+  D   KI++T ++  ST
Sbjct: 402 RINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGST 439


>BT009839-1|AAP88841.1|  510|Homo sapiens fumarate hydratase
           protein.
          Length = 510

 Score = 30.7 bits (66), Expect = 4.8
 Identities = 15/38 (39%), Positives = 24/38 (63%)
 Frame = +3

Query: 276 RVNRLMSESTIDVNHQNGHMNGDADEKISRTLNRAVST 389
           R+N+LM+ES + V   N H+  D   KI++T ++  ST
Sbjct: 444 RINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGST 481


>BC063668-1|AAH63668.1|  923|Homo sapiens USP11 protein protein.
          Length = 923

 Score = 30.7 bits (66), Expect = 4.8
 Identities = 13/35 (37%), Positives = 22/35 (62%), Gaps = 2/35 (5%)
 Frame = +1

Query: 109 VKHLCA--IISFLPIRISDCVTSFTMGDSLLKEDP 207
           VKH C   ++   P+R+ +C+  FT  ++L KE+P
Sbjct: 725 VKHDCVGYVMKKAPVRLQECIELFTTVETLEKENP 759


>BC017444-1|AAH17444.1|  510|Homo sapiens fumarate hydratase
           protein.
          Length = 510

 Score = 30.7 bits (66), Expect = 4.8
 Identities = 15/38 (39%), Positives = 24/38 (63%)
 Frame = +3

Query: 276 RVNRLMSESTIDVNHQNGHMNGDADEKISRTLNRAVST 389
           R+N+LM+ES + V   N H+  D   KI++T ++  ST
Sbjct: 444 RINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGST 481


>BC003108-1|AAH03108.1|  510|Homo sapiens fumarate hydratase
           protein.
          Length = 510

 Score = 30.7 bits (66), Expect = 4.8
 Identities = 15/38 (39%), Positives = 24/38 (63%)
 Frame = +3

Query: 276 RVNRLMSESTIDVNHQNGHMNGDADEKISRTLNRAVST 389
           R+N+LM+ES + V   N H+  D   KI++T ++  ST
Sbjct: 444 RINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGST 481


>BC000350-1|AAH00350.4|  921|Homo sapiens USP11 protein protein.
          Length = 921

 Score = 30.7 bits (66), Expect = 4.8
 Identities = 13/35 (37%), Positives = 22/35 (62%), Gaps = 2/35 (5%)
 Frame = +1

Query: 109 VKHLCA--IISFLPIRISDCVTSFTMGDSLLKEDP 207
           VKH C   ++   P+R+ +C+  FT  ++L KE+P
Sbjct: 723 VKHDCVGYVMKKAPVRLQECIELFTTVETLEKENP 757


>AL606476-1|CAI14951.1|  510|Homo sapiens fumarate hydratase
           protein.
          Length = 510

 Score = 30.7 bits (66), Expect = 4.8
 Identities = 15/38 (39%), Positives = 24/38 (63%)
 Frame = +3

Query: 276 RVNRLMSESTIDVNHQNGHMNGDADEKISRTLNRAVST 389
           R+N+LM+ES + V   N H+  D   KI++T ++  ST
Sbjct: 444 RINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGST 481


>AL591898-5|CAI13908.1|  510|Homo sapiens fumarate hydratase
           protein.
          Length = 510

 Score = 30.7 bits (66), Expect = 4.8
 Identities = 15/38 (39%), Positives = 24/38 (63%)
 Frame = +3

Query: 276 RVNRLMSESTIDVNHQNGHMNGDADEKISRTLNRAVST 389
           R+N+LM+ES + V   N H+  D   KI++T ++  ST
Sbjct: 444 RINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGST 481


>AL359764-5|CAI15144.1|  510|Homo sapiens fumarate hydratase
           protein.
          Length = 510

 Score = 30.7 bits (66), Expect = 4.8
 Identities = 15/38 (39%), Positives = 24/38 (63%)
 Frame = +3

Query: 276 RVNRLMSESTIDVNHQNGHMNGDADEKISRTLNRAVST 389
           R+N+LM+ES + V   N H+  D   KI++T ++  ST
Sbjct: 444 RINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGST 481


>AL096791-3|CAD20056.1|  690|Homo sapiens ubiquitin specific
           peptidase 11 protein.
          Length = 690

 Score = 30.7 bits (66), Expect = 4.8
 Identities = 13/35 (37%), Positives = 22/35 (62%), Gaps = 2/35 (5%)
 Frame = +1

Query: 109 VKHLCA--IISFLPIRISDCVTSFTMGDSLLKEDP 207
           VKH C   ++   P+R+ +C+  FT  ++L KE+P
Sbjct: 492 VKHDCVGYVMKKAPVRLQECIELFTTVETLEKENP 526


>AB073597-1|BAC20463.1|  921|Homo sapiens deubiquitinating enzyme
           protein.
          Length = 921

 Score = 30.7 bits (66), Expect = 4.8
 Identities = 13/35 (37%), Positives = 22/35 (62%), Gaps = 2/35 (5%)
 Frame = +1

Query: 109 VKHLCA--IISFLPIRISDCVTSFTMGDSLLKEDP 207
           VKH C   ++   P+R+ +C+  FT  ++L KE+P
Sbjct: 723 VKHDCVGYVMKKAPVRLQECIELFTTVETLEKENP 757


>BC067812-1|AAH67812.1|  526|Homo sapiens cyclin L1 protein.
          Length = 526

 Score = 29.9 bits (64), Expect = 8.4
 Identities = 18/66 (27%), Positives = 28/66 (42%)
 Frame = +3

Query: 144 HSDIGLRYEFHHGRLTFERRSAVKDPERDHRSHREGKEFKEGHFRVNRLMSESTIDVNHQ 323
           H+   L+    HG    + RS  +   RDH    +    + GH R  R  S S  + +H+
Sbjct: 452 HTRDDLKSSNRHGHKRKKSRSRSQSKSRDHSDAAKKHRHERGHHRDRRERSRS-FERSHK 510

Query: 324 NGHMNG 341
           + H  G
Sbjct: 511 SKHHGG 516


>BC007081-1|AAH07081.1|  526|Homo sapiens cyclin L1 protein.
          Length = 526

 Score = 29.9 bits (64), Expect = 8.4
 Identities = 18/66 (27%), Positives = 28/66 (42%)
 Frame = +3

Query: 144 HSDIGLRYEFHHGRLTFERRSAVKDPERDHRSHREGKEFKEGHFRVNRLMSESTIDVNHQ 323
           H+   L+    HG    + RS  +   RDH    +    + GH R  R  S S  + +H+
Sbjct: 452 HTRDDLKSSNRHGHKRKKSRSRSQSKSRDHSDAAKKHRHERGHHRDRRERSRS-FERSHK 510

Query: 324 NGHMNG 341
           + H  G
Sbjct: 511 SKHHGG 516


>AY358663-1|AAQ89026.1|  299|Homo sapiens CCNL1 protein.
          Length = 299

 Score = 29.9 bits (64), Expect = 8.4
 Identities = 18/66 (27%), Positives = 28/66 (42%)
 Frame = +3

Query: 144 HSDIGLRYEFHHGRLTFERRSAVKDPERDHRSHREGKEFKEGHFRVNRLMSESTIDVNHQ 323
           H+   L+    HG    + RS  +   RDH    +    + GH R  R  S S  + +H+
Sbjct: 225 HTRDDLKSSNRHGHKRKKSRSRSQSKSRDHSDAAKKHRHERGHHRDRRERSRS-FERSHK 283

Query: 324 NGHMNG 341
           + H  G
Sbjct: 284 SKHHGG 289


>AF180920-1|AAD53184.1|  526|Homo sapiens cyclin L ania-6a protein.
          Length = 526

 Score = 29.9 bits (64), Expect = 8.4
 Identities = 18/66 (27%), Positives = 28/66 (42%)
 Frame = +3

Query: 144 HSDIGLRYEFHHGRLTFERRSAVKDPERDHRSHREGKEFKEGHFRVNRLMSESTIDVNHQ 323
           H+   L+    HG    + RS  +   RDH    +    + GH R  R  S S  + +H+
Sbjct: 452 HTRDDLKSSNRHGHKRKKSRSRSQSKSRDHSDAAKKHRHERGHHRDRRERSRS-FERSHK 510

Query: 324 NGHMNG 341
           + H  G
Sbjct: 511 SKHHGG 516


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 92,132,447
Number of Sequences: 237096
Number of extensions: 1860354
Number of successful extensions: 6325
Number of sequences better than 10.0: 28
Number of HSP's better than 10.0 without gapping: 5966
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6321
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 7422585720
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -