SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20040
         (701 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X03487-1|CAA27205.1|  183|Homo sapiens apoferritin H subunit pro...    48   3e-05
X00318-1|CAA25086.1|  190|Homo sapiens  frequency transformation...    48   3e-05
M97164-1|AAA35832.1|  183|Homo sapiens ferritin protein.               48   3e-05
M14212-1|AAA52438.1|  183|Homo sapiens protein ( Human ferritin ...    48   3e-05
M12937-1|AAA35830.1|  183|Homo sapiens protein ( Human ferritin ...    48   3e-05
M11146-1|AAA52437.1|  183|Homo sapiens FTH1 protein.                   48   3e-05
L20941-1|AAA35833.1|  183|Homo sapiens ferritin heavy chain prot...    48   3e-05
DQ496108-1|ABF47097.1|  183|Homo sapiens ferritin, heavy polypep...    48   3e-05
BC105802-1|AAI05803.1|  245|Homo sapiens FTH1 protein protein.         48   3e-05
BC104643-1|AAI04644.1|  183|Homo sapiens ferritin, heavy polypep...    48   3e-05
BC073750-1|AAH73750.1|  183|Homo sapiens ferritin, heavy polypep...    48   3e-05
BC070494-1|AAH70494.1|  232|Homo sapiens FTH1 protein protein.         48   3e-05
BC066961-1|AAH66961.1|  183|Homo sapiens ferritin, heavy polypep...    48   3e-05
BC066341-1|AAH66341.1|  183|Homo sapiens FTH1 protein protein.         48   3e-05
BC063514-1|AAH63514.1|  183|Homo sapiens ferritin, heavy polypep...    48   3e-05
BC016857-1|AAH16857.1|  183|Homo sapiens ferritin, heavy polypep...    48   3e-05
BC016009-1|AAH16009.1|  183|Homo sapiens ferritin, heavy polypep...    48   3e-05
BC015156-1|AAH15156.1|  183|Homo sapiens ferritin, heavy polypep...    48   3e-05
BC013724-1|AAH13724.1|  183|Homo sapiens ferritin, heavy polypep...    48   3e-05
BC011359-1|AAH11359.1|  183|Homo sapiens ferritin, heavy polypep...    48   3e-05
BC001399-1|AAH01399.1|  183|Homo sapiens ferritin, heavy polypep...    48   3e-05
BC000857-1|AAH00857.1|  183|Homo sapiens ferritin, heavy polypep...    48   3e-05
AY258285-1|AAP82230.1|  183|Homo sapiens proliferation-inducing ...    48   3e-05
AY033611-1|AAK55486.1|  165|Homo sapiens placenta immunoregulato...    48   3e-05
AF088851-1|AAF89523.1|  183|Homo sapiens ferritin heavy chain su...    48   3e-05
AB062402-1|BAB93489.1|  183|Homo sapiens ferritin-heavy polypept...    48   3e-05
BC034419-1|AAH34419.1|  242|Homo sapiens ferritin mitochondrial ...    44   4e-04
BC073777-1|AAH73777.1|  103|Homo sapiens FTHL3 protein protein.        44   5e-04
M12938-1|AAA52440.1|  143|Homo sapiens FTL protein.                    37   0.080
M11147-1|AAA52439.1|  175|Homo sapiens FTL protein.                    37   0.080
M10119-1|AAA35831.1|  175|Homo sapiens protein ( Human ferritin ...    37   0.080
CR456715-1|CAG32996.1|  175|Homo sapiens FTL protein.                  37   0.080
BX571748-1|CAE11873.1|  241|Homo sapiens hypothetical protein pr...    37   0.080
BC100770-1|AAI00771.1|  183|Homo sapiens ferritin, heavy polypep...    37   0.080
BC100769-1|AAI00770.1|  183|Homo sapiens ferritin, heavy polypep...    37   0.080
BC100768-1|AAI00769.1|  183|Homo sapiens ferritin, heavy polypep...    37   0.080
BC069538-1|AAH69538.2|  183|Homo sapiens ferritin, heavy polypep...    37   0.080
BC069069-1|AAH69069.2|  183|Homo sapiens ferritin, heavy polypep...    37   0.080
BC062708-1|AAH62708.1|  175|Homo sapiens ferritin, light polypep...    37   0.080
BC058820-1|AAH58820.1|  175|Homo sapiens FTL protein protein.          37   0.080
BC021670-1|AAH21670.1|  175|Homo sapiens ferritin, light polypep...    37   0.080
BC018990-1|AAH18990.1|  175|Homo sapiens ferritin, light polypep...    37   0.080
BC016715-1|AAH16715.1|  175|Homo sapiens ferritin, light polypep...    37   0.080
BC016354-1|AAH16354.1|  175|Homo sapiens ferritin, light polypep...    37   0.080
BC016346-1|AAH16346.1|  175|Homo sapiens ferritin, light polypep...    37   0.080
BC008439-1|AAH08439.1|  175|Homo sapiens ferritin, light polypep...    37   0.080
BC004245-1|AAH04245.1|  175|Homo sapiens ferritin, light polypep...    37   0.080
BC002991-1|AAH02991.2|  175|Homo sapiens ferritin, light polypep...    37   0.080
AY466472-1|AAS45711.1|  191|Homo sapiens ferritin light polypept...    37   0.080
AY207005-1|AAO52739.1|  175|Homo sapiens ferritin-like protein p...    37   0.080
AF285592-1|AAK31971.1|  183|Homo sapiens ferritin heavy polypept...    37   0.080
X03742-1|CAA27382.1|   83|Homo sapiens L apoferritin protein.          33   0.75 
DQ094831-1|AAZ04400.1|   83|Homo sapiens ferritin light chain pr...    33   0.75 
DQ094830-1|AAZ04399.1|   83|Homo sapiens ferritin light chain pr...    33   0.75 
BC067772-1|AAH67772.1|  107|Homo sapiens FTL protein protein.          33   0.75 
BC013928-1|AAH13928.1|  175|Homo sapiens ferritin, light polypep...    33   0.75 
AF274934-1|AAK07513.1|   82|Homo sapiens PNAS-9 protein.               30   7.0  
AL591545-1|CAI40663.1|  724|Homo sapiens RP11-419L10.1 protein.        30   9.2  
AL162578-1|CAI40011.1|  724|Homo sapiens RP11-419L10.1 protein.        30   9.2  
AL049820-1|CAI42304.1|  724|Homo sapiens RP11-419L10.1 protein.        30   9.2  

>X03487-1|CAA27205.1|  183|Homo sapiens apoferritin H subunit
           protein.
          Length = 183

 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 26/58 (44%), Positives = 32/58 (55%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           + +QI  E+ AS  YL+M  YF  D V    FAK F   + EEREHA KL+     RG
Sbjct: 21  INRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRG 78


>X00318-1|CAA25086.1|  190|Homo sapiens  frequency transformation
           while RE is essential   protein.
          Length = 190

 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 26/58 (44%), Positives = 32/58 (55%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           + +QI  E+ AS  YL+M  YF  D V    FAK F   + EEREHA KL+     RG
Sbjct: 21  INRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRG 78


>M97164-1|AAA35832.1|  183|Homo sapiens ferritin protein.
          Length = 183

 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 26/58 (44%), Positives = 32/58 (55%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           + +QI  E+ AS  YL+M  YF  D V    FAK F   + EEREHA KL+     RG
Sbjct: 21  INRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRG 78


>M14212-1|AAA52438.1|  183|Homo sapiens protein ( Human ferritin
           heavy-chain gene, exons 2, 3 and 4. ).
          Length = 183

 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 26/58 (44%), Positives = 32/58 (55%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           + +QI  E+ AS  YL+M  YF  D V    FAK F   + EEREHA KL+     RG
Sbjct: 21  INRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRG 78


>M12937-1|AAA35830.1|  183|Homo sapiens protein ( Human ferritin
           Heavy subunit mRNA, complete cds. ).
          Length = 183

 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 26/58 (44%), Positives = 32/58 (55%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           + +QI  E+ AS  YL+M  YF  D V    FAK F   + EEREHA KL+     RG
Sbjct: 21  INRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRG 78


>M11146-1|AAA52437.1|  183|Homo sapiens FTH1 protein.
          Length = 183

 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 26/58 (44%), Positives = 32/58 (55%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           + +QI  E+ AS  YL+M  YF  D V    FAK F   + EEREHA KL+     RG
Sbjct: 21  INRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRG 78


>L20941-1|AAA35833.1|  183|Homo sapiens ferritin heavy chain
           protein.
          Length = 183

 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 26/58 (44%), Positives = 32/58 (55%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           + +QI  E+ AS  YL+M  YF  D V    FAK F   + EEREHA KL+     RG
Sbjct: 21  INRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRG 78


>DQ496108-1|ABF47097.1|  183|Homo sapiens ferritin, heavy
           polypeptide 1 protein.
          Length = 183

 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 26/58 (44%), Positives = 32/58 (55%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           + +QI  E+ AS  YL+M  YF  D V    FAK F   + EEREHA KL+     RG
Sbjct: 21  INRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRG 78


>BC105802-1|AAI05803.1|  245|Homo sapiens FTH1 protein protein.
          Length = 245

 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 26/58 (44%), Positives = 32/58 (55%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           + +QI  E+ AS  YL+M  YF  D V    FAK F   + EEREHA KL+     RG
Sbjct: 83  INRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRG 140


>BC104643-1|AAI04644.1|  183|Homo sapiens ferritin, heavy
           polypeptide 1 protein.
          Length = 183

 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 26/58 (44%), Positives = 32/58 (55%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           + +QI  E+ AS  YL+M  YF  D V    FAK F   + EEREHA KL+     RG
Sbjct: 21  INRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRG 78


>BC073750-1|AAH73750.1|  183|Homo sapiens ferritin, heavy
           polypeptide 1 protein.
          Length = 183

 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 26/58 (44%), Positives = 32/58 (55%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           + +QI  E+ AS  YL+M  YF  D V    FAK F   + EEREHA KL+     RG
Sbjct: 21  INRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRG 78


>BC070494-1|AAH70494.1|  232|Homo sapiens FTH1 protein protein.
          Length = 232

 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 26/58 (44%), Positives = 32/58 (55%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           + +QI  E+ AS  YL+M  YF  D V    FAK F   + EEREHA KL+     RG
Sbjct: 70  INRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRG 127


>BC066961-1|AAH66961.1|  183|Homo sapiens ferritin, heavy
           polypeptide 1 protein.
          Length = 183

 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 26/58 (44%), Positives = 32/58 (55%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           + +QI  E+ AS  YL+M  YF  D V    FAK F   + EEREHA KL+     RG
Sbjct: 21  INRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRG 78


>BC066341-1|AAH66341.1|  183|Homo sapiens FTH1 protein protein.
          Length = 183

 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 26/58 (44%), Positives = 32/58 (55%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           + +QI  E+ AS  YL+M  YF  D V    FAK F   + EEREHA KL+     RG
Sbjct: 21  INRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRG 78


>BC063514-1|AAH63514.1|  183|Homo sapiens ferritin, heavy
           polypeptide 1 protein.
          Length = 183

 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 26/58 (44%), Positives = 32/58 (55%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           + +QI  E+ AS  YL+M  YF  D V    FAK F   + EEREHA KL+     RG
Sbjct: 21  INRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRG 78


>BC016857-1|AAH16857.1|  183|Homo sapiens ferritin, heavy
           polypeptide 1 protein.
          Length = 183

 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 26/58 (44%), Positives = 32/58 (55%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           + +QI  E+ AS  YL+M  YF  D V    FAK F   + EEREHA KL+     RG
Sbjct: 21  INRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRG 78


>BC016009-1|AAH16009.1|  183|Homo sapiens ferritin, heavy
           polypeptide 1 protein.
          Length = 183

 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 26/58 (44%), Positives = 32/58 (55%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           + +QI  E+ AS  YL+M  YF  D V    FAK F   + EEREHA KL+     RG
Sbjct: 21  INRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRG 78


>BC015156-1|AAH15156.1|  183|Homo sapiens ferritin, heavy
           polypeptide 1 protein.
          Length = 183

 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 26/58 (44%), Positives = 32/58 (55%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           + +QI  E+ AS  YL+M  YF  D V    FAK F   + EEREHA KL+     RG
Sbjct: 21  INRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRG 78


>BC013724-1|AAH13724.1|  183|Homo sapiens ferritin, heavy
           polypeptide 1 protein.
          Length = 183

 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 26/58 (44%), Positives = 32/58 (55%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           + +QI  E+ AS  YL+M  YF  D V    FAK F   + EEREHA KL+     RG
Sbjct: 21  INRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRG 78


>BC011359-1|AAH11359.1|  183|Homo sapiens ferritin, heavy
           polypeptide 1 protein.
          Length = 183

 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 26/58 (44%), Positives = 32/58 (55%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           + +QI  E+ AS  YL+M  YF  D V    FAK F   + EEREHA KL+     RG
Sbjct: 21  INRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRG 78


>BC001399-1|AAH01399.1|  183|Homo sapiens ferritin, heavy
           polypeptide 1 protein.
          Length = 183

 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 26/58 (44%), Positives = 32/58 (55%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           + +QI  E+ AS  YL+M  YF  D V    FAK F   + EEREHA KL+     RG
Sbjct: 21  INRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRG 78


>BC000857-1|AAH00857.1|  183|Homo sapiens ferritin, heavy
           polypeptide 1 protein.
          Length = 183

 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 26/58 (44%), Positives = 32/58 (55%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           + +QI  E+ AS  YL+M  YF  D V    FAK F   + EEREHA KL+     RG
Sbjct: 21  INRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRG 78


>AY258285-1|AAP82230.1|  183|Homo sapiens proliferation-inducing
           protein 15 protein.
          Length = 183

 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 26/58 (44%), Positives = 32/58 (55%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           + +QI  E+ AS  YL+M  YF  D V    FAK F   + EEREHA KL+     RG
Sbjct: 21  INRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRG 78


>AY033611-1|AAK55486.1|  165|Homo sapiens placenta immunoregulatory
           factor PLIF protein.
          Length = 165

 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 26/58 (44%), Positives = 32/58 (55%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           + +QI  E+ AS  YL+M  YF  D V    FAK F   + EEREHA KL+     RG
Sbjct: 21  INRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRG 78


>AF088851-1|AAF89523.1|  183|Homo sapiens ferritin heavy chain
           subunit protein.
          Length = 183

 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 26/58 (44%), Positives = 32/58 (55%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           + +QI  E+ AS  YL+M  YF  D V    FAK F   + EEREHA KL+     RG
Sbjct: 21  INRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRG 78


>AB062402-1|BAB93489.1|  183|Homo sapiens ferritin-heavy polypeptide
           1 protein.
          Length = 183

 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 26/58 (44%), Positives = 32/58 (55%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           + +QI  E+ AS  YL+M  YF  D V    FAK F   + EEREHA KL+     RG
Sbjct: 21  INRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRG 78


>BC034419-1|AAH34419.1|  242|Homo sapiens ferritin mitochondrial
           protein.
          Length = 242

 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 24/58 (41%), Positives = 32/58 (55%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           + +QI  E+ AS  YL+M  YFS D V    F++ F   + EE EHA KL+     RG
Sbjct: 80  INRQINLELYASYVYLSMAYYFSRDDVALNNFSRYFLHQSREETEHAEKLMRLQNQRG 137


>BC073777-1|AAH73777.1|  103|Homo sapiens FTHL3 protein protein.
          Length = 103

 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 23/51 (45%), Positives = 29/51 (56%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLI 446
           + +QI  E+ AS  YL +  YF  D V    FAK F   + EEREHA KL+
Sbjct: 51  INRQINLELYASSIYLCVAYYFDSDDVALKNFAKYFLHQSHEEREHAEKLM 101


>M12938-1|AAA52440.1|  143|Homo sapiens FTL protein.
          Length = 143

 Score = 36.7 bits (81), Expect = 0.080
 Identities = 18/60 (30%), Positives = 31/60 (51%)
 Frame = +2

Query: 500 VQGPANTSWESGASALEHALKLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLDEQYK 679
           ++ PA   W     A++ A+ LE  +  ++ + +    S+  D HL D+L   FLDE+ K
Sbjct: 50  IKKPAEDEWGKTPDAMKAAMALEKKLNQALLD-LHALGSARTDPHLCDFLETHFLDEEVK 108


>M11147-1|AAA52439.1|  175|Homo sapiens FTL protein.
          Length = 175

 Score = 36.7 bits (81), Expect = 0.080
 Identities = 18/60 (30%), Positives = 31/60 (51%)
 Frame = +2

Query: 500 VQGPANTSWESGASALEHALKLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLDEQYK 679
           ++ PA   W     A++ A+ LE  +  ++ + +    S+  D HL D+L   FLDE+ K
Sbjct: 82  IKKPAEDEWGKTPDAMKAAMALEKKLNQALLD-LHALGSARTDPHLCDFLETHFLDEEVK 140



 Score = 33.5 bits (73), Expect = 0.75
 Identities = 18/48 (37%), Positives = 25/48 (52%)
 Frame = +3

Query: 324 ASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           AS  YL++G YF  D V   G +  F + A E+RE   +L+     RG
Sbjct: 27  ASYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQNQRG 74


>M10119-1|AAA35831.1|  175|Homo sapiens protein ( Human ferritin
           light subunit mRNA, complete cds. ).
          Length = 175

 Score = 36.7 bits (81), Expect = 0.080
 Identities = 18/60 (30%), Positives = 31/60 (51%)
 Frame = +2

Query: 500 VQGPANTSWESGASALEHALKLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLDEQYK 679
           ++ PA   W     A++ A+ LE  +  ++ + +    S+  D HL D+L   FLDE+ K
Sbjct: 82  IKKPAEDEWGKTPDAMKAAMTLEKKLNQALLD-LHALGSARTDPHLCDFLETHFLDEEVK 140



 Score = 33.5 bits (73), Expect = 0.75
 Identities = 18/48 (37%), Positives = 25/48 (52%)
 Frame = +3

Query: 324 ASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           AS  YL++G YF  D V   G +  F + A E+RE   +L+     RG
Sbjct: 27  ASYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQNQRG 74


>CR456715-1|CAG32996.1|  175|Homo sapiens FTL protein.
          Length = 175

 Score = 36.7 bits (81), Expect = 0.080
 Identities = 18/60 (30%), Positives = 31/60 (51%)
 Frame = +2

Query: 500 VQGPANTSWESGASALEHALKLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLDEQYK 679
           ++ PA   W     A++ A+ LE  +  ++ + +    S+  D HL D+L   FLDE+ K
Sbjct: 82  IKKPAEDEWGKTPDAMKAAMALEKKLNQALLD-LHALGSARTDPHLCDFLETHFLDEEVK 140



 Score = 33.5 bits (73), Expect = 0.75
 Identities = 18/48 (37%), Positives = 25/48 (52%)
 Frame = +3

Query: 324 ASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           AS  YL++G YF  D V   G +  F + A E+RE   +L+     RG
Sbjct: 27  ASYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQNQRG 74


>BX571748-1|CAE11873.1|  241|Homo sapiens hypothetical protein
           protein.
          Length = 241

 Score = 36.7 bits (81), Expect = 0.080
 Identities = 18/60 (30%), Positives = 31/60 (51%)
 Frame = +2

Query: 500 VQGPANTSWESGASALEHALKLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLDEQYK 679
           ++ PA   W     A++ A+ LE  +  ++ + +    S+  D HL D+L   FLDE+ K
Sbjct: 148 IKKPAEDEWGKTPDAMKAAMALEKKLNQALLD-LHALGSARTDPHLCDFLETHFLDEEVK 206



 Score = 33.5 bits (73), Expect = 0.75
 Identities = 18/48 (37%), Positives = 25/48 (52%)
 Frame = +3

Query: 324 ASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           AS  YL++G YF  D V   G +  F + A E+RE   +L+     RG
Sbjct: 93  ASYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQNQRG 140


>BC100770-1|AAI00771.1|  183|Homo sapiens ferritin, heavy
           polypeptide-like 17 protein.
          Length = 183

 Score = 36.7 bits (81), Expect = 0.080
 Identities = 20/65 (30%), Positives = 31/65 (47%)
 Frame = +3

Query: 273 EQTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDY 452
           +  C   +   I  E+  S  YL+M  YF+ D V    F + F   + ++ EHA KL+  
Sbjct: 14  DTNCDAAINSHITLELYTSYLYLSMAFYFNRDDVALENFFRYFLRLSDDKMEHAQKLMRL 73

Query: 453 LLMRG 467
             +RG
Sbjct: 74  QNLRG 78


>BC100769-1|AAI00770.1|  183|Homo sapiens ferritin, heavy
           polypeptide-like 17 protein.
          Length = 183

 Score = 36.7 bits (81), Expect = 0.080
 Identities = 20/65 (30%), Positives = 31/65 (47%)
 Frame = +3

Query: 273 EQTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDY 452
           +  C   +   I  E+  S  YL+M  YF+ D V    F + F   + ++ EHA KL+  
Sbjct: 14  DTNCDAAINSHITLELYTSYLYLSMAFYFNRDDVALENFFRYFLRLSDDKMEHAQKLMRL 73

Query: 453 LLMRG 467
             +RG
Sbjct: 74  QNLRG 78


>BC100768-1|AAI00769.1|  183|Homo sapiens ferritin, heavy
           polypeptide-like 17 protein.
          Length = 183

 Score = 36.7 bits (81), Expect = 0.080
 Identities = 20/65 (30%), Positives = 31/65 (47%)
 Frame = +3

Query: 273 EQTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDY 452
           +  C   +   I  E+  S  YL+M  YF+ D V    F + F   + ++ EHA KL+  
Sbjct: 14  DTNCDAAINSHITLELYTSYLYLSMAFYFNRDDVALENFFRYFLRLSDDKMEHAQKLMRL 73

Query: 453 LLMRG 467
             +RG
Sbjct: 74  QNLRG 78


>BC069538-1|AAH69538.2|  183|Homo sapiens ferritin, heavy
           polypeptide-like 17 protein.
          Length = 183

 Score = 36.7 bits (81), Expect = 0.080
 Identities = 20/65 (30%), Positives = 31/65 (47%)
 Frame = +3

Query: 273 EQTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDY 452
           +  C   +   I  E+  S  YL+M  YF+ D V    F + F   + ++ EHA KL+  
Sbjct: 14  DTNCDAAINSHITLELYTSYLYLSMAFYFNRDDVALENFFRYFLRLSDDKMEHAQKLMRL 73

Query: 453 LLMRG 467
             +RG
Sbjct: 74  QNLRG 78


>BC069069-1|AAH69069.2|  183|Homo sapiens ferritin, heavy
           polypeptide-like 17 protein.
          Length = 183

 Score = 36.7 bits (81), Expect = 0.080
 Identities = 20/65 (30%), Positives = 31/65 (47%)
 Frame = +3

Query: 273 EQTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDY 452
           +  C   +   I  E+  S  YL+M  YF+ D V    F + F   + ++ EHA KL+  
Sbjct: 14  DTNCDAAINSHITLELYTSYLYLSMAFYFNRDDVALENFFRYFLRLSDDKMEHAQKLMRL 73

Query: 453 LLMRG 467
             +RG
Sbjct: 74  QNLRG 78


>BC062708-1|AAH62708.1|  175|Homo sapiens ferritin, light
           polypeptide protein.
          Length = 175

 Score = 36.7 bits (81), Expect = 0.080
 Identities = 18/60 (30%), Positives = 31/60 (51%)
 Frame = +2

Query: 500 VQGPANTSWESGASALEHALKLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLDEQYK 679
           ++ PA   W     A++ A+ LE  +  ++ + +    S+  D HL D+L   FLDE+ K
Sbjct: 82  IKKPAEDEWGKTPDAMKAAMALEKKLNQALLD-LHALGSARTDPHLCDFLETHFLDEEVK 140



 Score = 33.5 bits (73), Expect = 0.75
 Identities = 18/48 (37%), Positives = 25/48 (52%)
 Frame = +3

Query: 324 ASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           AS  YL++G YF  D V   G +  F + A E+RE   +L+     RG
Sbjct: 27  ASYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQNQRG 74


>BC058820-1|AAH58820.1|  175|Homo sapiens FTL protein protein.
          Length = 175

 Score = 36.7 bits (81), Expect = 0.080
 Identities = 18/60 (30%), Positives = 31/60 (51%)
 Frame = +2

Query: 500 VQGPANTSWESGASALEHALKLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLDEQYK 679
           ++ PA   W     A++ A+ LE  +  ++ + +    S+  D HL D+L   FLDE+ K
Sbjct: 82  IKKPAEDEWGKTPDAMKAAMALEKKLNQALLD-LHALGSARTDPHLCDFLETHFLDEEVK 140



 Score = 33.5 bits (73), Expect = 0.75
 Identities = 18/48 (37%), Positives = 25/48 (52%)
 Frame = +3

Query: 324 ASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           AS  YL++G YF  D V   G +  F + A E+RE   +L+     RG
Sbjct: 27  ASYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQNQRG 74


>BC021670-1|AAH21670.1|  175|Homo sapiens ferritin, light
           polypeptide protein.
          Length = 175

 Score = 36.7 bits (81), Expect = 0.080
 Identities = 18/60 (30%), Positives = 31/60 (51%)
 Frame = +2

Query: 500 VQGPANTSWESGASALEHALKLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLDEQYK 679
           ++ PA   W     A++ A+ LE  +  ++ + +    S+  D HL D+L   FLDE+ K
Sbjct: 82  IKKPAEDEWGKTPDAMKAAMALEKKLNQALLD-LHALGSARTDPHLCDFLETHFLDEEVK 140



 Score = 31.9 bits (69), Expect = 2.3
 Identities = 16/41 (39%), Positives = 23/41 (56%)
 Frame = +3

Query: 324 ASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLI 446
           AS  YL++G YF  D V   G +  F + A E+RE   +L+
Sbjct: 27  ASYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYERLL 67


>BC018990-1|AAH18990.1|  175|Homo sapiens ferritin, light
           polypeptide protein.
          Length = 175

 Score = 36.7 bits (81), Expect = 0.080
 Identities = 18/60 (30%), Positives = 31/60 (51%)
 Frame = +2

Query: 500 VQGPANTSWESGASALEHALKLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLDEQYK 679
           ++ PA   W     A++ A+ LE  +  ++ + +    S+  D HL D+L   FLDE+ K
Sbjct: 82  IKKPAEDEWGKTPDAMKAAMALEKKLNQALLD-LHALGSARTDPHLCDFLETHFLDEEVK 140



 Score = 33.5 bits (73), Expect = 0.75
 Identities = 18/48 (37%), Positives = 25/48 (52%)
 Frame = +3

Query: 324 ASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           AS  YL++G YF  D V   G +  F + A E+RE   +L+     RG
Sbjct: 27  ASYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQNQRG 74


>BC016715-1|AAH16715.1|  175|Homo sapiens ferritin, light
           polypeptide protein.
          Length = 175

 Score = 36.7 bits (81), Expect = 0.080
 Identities = 18/60 (30%), Positives = 31/60 (51%)
 Frame = +2

Query: 500 VQGPANTSWESGASALEHALKLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLDEQYK 679
           ++ PA   W     A++ A+ LE  +  ++ + +    S+  D HL D+L   FLDE+ K
Sbjct: 82  IKKPAEDEWGKTPDAMKAAMALEKKLNQALLD-LHALGSARTDPHLCDFLETHFLDEEVK 140



 Score = 33.5 bits (73), Expect = 0.75
 Identities = 18/48 (37%), Positives = 25/48 (52%)
 Frame = +3

Query: 324 ASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           AS  YL++G YF  D V   G +  F + A E+RE   +L+     RG
Sbjct: 27  ASYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQNQRG 74


>BC016354-1|AAH16354.1|  175|Homo sapiens ferritin, light
           polypeptide protein.
          Length = 175

 Score = 36.7 bits (81), Expect = 0.080
 Identities = 18/60 (30%), Positives = 31/60 (51%)
 Frame = +2

Query: 500 VQGPANTSWESGASALEHALKLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLDEQYK 679
           ++ PA   W     A++ A+ LE  +  ++ + +    S+  D HL D+L   FLDE+ K
Sbjct: 82  IKKPAEDEWGKTPDAMKAAMALEKKLNQALLD-LHALGSARTDPHLCDFLETHFLDEEVK 140



 Score = 33.5 bits (73), Expect = 0.75
 Identities = 18/48 (37%), Positives = 25/48 (52%)
 Frame = +3

Query: 324 ASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           AS  YL++G YF  D V   G +  F + A E+RE   +L+     RG
Sbjct: 27  ASYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQNQRG 74


>BC016346-1|AAH16346.1|  175|Homo sapiens ferritin, light
           polypeptide protein.
          Length = 175

 Score = 36.7 bits (81), Expect = 0.080
 Identities = 18/60 (30%), Positives = 31/60 (51%)
 Frame = +2

Query: 500 VQGPANTSWESGASALEHALKLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLDEQYK 679
           ++ PA   W     A++ A+ LE  +  ++ + +    S+  D HL D+L   FLDE+ K
Sbjct: 82  IKKPAEDEWGKTPDAMKAAMALEKKLNQALLD-LHALGSARTDPHLCDFLETHFLDEEVK 140



 Score = 33.5 bits (73), Expect = 0.75
 Identities = 18/48 (37%), Positives = 25/48 (52%)
 Frame = +3

Query: 324 ASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           AS  YL++G YF  D V   G +  F + A E+RE   +L+     RG
Sbjct: 27  ASYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQNQRG 74


>BC008439-1|AAH08439.1|  175|Homo sapiens ferritin, light
           polypeptide protein.
          Length = 175

 Score = 36.7 bits (81), Expect = 0.080
 Identities = 18/60 (30%), Positives = 31/60 (51%)
 Frame = +2

Query: 500 VQGPANTSWESGASALEHALKLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLDEQYK 679
           ++ PA   W     A++ A+ LE  +  ++ + +    S+  D HL D+L   FLDE+ K
Sbjct: 82  IKKPAEDEWGKTPDAMKAAMALEKKLNQALLD-LHALGSARTDPHLCDFLETHFLDEEVK 140



 Score = 33.5 bits (73), Expect = 0.75
 Identities = 18/48 (37%), Positives = 25/48 (52%)
 Frame = +3

Query: 324 ASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           AS  YL++G YF  D V   G +  F + A E+RE   +L+     RG
Sbjct: 27  ASYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQNQRG 74


>BC004245-1|AAH04245.1|  175|Homo sapiens ferritin, light
           polypeptide protein.
          Length = 175

 Score = 36.7 bits (81), Expect = 0.080
 Identities = 18/60 (30%), Positives = 31/60 (51%)
 Frame = +2

Query: 500 VQGPANTSWESGASALEHALKLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLDEQYK 679
           ++ PA   W     A++ A+ LE  +  ++ + +    S+  D HL D+L   FLDE+ K
Sbjct: 82  IKKPAEDEWGKTPDAMKAAMALEKKLNQALLD-LHALGSARTDPHLCDFLETHFLDEEVK 140



 Score = 33.5 bits (73), Expect = 0.75
 Identities = 18/48 (37%), Positives = 25/48 (52%)
 Frame = +3

Query: 324 ASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           AS  YL++G YF  D V   G +  F + A E+RE   +L+     RG
Sbjct: 27  ASYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQNQRG 74


>BC002991-1|AAH02991.2|  175|Homo sapiens ferritin, light
           polypeptide protein.
          Length = 175

 Score = 36.7 bits (81), Expect = 0.080
 Identities = 18/60 (30%), Positives = 31/60 (51%)
 Frame = +2

Query: 500 VQGPANTSWESGASALEHALKLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLDEQYK 679
           ++ PA   W     A++ A+ LE  +  ++ + +    S+  D HL D+L   FLDE+ K
Sbjct: 82  IKKPAEDEWGKTPDAMKAAMALEKKLNQALLD-LHALGSARTDPHLCDFLETHFLDEEVK 140



 Score = 33.5 bits (73), Expect = 0.75
 Identities = 18/48 (37%), Positives = 25/48 (52%)
 Frame = +3

Query: 324 ASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           AS  YL++G YF  D V   G +  F + A E+RE   +L+     RG
Sbjct: 27  ASYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQNQRG 74


>AY466472-1|AAS45711.1|  191|Homo sapiens ferritin light polypeptide
           variant protein.
          Length = 191

 Score = 36.7 bits (81), Expect = 0.080
 Identities = 18/60 (30%), Positives = 31/60 (51%)
 Frame = +2

Query: 500 VQGPANTSWESGASALEHALKLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLDEQYK 679
           ++ PA   W     A++ A+ LE  +  ++ + +    S+  D HL D+L   FLDE+ K
Sbjct: 82  IKKPAEDEWGKTPDAMKAAMALEKKLNQALLD-LHALGSARTDPHLCDFLETHFLDEEVK 140



 Score = 33.5 bits (73), Expect = 0.75
 Identities = 18/48 (37%), Positives = 25/48 (52%)
 Frame = +3

Query: 324 ASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           AS  YL++G YF  D V   G +  F + A E+RE   +L+     RG
Sbjct: 27  ASYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQNQRG 74


>AY207005-1|AAO52739.1|  175|Homo sapiens ferritin-like protein
           protein.
          Length = 175

 Score = 36.7 bits (81), Expect = 0.080
 Identities = 18/60 (30%), Positives = 31/60 (51%)
 Frame = +2

Query: 500 VQGPANTSWESGASALEHALKLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLDEQYK 679
           ++ PA   W     A++ A+ LE  +  ++ + +    S+  D HL D+L   FLDE+ K
Sbjct: 82  IKKPAEDEWGKTPDAMKAAMALEKKLNQALLD-LHALGSARTDPHLCDFLETHFLDEEVK 140



 Score = 35.1 bits (77), Expect = 0.24
 Identities = 19/48 (39%), Positives = 26/48 (54%)
 Frame = +3

Query: 324 ASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           AS  YL++G YF  D V   G + LF + A E+RE   +L+     RG
Sbjct: 27  ASYTYLSLGFYFDRDDVALEGVSHLFRELAEEKREGYERLLKMQNQRG 74


>AF285592-1|AAK31971.1|  183|Homo sapiens ferritin heavy
           polypeptide-like 17 protein.
          Length = 183

 Score = 36.7 bits (81), Expect = 0.080
 Identities = 20/65 (30%), Positives = 31/65 (47%)
 Frame = +3

Query: 273 EQTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDY 452
           +  C   +   I  E+  S  YL+M  YF+ D V    F + F   + ++ EHA KL+  
Sbjct: 14  DTNCDAAINSHITLELYTSYLYLSMAFYFNRDDVALENFFRYFLRLSDDKMEHAQKLMRL 73

Query: 453 LLMRG 467
             +RG
Sbjct: 74  QNLRG 78


>X03742-1|CAA27382.1|   83|Homo sapiens L apoferritin protein.
          Length = 83

 Score = 33.5 bits (73), Expect = 0.75
 Identities = 18/48 (37%), Positives = 25/48 (52%)
 Frame = +3

Query: 324 ASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           AS  YL++G YF  D V   G +  F + A E+RE   +L+     RG
Sbjct: 27  ASYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQNQRG 74


>DQ094831-1|AAZ04400.1|   83|Homo sapiens ferritin light chain
           protein.
          Length = 83

 Score = 33.5 bits (73), Expect = 0.75
 Identities = 18/48 (37%), Positives = 25/48 (52%)
 Frame = +3

Query: 324 ASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           AS  YL++G YF  D V   G +  F + A E+RE   +L+     RG
Sbjct: 27  ASYTYLSLGFYFDRDDVALEGVSHFFRELAKEKREGYERLLKMQNQRG 74


>DQ094830-1|AAZ04399.1|   83|Homo sapiens ferritin light chain
           protein.
          Length = 83

 Score = 33.5 bits (73), Expect = 0.75
 Identities = 18/48 (37%), Positives = 25/48 (52%)
 Frame = +3

Query: 324 ASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           AS  YL++G YF  D V   G +  F + A E+RE   +L+     RG
Sbjct: 27  ASYTYLSLGFYFDRDDVALEGVSHFFRELAKEKREGYERLLKMQNQRG 74


>BC067772-1|AAH67772.1|  107|Homo sapiens FTL protein protein.
          Length = 107

 Score = 33.5 bits (73), Expect = 0.75
 Identities = 18/48 (37%), Positives = 25/48 (52%)
 Frame = +3

Query: 324 ASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           AS  YL++G YF  D V   G +  F + A E+RE   +L+     RG
Sbjct: 27  ASYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQNQRG 74


>BC013928-1|AAH13928.1|  175|Homo sapiens ferritin, light
           polypeptide protein.
          Length = 175

 Score = 33.5 bits (73), Expect = 0.75
 Identities = 18/48 (37%), Positives = 25/48 (52%)
 Frame = +3

Query: 324 ASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           AS  YL++G YF  D V   G +  F + A E+RE   +L+     RG
Sbjct: 27  ASYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQNQRG 74



 Score = 33.5 bits (73), Expect = 0.75
 Identities = 17/60 (28%), Positives = 30/60 (50%)
 Frame = +2

Query: 500 VQGPANTSWESGASALEHALKLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLDEQYK 679
           ++ PA   W     A++ A+ LE  +  ++ + +    S+  D  L D+L   FLDE+ K
Sbjct: 82  IKKPAEDEWGKTPDAMKAAMALEKKLNQALLD-LHALGSARTDPRLCDFLETHFLDEEVK 140


>AF274934-1|AAK07513.1|   82|Homo sapiens PNAS-9 protein.
          Length = 82

 Score = 30.3 bits (65), Expect = 7.0
 Identities = 18/72 (25%), Positives = 39/72 (54%), Gaps = 1/72 (1%)
 Frame = +3

Query: 216 HSYTVLRQPRHHQDEWLTMEQTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAK 395
           + Y+  ++ R H D+W   ++  Y +++K I+E+V  + + + +  YF     N+    +
Sbjct: 8   YDYSQNQENRIHLDDWTAFDEYYYELLKKYIKEKVTNTNEKIRI--YFLPHYDNKYYAFR 65

Query: 396 LFFDAATE-ERE 428
           L +++  E ERE
Sbjct: 66  LKYESEKEAERE 77


>AL591545-1|CAI40663.1|  724|Homo sapiens RP11-419L10.1 protein.
          Length = 724

 Score = 29.9 bits (64), Expect = 9.2
 Identities = 23/63 (36%), Positives = 28/63 (44%), Gaps = 4/63 (6%)
 Frame = +1

Query: 487 PTSSRTGPRKHVVGERRISPRARPQAGE*RHQQHPGG----HQDLREQLQRLPPGRLFVR 654
           P +  TG         R +PRAR  AG  RH Q  GG    H  L++ L  LPP +    
Sbjct: 647 PRACDTGGSGRKASWSRPAPRAR--AGGSRHTQASGGRRQRHPGLQKPLDSLPPTQQVAS 704

Query: 655 GIP 663
            IP
Sbjct: 705 PIP 707


>AL162578-1|CAI40011.1|  724|Homo sapiens RP11-419L10.1 protein.
          Length = 724

 Score = 29.9 bits (64), Expect = 9.2
 Identities = 23/63 (36%), Positives = 28/63 (44%), Gaps = 4/63 (6%)
 Frame = +1

Query: 487 PTSSRTGPRKHVVGERRISPRARPQAGE*RHQQHPGG----HQDLREQLQRLPPGRLFVR 654
           P +  TG         R +PRAR  AG  RH Q  GG    H  L++ L  LPP +    
Sbjct: 647 PRACDTGGSGRKASWSRPAPRAR--AGGSRHTQASGGRRQRHPGLQKPLDSLPPTQQVAS 704

Query: 655 GIP 663
            IP
Sbjct: 705 PIP 707


>AL049820-1|CAI42304.1|  724|Homo sapiens RP11-419L10.1 protein.
          Length = 724

 Score = 29.9 bits (64), Expect = 9.2
 Identities = 23/63 (36%), Positives = 28/63 (44%), Gaps = 4/63 (6%)
 Frame = +1

Query: 487 PTSSRTGPRKHVVGERRISPRARPQAGE*RHQQHPGG----HQDLREQLQRLPPGRLFVR 654
           P +  TG         R +PRAR  AG  RH Q  GG    H  L++ L  LPP +    
Sbjct: 647 PRACDTGGSGRKASWSRPAPRAR--AGGSRHTQASGGRRQRHPGLQKPLDSLPPTQQVAS 704

Query: 655 GIP 663
            IP
Sbjct: 705 PIP 707


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 95,898,319
Number of Sequences: 237096
Number of extensions: 2003894
Number of successful extensions: 4503
Number of sequences better than 10.0: 60
Number of HSP's better than 10.0 without gapping: 4314
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4503
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8119219030
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -