SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20045
         (722 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U19176-1|AAC13784.1|  838|Homo sapiens P protein protein.              78   3e-14
M99564-1|AAA36477.1|  838|Homo sapiens P protein protein.              78   3e-14
BC012097-1|AAH12097.1|  814|Homo sapiens OCA2 protein protein.         78   3e-14
D38521-1|BAA07526.1| 1798|Homo sapiens KIAA0077 protein.               33   1.4  
BC113668-1|AAI13669.1| 1729|Homo sapiens proteasome (prosome, ma...    33   1.4  
BC112169-1|AAI12170.1| 1729|Homo sapiens proteasome (prosome, ma...    33   1.4  
AY894756-1|AAX83871.1| 1210|Homo sapiens proteasome activator 20...    33   1.4  
AY894754-1|AAX83869.1| 1218|Homo sapiens proteasome activator 20...    33   1.4  

>U19176-1|AAC13784.1|  838|Homo sapiens P protein protein.
          Length = 838

 Score = 78.2 bits (184), Expect = 3e-14
 Identities = 31/53 (58%), Positives = 40/53 (75%)
 Frame = -1

Query: 254 GASANVVCAGVAEQHGYKFTFMNFFKIGFPIMIGHLVVASLYLIICHCVFAWH 96
           GASANVVCAG+AEQHGY F+FM FF++GFP+M+    V   YL++ H V  W+
Sbjct: 786 GASANVVCAGIAEQHGYGFSFMEFFRLGFPMMVVSCTVGMCYLLVAHVVVGWN 838


>M99564-1|AAA36477.1|  838|Homo sapiens P protein protein.
          Length = 838

 Score = 78.2 bits (184), Expect = 3e-14
 Identities = 31/53 (58%), Positives = 40/53 (75%)
 Frame = -1

Query: 254 GASANVVCAGVAEQHGYKFTFMNFFKIGFPIMIGHLVVASLYLIICHCVFAWH 96
           GASANVVCAG+AEQHGY F+FM FF++GFP+M+    V   YL++ H V  W+
Sbjct: 786 GASANVVCAGIAEQHGYGFSFMEFFRLGFPMMVVSCTVGMCYLLVAHVVVGWN 838


>BC012097-1|AAH12097.1|  814|Homo sapiens OCA2 protein protein.
          Length = 814

 Score = 78.2 bits (184), Expect = 3e-14
 Identities = 31/53 (58%), Positives = 40/53 (75%)
 Frame = -1

Query: 254 GASANVVCAGVAEQHGYKFTFMNFFKIGFPIMIGHLVVASLYLIICHCVFAWH 96
           GASANVVCAG+AEQHGY F+FM FF++GFP+M+    V   YL++ H V  W+
Sbjct: 762 GASANVVCAGIAEQHGYGFSFMEFFRLGFPMMVVSCTVGMCYLLVAHVVVGWN 814


>D38521-1|BAA07526.1| 1798|Homo sapiens KIAA0077 protein.
          Length = 1798

 Score = 32.7 bits (71), Expect = 1.4
 Identities = 16/55 (29%), Positives = 27/55 (49%)
 Frame = +2

Query: 488 VKMIGTAISTSSQQDYSRTLKMVTSWRLGNTVEVSTTFCHVPSGFGMSSPSRYFP 652
           VK++   +  + +Q Y+ +  ++       T+   T +C VP GF    PS YFP
Sbjct: 654 VKILQRTLHLTCKQGYTLSCNLLHHLLRSTTLIYPTEYCSVPGGFD-KPPSEYFP 707


>BC113668-1|AAI13669.1| 1729|Homo sapiens proteasome (prosome,
           macropain) activator subunit 4 protein.
          Length = 1729

 Score = 32.7 bits (71), Expect = 1.4
 Identities = 16/55 (29%), Positives = 27/55 (49%)
 Frame = +2

Query: 488 VKMIGTAISTSSQQDYSRTLKMVTSWRLGNTVEVSTTFCHVPSGFGMSSPSRYFP 652
           VK++   +  + +Q Y+ +  ++       T+   T +C VP GF    PS YFP
Sbjct: 585 VKILQRTLHLTCKQGYTLSCNLLHHLLRSTTLIYPTEYCSVPGGFD-KPPSEYFP 638


>BC112169-1|AAI12170.1| 1729|Homo sapiens proteasome (prosome,
           macropain) activator subunit 4 protein.
          Length = 1729

 Score = 32.7 bits (71), Expect = 1.4
 Identities = 16/55 (29%), Positives = 27/55 (49%)
 Frame = +2

Query: 488 VKMIGTAISTSSQQDYSRTLKMVTSWRLGNTVEVSTTFCHVPSGFGMSSPSRYFP 652
           VK++   +  + +Q Y+ +  ++       T+   T +C VP GF    PS YFP
Sbjct: 585 VKILQRTLHLTCKQGYTLSCNLLHHLLRSTTLIYPTEYCSVPGGFD-KPPSEYFP 638


>AY894756-1|AAX83871.1| 1210|Homo sapiens proteasome activator 200
           kDa i protein.
          Length = 1210

 Score = 32.7 bits (71), Expect = 1.4
 Identities = 16/55 (29%), Positives = 27/55 (49%)
 Frame = +2

Query: 488 VKMIGTAISTSSQQDYSRTLKMVTSWRLGNTVEVSTTFCHVPSGFGMSSPSRYFP 652
           VK++   +  + +Q Y+ +  ++       T+   T +C VP GF    PS YFP
Sbjct: 699 VKILQRTLHLTRKQGYTLSCNLLHHLLRSTTLIYPTEYCSVPGGFD-KPPSEYFP 752


>AY894754-1|AAX83869.1| 1218|Homo sapiens proteasome activator 200
           kDa ii protein.
          Length = 1218

 Score = 32.7 bits (71), Expect = 1.4
 Identities = 16/55 (29%), Positives = 27/55 (49%)
 Frame = +2

Query: 488 VKMIGTAISTSSQQDYSRTLKMVTSWRLGNTVEVSTTFCHVPSGFGMSSPSRYFP 652
           VK++   +  + +Q Y+ +  ++       T+   T +C VP GF    PS YFP
Sbjct: 74  VKILQRTLHLTCKQGYTLSCNLLHHLLRSTTLIYPTEYCSVPGGFD-KPPSEYFP 127


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 116,929,261
Number of Sequences: 237096
Number of extensions: 2703670
Number of successful extensions: 8350
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 8005
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8350
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8511181328
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -