SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20041
         (743 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC003176-1|AAH03176.1|  475|Homo sapiens CNDP dipeptidase 2 (met...   105   2e-22
BC001375-1|AAH01375.1|  475|Homo sapiens CNDP dipeptidase 2 (met...   105   2e-22
AJ347717-1|CAC69883.1|  475|Homo sapiens glutamate carboxypeptid...   103   9e-22
AK001692-1|BAA91840.1|  475|Homo sapiens protein ( Homo sapiens ...   102   2e-21
BC117122-1|AAI17123.1|  508|Homo sapiens carnosine dipeptidase 1...    88   3e-17
BC113512-1|AAI13513.1|  507|Homo sapiens carnosine dipeptidase 1...    88   3e-17
BC110295-1|AAI10296.1|  508|Homo sapiens carnosine dipeptidase 1...    88   3e-17
AY358756-1|AAQ89116.1|  507|Homo sapiens DPKL1915 protein.             88   3e-17
AJ417564-1|CAD10388.1|  508|Homo sapiens glutamate carboxypeptid...    88   4e-17
AK024471-1|BAB15761.1|  276|Homo sapiens FLJ00064 protein protein.     58   4e-08
AK001262-1|BAA91587.1|  311|Homo sapiens protein ( Homo sapiens ...    58   4e-08
AF258592-1|AAG23795.1|  391|Homo sapiens PP856 protein.                58   4e-08
BC039170-1|AAH39170.1|  502|Homo sapiens hypothetical protein FL...    48   5e-05
BC063477-1|AAH63477.1|  502|Homo sapiens hypothetical protein FL...    44   4e-04
AK057131-1|BAB71368.1|  361|Homo sapiens protein ( Homo sapiens ...    44   4e-04

>BC003176-1|AAH03176.1|  475|Homo sapiens CNDP dipeptidase 2
           (metallopeptidase M20 family) protein.
          Length = 475

 Score =  105 bits (251), Expect = 2e-22
 Identities = 48/87 (55%), Positives = 61/87 (70%), Gaps = 1/87 (1%)
 Frame = +3

Query: 252 ADKLKEVGATTELRDVGFQTI-DGKDVQXXXXXXXXXXNDPKKNTVCIYGHLDVQPALKS 428
           A  +K++G + EL D+G Q + DG ++           +DP+K TVCIYGHLDVQPA   
Sbjct: 49  AADVKQLGGSVELVDIGKQKLPDGSEIPLPPILLGRLGSDPQKKTVCIYGHLDVQPAALE 108

Query: 429 DGWETEPFELVERNEKLYGRGSTDDKG 509
           DGW++EPF LVER+ KLYGRGSTDDKG
Sbjct: 109 DGWDSEPFTLVERDGKLYGRGSTDDKG 135



 Score = 57.6 bits (133), Expect = 4e-08
 Identities = 26/41 (63%), Positives = 29/41 (70%)
 Frame = +1

Query: 619 LDSLLMDKLKPEGFFDSVDYVCISDNYWLGTTKPCITNGLR 741
           LD L+    + + FF  VDYVCISDNYWLG  KPCIT GLR
Sbjct: 173 LDELIF--ARKDTFFKDVDYVCISDNYWLGKKKPCITYGLR 211



 Score = 56.4 bits (130), Expect = 1e-07
 Identities = 23/38 (60%), Positives = 30/38 (78%)
 Frame = +2

Query: 509 PVLGWLHTINAYKGTGAELPVNLKFIFECMEESGSEGL 622
           PV GW++ + AY+ TG E+PVN++F  E MEESGSEGL
Sbjct: 136 PVAGWINALEAYQKTGQEIPVNVRFCLEGMEESGSEGL 173



 Score = 35.9 bits (79), Expect = 0.15
 Identities = 18/42 (42%), Positives = 27/42 (64%)
 Frame = +1

Query: 118 LPEIFKYVDQNKDSYKQLLKEAVAIPSVSCDVKYRADCIRMV 243
           L  +FKY+D+N+D Y + L + VAI SVS   + R +  RM+
Sbjct: 4   LTTLFKYIDENQDRYIKKLAKWVAIQSVSAWPEKRGEIRRMM 45


>BC001375-1|AAH01375.1|  475|Homo sapiens CNDP dipeptidase 2
           (metallopeptidase M20 family) protein.
          Length = 475

 Score =  105 bits (251), Expect = 2e-22
 Identities = 48/87 (55%), Positives = 61/87 (70%), Gaps = 1/87 (1%)
 Frame = +3

Query: 252 ADKLKEVGATTELRDVGFQTI-DGKDVQXXXXXXXXXXNDPKKNTVCIYGHLDVQPALKS 428
           A  +K++G + EL D+G Q + DG ++           +DP+K TVCIYGHLDVQPA   
Sbjct: 49  AADVKQLGGSVELVDIGKQKLPDGSEIPLPPILLGRLGSDPQKKTVCIYGHLDVQPAALE 108

Query: 429 DGWETEPFELVERNEKLYGRGSTDDKG 509
           DGW++EPF LVER+ KLYGRGSTDDKG
Sbjct: 109 DGWDSEPFTLVERDGKLYGRGSTDDKG 135



 Score = 57.6 bits (133), Expect = 4e-08
 Identities = 26/41 (63%), Positives = 29/41 (70%)
 Frame = +1

Query: 619 LDSLLMDKLKPEGFFDSVDYVCISDNYWLGTTKPCITNGLR 741
           LD L+    + + FF  VDYVCISDNYWLG  KPCIT GLR
Sbjct: 173 LDELIF--ARKDTFFKDVDYVCISDNYWLGKKKPCITYGLR 211



 Score = 56.4 bits (130), Expect = 1e-07
 Identities = 23/38 (60%), Positives = 30/38 (78%)
 Frame = +2

Query: 509 PVLGWLHTINAYKGTGAELPVNLKFIFECMEESGSEGL 622
           PV GW++ + AY+ TG E+PVN++F  E MEESGSEGL
Sbjct: 136 PVAGWINALEAYQKTGQEIPVNVRFCLEGMEESGSEGL 173



 Score = 35.9 bits (79), Expect = 0.15
 Identities = 18/42 (42%), Positives = 27/42 (64%)
 Frame = +1

Query: 118 LPEIFKYVDQNKDSYKQLLKEAVAIPSVSCDVKYRADCIRMV 243
           L  +FKY+D+N+D Y + L + VAI SVS   + R +  RM+
Sbjct: 4   LTTLFKYIDENQDRYIKKLAKWVAIQSVSAWPEKRGEIRRMM 45


>AJ347717-1|CAC69883.1|  475|Homo sapiens glutamate carboxypeptidase
           protein.
          Length = 475

 Score =  103 bits (246), Expect = 9e-22
 Identities = 47/87 (54%), Positives = 61/87 (70%), Gaps = 1/87 (1%)
 Frame = +3

Query: 252 ADKLKEVGATTELRDVGFQTI-DGKDVQXXXXXXXXXXNDPKKNTVCIYGHLDVQPALKS 428
           A  +K++G + EL D+G Q + DG ++           +DP+K TVCIYGHLDVQPA   
Sbjct: 49  AADVKQLGGSVELVDIGKQKLPDGSEIPLPPILLGRLGSDPQKKTVCIYGHLDVQPAALE 108

Query: 429 DGWETEPFELVERNEKLYGRGSTDDKG 509
           DGW++EPF LVER+ KL+GRGSTDDKG
Sbjct: 109 DGWDSEPFTLVERDGKLHGRGSTDDKG 135



 Score = 57.6 bits (133), Expect = 4e-08
 Identities = 26/41 (63%), Positives = 29/41 (70%)
 Frame = +1

Query: 619 LDSLLMDKLKPEGFFDSVDYVCISDNYWLGTTKPCITNGLR 741
           LD L+    + + FF  VDYVCISDNYWLG  KPCIT GLR
Sbjct: 173 LDELIF--ARKDTFFKDVDYVCISDNYWLGKKKPCITYGLR 211



 Score = 56.4 bits (130), Expect = 1e-07
 Identities = 23/38 (60%), Positives = 30/38 (78%)
 Frame = +2

Query: 509 PVLGWLHTINAYKGTGAELPVNLKFIFECMEESGSEGL 622
           PV GW++ + AY+ TG E+PVN++F  E MEESGSEGL
Sbjct: 136 PVAGWINALEAYQKTGQEIPVNVRFCLEGMEESGSEGL 173



 Score = 35.9 bits (79), Expect = 0.15
 Identities = 18/42 (42%), Positives = 27/42 (64%)
 Frame = +1

Query: 118 LPEIFKYVDQNKDSYKQLLKEAVAIPSVSCDVKYRADCIRMV 243
           L  +FKY+D+N+D Y + L + VAI SVS   + R +  RM+
Sbjct: 4   LTTLFKYIDENQDRYIKKLAKWVAIQSVSAWPEKRGEIRRMM 45


>AK001692-1|BAA91840.1|  475|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10830 fis, clone NT2RP4001143, weakly similar to
           SUCCINYL-DIAMINOPIMELATE DESUCCINYLASE (EC 3.5.1.18). ).
          Length = 475

 Score =  102 bits (244), Expect = 2e-21
 Identities = 47/87 (54%), Positives = 60/87 (68%), Gaps = 1/87 (1%)
 Frame = +3

Query: 252 ADKLKEVGATTELRDVGFQTI-DGKDVQXXXXXXXXXXNDPKKNTVCIYGHLDVQPALKS 428
           A  +K++G + EL D+G Q + DG ++           +DP+K TVCIYGHLDVQPA   
Sbjct: 49  AADVKQLGGSVELVDIGKQKLPDGSEIPLPPILLGRLGSDPQKKTVCIYGHLDVQPAALE 108

Query: 429 DGWETEPFELVERNEKLYGRGSTDDKG 509
           DGW++EPF LVER+ KLYG GSTDDKG
Sbjct: 109 DGWDSEPFTLVERDGKLYGGGSTDDKG 135



 Score = 57.6 bits (133), Expect = 4e-08
 Identities = 26/41 (63%), Positives = 29/41 (70%)
 Frame = +1

Query: 619 LDSLLMDKLKPEGFFDSVDYVCISDNYWLGTTKPCITNGLR 741
           LD L+    + + FF  VDYVCISDNYWLG  KPCIT GLR
Sbjct: 173 LDELIF--ARKDTFFKDVDYVCISDNYWLGKKKPCITYGLR 211



 Score = 56.4 bits (130), Expect = 1e-07
 Identities = 23/38 (60%), Positives = 30/38 (78%)
 Frame = +2

Query: 509 PVLGWLHTINAYKGTGAELPVNLKFIFECMEESGSEGL 622
           PV GW++ + AY+ TG E+PVN++F  E MEESGSEGL
Sbjct: 136 PVAGWINALEAYQKTGQEIPVNVRFCLEGMEESGSEGL 173



 Score = 35.9 bits (79), Expect = 0.15
 Identities = 18/42 (42%), Positives = 27/42 (64%)
 Frame = +1

Query: 118 LPEIFKYVDQNKDSYKQLLKEAVAIPSVSCDVKYRADCIRMV 243
           L  +FKY+D+N+D Y + L + VAI SVS   + R +  RM+
Sbjct: 4   LTTLFKYIDENQDRYIKKLAKWVAIQSVSAWPEKRGEIRRMM 45


>BC117122-1|AAI17123.1|  508|Homo sapiens carnosine dipeptidase 1
           (metallopeptidase M20 family) protein.
          Length = 508

 Score = 88.2 bits (209), Expect = 3e-17
 Identities = 46/102 (45%), Positives = 59/102 (57%), Gaps = 1/102 (0%)
 Frame = +3

Query: 252 ADKLKEVGATTELRDVGFQTI-DGKDVQXXXXXXXXXXNDPKKNTVCIYGHLDVQPALKS 428
           AD L+ +GA     D+G Q + DG+ +           +DP K TVC YGHLDVQPA + 
Sbjct: 83  ADTLQRLGARVASVDMGPQQLPDGQSLPIPPVILAELGSDPTKGTVCFYGHLDVQPADRG 142

Query: 429 DGWETEPFELVERNEKLYGRGSTDDKGLYLVGCIPSMPIRAL 554
           DGW T+P+ L E + KLYGRG+TD+KG  L         RAL
Sbjct: 143 DGWLTDPYVLTEVDGKLYGRGATDNKGPVLAWINAVSAFRAL 184



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 19/38 (50%), Positives = 28/38 (73%)
 Frame = +2

Query: 509 PVLGWLHTINAYKGTGAELPVNLKFIFECMEESGSEGL 622
           PVL W++ ++A++    +LPVN+KFI E MEE+GS  L
Sbjct: 170 PVLAWINAVSAFRALEQDLPVNIKFIIEGMEEAGSVAL 207



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 19/37 (51%), Positives = 24/37 (64%)
 Frame = +1

Query: 631 LMDKLKPEGFFDSVDYVCISDNYWLGTTKPCITNGLR 741
           L++K K + FF  VDY+ ISDN W+   KP IT G R
Sbjct: 210 LVEKEK-DRFFSGVDYIVISDNLWISQRKPAITYGTR 245



 Score = 33.5 bits (73), Expect = 0.82
 Identities = 17/44 (38%), Positives = 28/44 (63%), Gaps = 2/44 (4%)
 Frame = +1

Query: 118 LPEIFKYVDQNKDSYKQLLKEAVAIPSVSCD--VKYRADCIRMV 243
           L ++F+Y+D ++D + Q LKE VAI S S     ++R +  RM+
Sbjct: 36  LEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMM 79


>BC113512-1|AAI13513.1|  507|Homo sapiens carnosine dipeptidase 1
           (metallopeptidase M20 family) protein.
          Length = 507

 Score = 88.2 bits (209), Expect = 3e-17
 Identities = 46/102 (45%), Positives = 59/102 (57%), Gaps = 1/102 (0%)
 Frame = +3

Query: 252 ADKLKEVGATTELRDVGFQTI-DGKDVQXXXXXXXXXXNDPKKNTVCIYGHLDVQPALKS 428
           AD L+ +GA     D+G Q + DG+ +           +DP K TVC YGHLDVQPA + 
Sbjct: 82  ADTLQRLGARVASVDMGPQQLPDGQSLPIPPVILAELGSDPTKGTVCFYGHLDVQPADRG 141

Query: 429 DGWETEPFELVERNEKLYGRGSTDDKGLYLVGCIPSMPIRAL 554
           DGW T+P+ L E + KLYGRG+TD+KG  L         RAL
Sbjct: 142 DGWLTDPYVLTEVDGKLYGRGATDNKGPVLAWINAVSAFRAL 183



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 19/38 (50%), Positives = 28/38 (73%)
 Frame = +2

Query: 509 PVLGWLHTINAYKGTGAELPVNLKFIFECMEESGSEGL 622
           PVL W++ ++A++    +LPVN+KFI E MEE+GS  L
Sbjct: 169 PVLAWINAVSAFRALEQDLPVNIKFIIEGMEEAGSVAL 206



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 19/37 (51%), Positives = 24/37 (64%)
 Frame = +1

Query: 631 LMDKLKPEGFFDSVDYVCISDNYWLGTTKPCITNGLR 741
           L++K K + FF  VDY+ ISDN W+   KP IT G R
Sbjct: 209 LVEKEK-DRFFSGVDYIVISDNLWISQRKPAITYGTR 244



 Score = 33.5 bits (73), Expect = 0.82
 Identities = 17/44 (38%), Positives = 28/44 (63%), Gaps = 2/44 (4%)
 Frame = +1

Query: 118 LPEIFKYVDQNKDSYKQLLKEAVAIPSVSCD--VKYRADCIRMV 243
           L ++F+Y+D ++D + Q LKE VAI S S     ++R +  RM+
Sbjct: 35  LEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMM 78


>BC110295-1|AAI10296.1|  508|Homo sapiens carnosine dipeptidase 1
           (metallopeptidase M20 family) protein.
          Length = 508

 Score = 88.2 bits (209), Expect = 3e-17
 Identities = 46/102 (45%), Positives = 59/102 (57%), Gaps = 1/102 (0%)
 Frame = +3

Query: 252 ADKLKEVGATTELRDVGFQTI-DGKDVQXXXXXXXXXXNDPKKNTVCIYGHLDVQPALKS 428
           AD L+ +GA     D+G Q + DG+ +           +DP K TVC YGHLDVQPA + 
Sbjct: 83  ADTLQRLGARVASVDMGPQQLPDGQSLPIPPVILAELGSDPTKGTVCFYGHLDVQPADRG 142

Query: 429 DGWETEPFELVERNEKLYGRGSTDDKGLYLVGCIPSMPIRAL 554
           DGW T+P+ L E + KLYGRG+TD+KG  L         RAL
Sbjct: 143 DGWLTDPYVLTEVDGKLYGRGATDNKGPVLAWINAVSAFRAL 184



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 19/38 (50%), Positives = 28/38 (73%)
 Frame = +2

Query: 509 PVLGWLHTINAYKGTGAELPVNLKFIFECMEESGSEGL 622
           PVL W++ ++A++    +LPVN+KFI E MEE+GS  L
Sbjct: 170 PVLAWINAVSAFRALEQDLPVNIKFIIEGMEEAGSVAL 207



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 19/37 (51%), Positives = 24/37 (64%)
 Frame = +1

Query: 631 LMDKLKPEGFFDSVDYVCISDNYWLGTTKPCITNGLR 741
           L++K K + FF  VDY+ ISDN W+   KP IT G R
Sbjct: 210 LVEKEK-DRFFSGVDYIVISDNLWISQRKPAITYGTR 245



 Score = 33.5 bits (73), Expect = 0.82
 Identities = 17/44 (38%), Positives = 28/44 (63%), Gaps = 2/44 (4%)
 Frame = +1

Query: 118 LPEIFKYVDQNKDSYKQLLKEAVAIPSVSCD--VKYRADCIRMV 243
           L ++F+Y+D ++D + Q LKE VAI S S     ++R +  RM+
Sbjct: 36  LEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMM 79


>AY358756-1|AAQ89116.1|  507|Homo sapiens DPKL1915 protein.
          Length = 507

 Score = 88.2 bits (209), Expect = 3e-17
 Identities = 46/102 (45%), Positives = 59/102 (57%), Gaps = 1/102 (0%)
 Frame = +3

Query: 252 ADKLKEVGATTELRDVGFQTI-DGKDVQXXXXXXXXXXNDPKKNTVCIYGHLDVQPALKS 428
           AD L+ +GA     D+G Q + DG+ +           +DP K TVC YGHLDVQPA + 
Sbjct: 82  ADTLQRLGARVASVDMGPQQLPDGQSLPIPPVILAELGSDPTKGTVCFYGHLDVQPADRG 141

Query: 429 DGWETEPFELVERNEKLYGRGSTDDKGLYLVGCIPSMPIRAL 554
           DGW T+P+ L E + KLYGRG+TD+KG  L         RAL
Sbjct: 142 DGWLTDPYVLTEVDGKLYGRGATDNKGPVLAWINAVSAFRAL 183



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 19/38 (50%), Positives = 28/38 (73%)
 Frame = +2

Query: 509 PVLGWLHTINAYKGTGAELPVNLKFIFECMEESGSEGL 622
           PVL W++ ++A++    +LPVN+KFI E MEE+GS  L
Sbjct: 169 PVLAWINAVSAFRALEQDLPVNIKFIIEGMEEAGSVAL 206



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 19/37 (51%), Positives = 24/37 (64%)
 Frame = +1

Query: 631 LMDKLKPEGFFDSVDYVCISDNYWLGTTKPCITNGLR 741
           L++K K + FF  VDY+ ISDN W+   KP IT G R
Sbjct: 209 LVEKEK-DRFFSGVDYIVISDNLWISQRKPAITYGTR 244



 Score = 33.5 bits (73), Expect = 0.82
 Identities = 17/44 (38%), Positives = 28/44 (63%), Gaps = 2/44 (4%)
 Frame = +1

Query: 118 LPEIFKYVDQNKDSYKQLLKEAVAIPSVSCD--VKYRADCIRMV 243
           L ++F+Y+D ++D + Q LKE VAI S S     ++R +  RM+
Sbjct: 35  LEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMM 78


>AJ417564-1|CAD10388.1|  508|Homo sapiens glutamate
           carboxypeptidase-like protein 2 protein.
          Length = 508

 Score = 87.8 bits (208), Expect = 4e-17
 Identities = 46/102 (45%), Positives = 58/102 (56%), Gaps = 1/102 (0%)
 Frame = +3

Query: 252 ADKLKEVGATTELRDVGFQTI-DGKDVQXXXXXXXXXXNDPKKNTVCIYGHLDVQPALKS 428
           AD L+ +GA     D+G Q + DG+ +           +DP K TVC YGHLDVQPA + 
Sbjct: 83  ADTLQRLGARVASVDMGPQQLPDGQSLPIPPVILAELGSDPTKGTVCFYGHLDVQPADRG 142

Query: 429 DGWETEPFELVERNEKLYGRGSTDDKGLYLVGCIPSMPIRAL 554
           DGW T+P+ L E   KLYGRG+TD+KG  L         RAL
Sbjct: 143 DGWLTDPYVLTEVGGKLYGRGATDNKGPVLAWINAVSAFRAL 184



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 19/38 (50%), Positives = 28/38 (73%)
 Frame = +2

Query: 509 PVLGWLHTINAYKGTGAELPVNLKFIFECMEESGSEGL 622
           PVL W++ ++A++    +LPVN+KFI E MEE+GS  L
Sbjct: 170 PVLAWINAVSAFRALEQDLPVNIKFIIEGMEEAGSVAL 207



 Score = 37.5 bits (83), Expect = 0.050
 Identities = 18/37 (48%), Positives = 23/37 (62%)
 Frame = +1

Query: 631 LMDKLKPEGFFDSVDYVCISDNYWLGTTKPCITNGLR 741
           L++K K + FF  VDY+ ISDN W+   K  IT G R
Sbjct: 210 LVEKEK-DRFFSGVDYIVISDNLWISQRKLAITYGTR 245



 Score = 33.5 bits (73), Expect = 0.82
 Identities = 17/44 (38%), Positives = 28/44 (63%), Gaps = 2/44 (4%)
 Frame = +1

Query: 118 LPEIFKYVDQNKDSYKQLLKEAVAIPSVSCD--VKYRADCIRMV 243
           L ++F+Y+D ++D + Q LKE VAI S S     ++R +  RM+
Sbjct: 36  LEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMM 79


>AK024471-1|BAB15761.1|  276|Homo sapiens FLJ00064 protein protein.
          Length = 276

 Score = 57.6 bits (133), Expect = 4e-08
 Identities = 26/41 (63%), Positives = 29/41 (70%)
 Frame = +1

Query: 619 LDSLLMDKLKPEGFFDSVDYVCISDNYWLGTTKPCITNGLR 741
           LD L+    + + FF  VDYVCISDNYWLG  KPCIT GLR
Sbjct: 49  LDELIF--ARKDTFFKDVDYVCISDNYWLGKKKPCITYGLR 87



 Score = 56.4 bits (130), Expect = 1e-07
 Identities = 23/38 (60%), Positives = 30/38 (78%)
 Frame = +2

Query: 509 PVLGWLHTINAYKGTGAELPVNLKFIFECMEESGSEGL 622
           PV GW++ + AY+ TG E+PVN++F  E MEESGSEGL
Sbjct: 12  PVAGWINALEAYQKTGQEIPVNVRFCLEGMEESGSEGL 49


>AK001262-1|BAA91587.1|  311|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10400 fis, clone NT2RM4000395. ).
          Length = 311

 Score = 57.6 bits (133), Expect = 4e-08
 Identities = 26/41 (63%), Positives = 29/41 (70%)
 Frame = +1

Query: 619 LDSLLMDKLKPEGFFDSVDYVCISDNYWLGTTKPCITNGLR 741
           LD L+    + + FF  VDYVCISDNYWLG  KPCIT GLR
Sbjct: 9   LDELIF--ARKDTFFKDVDYVCISDNYWLGKKKPCITYGLR 47


>AF258592-1|AAG23795.1|  391|Homo sapiens PP856 protein.
          Length = 391

 Score = 57.6 bits (133), Expect = 4e-08
 Identities = 26/41 (63%), Positives = 29/41 (70%)
 Frame = +1

Query: 619 LDSLLMDKLKPEGFFDSVDYVCISDNYWLGTTKPCITNGLR 741
           LD L+    + + FF  VDYVCISDNYWLG  KPCIT GLR
Sbjct: 89  LDELIF--ARKDTFFKDVDYVCISDNYWLGKKKPCITYGLR 127



 Score = 36.3 bits (80), Expect = 0.12
 Identities = 16/25 (64%), Positives = 19/25 (76%)
 Frame = +2

Query: 548 GTGAELPVNLKFIFECMEESGSEGL 622
           G   E+PVN++F  E MEESGSEGL
Sbjct: 65  GKQKEIPVNVRFCLEGMEESGSEGL 89



 Score = 35.9 bits (79), Expect = 0.15
 Identities = 18/42 (42%), Positives = 27/42 (64%)
 Frame = +1

Query: 118 LPEIFKYVDQNKDSYKQLLKEAVAIPSVSCDVKYRADCIRMV 243
           L  +FKY+D+N+D Y + L + VAI SVS   + R +  RM+
Sbjct: 4   LTTLFKYIDENQDRYIKKLAKWVAIQSVSAWPEKRGEIRRMM 45


>BC039170-1|AAH39170.1|  502|Homo sapiens hypothetical protein
           FLJ32569 protein.
          Length = 502

 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 21/48 (43%), Positives = 28/48 (58%)
 Frame = +3

Query: 363 NDPKKNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDK 506
           +DP      +  H DV PA   +GWE  PF  +ER+  +YGRG+ DDK
Sbjct: 113 SDPSLQPYLLMAHFDVVPA-PEEGWEVPPFSGLERDGVIYGRGTLDDK 159


>BC063477-1|AAH63477.1|  502|Homo sapiens hypothetical protein
           FLJ32569 protein.
          Length = 502

 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 20/48 (41%), Positives = 27/48 (56%)
 Frame = +3

Query: 363 NDPKKNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDK 506
           +DP      +  H DV PA   +GWE  PF  +ER+  +YG G+ DDK
Sbjct: 113 SDPSLQPYLLMAHFDVVPA-PEEGWEVPPFSGLERDGVIYGWGTLDDK 159


>AK057131-1|BAB71368.1|  361|Homo sapiens protein ( Homo sapiens
           cDNA FLJ32569 fis, clone SPLEN2000134, weakly similar to
           CARBOXYPEPTIDASE S PRECURSOR (EC 3.4.17.4). ).
          Length = 361

 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 20/48 (41%), Positives = 27/48 (56%)
 Frame = +3

Query: 363 NDPKKNTVCIYGHLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDK 506
           +DP      +  H DV PA   +GWE  PF  +ER+  +YG G+ DDK
Sbjct: 113 SDPSLQPYLLMAHFDVVPA-PEEGWEVPPFSGLERDGVIYGWGTLDDK 159


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 113,931,854
Number of Sequences: 237096
Number of extensions: 2476439
Number of successful extensions: 5032
Number of sequences better than 10.0: 15
Number of HSP's better than 10.0 without gapping: 4792
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5032
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8903143626
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -