SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20037
         (718 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Y00371-1|CAA68445.1|  646|Homo sapiens 71 Kd heat shock cognate ...   165   1e-40
BC019816-1|AAH19816.1|  646|Homo sapiens heat shock 70kDa protei...   165   1e-40
BC016660-1|AAH16660.1|  646|Homo sapiens heat shock 70kDa protei...   165   1e-40
BC016179-1|AAH16179.1|  646|Homo sapiens heat shock 70kDa protei...   165   1e-40
BC007276-1|AAH07276.2|  587|Homo sapiens HSPA8 protein protein.       165   1e-40
AK222785-1|BAD96505.1|  646|Homo sapiens heat shock 70kDa protei...   165   1e-40
AK222628-1|BAD96348.1|  493|Homo sapiens heat shock 70kDa protei...   165   1e-40
AF352832-1|AAK17898.1|  646|Homo sapiens constitutive heat shock...   165   1e-40
AB034951-1|BAB18615.1|  493|Homo sapiens heat shock cognate prot...   165   1e-40
X51757-1|CAA36061.1|  643|Homo sapiens protein ( Human heat-shoc...   163   6e-40
DQ521571-1|ABF47108.1|  643|Homo sapiens heat shock 70kDa protei...   163   6e-40
BC035665-1|AAH35665.1|  643|Homo sapiens heat shock 70kDa protei...   163   6e-40
AL590385-3|CAI16120.1|  643|Homo sapiens heat shock 70kDa protei...   163   6e-40
M59830-1|AAA63227.1|  641|Homo sapiens heat shock-induced protei...   162   1e-39
M59828-1|AAA63226.1|  641|Homo sapiens heat shock-induced protei...   162   1e-39
M11717-1|AAA52697.1|  640|Homo sapiens heat shock protein protein.    162   1e-39
DQ451402-1|ABD96830.1|  641|Homo sapiens heat shock 70kDa protei...   162   1e-39
DQ388429-1|ABD48956.1|  641|Homo sapiens heat shock 70kDa protei...   162   1e-39
BC063507-1|AAH63507.1|  641|Homo sapiens heat shock 70kDa protei...   162   1e-39
BC057397-1|AAH57397.1|  641|Homo sapiens heat shock 70kDa protei...   162   1e-39
BC018740-1|AAH18740.1|  641|Homo sapiens HSPA1A protein protein.      162   1e-39
BC009322-1|AAH09322.1|  641|Homo sapiens HSPA1A protein protein.      162   1e-39
BC002453-1|AAH02453.1|  641|Homo sapiens heat shock 70kDa protei...   162   1e-39
BA000025-9|BAB63300.1|  641|Homo sapiens heat shock protein prot...   162   1e-39
BA000025-8|BAB63299.1|  641|Homo sapiens heat shock protein prot...   162   1e-39
AL929592-7|CAI18466.1|  641|Homo sapiens heat shock 70kDa protei...   162   1e-39
AL929592-6|CAI18465.1|  476|Homo sapiens heat shock 70kDa protei...   162   1e-39
AL929592-5|CAI18464.1|  641|Homo sapiens heat shock 70kDa protei...   162   1e-39
AL671762-7|CAI18217.1|  641|Homo sapiens heat shock 70kDa protei...   162   1e-39
AL671762-6|CAI18216.1|  641|Homo sapiens heat shock 70kDa protei...   162   1e-39
AL671762-5|CAM25532.1|  476|Homo sapiens heat shock 70kDa protei...   162   1e-39
AL662834-18|CAI17738.1|  641|Homo sapiens heat shock 70kDa prote...   162   1e-39
AL662834-17|CAI17737.1|  641|Homo sapiens heat shock 70kDa prote...   162   1e-39
AL662834-16|CAM24989.1|  476|Homo sapiens heat shock 70kDa prote...   162   1e-39
AK223362-1|BAD97082.1|  643|Homo sapiens heat shock 70kDa protei...   162   1e-39
AF134726-7|AAD21816.1|  641|Homo sapiens HSP70-1 protein.             162   1e-39
AF134726-6|AAD21815.1|  641|Homo sapiens HSP70-2 protein.             162   1e-39
AB209818-1|BAD93055.1|  709|Homo sapiens heat shock 70kDa protei...   162   1e-39
U56725-1|AAD11466.1|  639|Homo sapiens heat shock protein protein.    161   3e-39
L26336-1|AAA52698.1|  639|Homo sapiens heat shock protein protein.    161   3e-39
DQ489378-1|ABE96830.1|  639|Homo sapiens heat shock 70kDa protei...   161   3e-39
BT009815-1|AAP88817.1|  639|Homo sapiens heat shock 70kDa protei...   161   3e-39
BC036107-1|AAH36107.1|  639|Homo sapiens HSPA2 protein protein.       161   3e-39
BC001752-1|AAH01752.1|  639|Homo sapiens heat shock 70kDa protei...   161   3e-39
M59829-1|AAA63228.1|  641|Homo sapiens heat shock-induced protei...   157   4e-38
D85730-1|BAA32521.1|  641|Homo sapiens Heat shock protein 70 tes...   157   4e-38
DQ383515-1|ABC88476.1|  641|Homo sapiens heat shock 70kDa protei...   157   4e-38
BC034483-1|AAH34483.1|  641|Homo sapiens heat shock 70kDa protei...   157   4e-38
BA000025-10|BAB63301.1|  641|Homo sapiens heat shock protein pro...   157   4e-38
AL929592-4|CAI18463.1|  641|Homo sapiens heat shock 70kDa protei...   157   4e-38
AL671762-4|CAI18215.1|  641|Homo sapiens heat shock 70kDa protei...   157   4e-38
AL662834-15|CAI17736.1|  641|Homo sapiens heat shock 70kDa prote...   157   4e-38
AK223386-1|BAD97106.1|  641|Homo sapiens heat shock 70kDa protei...   157   4e-38
AF134726-8|AAD21817.1|  641|Homo sapiens HSP70-HOM protein.           157   4e-38
BC112963-1|AAI12964.1|  655|Homo sapiens HSPA5 protein protein.       124   4e-28
DQ385847-1|ABD04090.1|  654|Homo sapiens heat shock 70kDa protei...   122   1e-27
BC020235-1|AAH20235.1|  654|Homo sapiens heat shock 70kDa protei...   122   1e-27
AJ271729-1|CAB71335.1|  654|Homo sapiens glucose-regulated prote...   122   1e-27
AF216292-1|AAF42836.1|  654|Homo sapiens endoplasmic reticulum l...   122   1e-27
AF188611-1|AAF13605.1|  639|Homo sapiens BiP protein protein.         122   1e-27
X87949-1|CAA61201.1|  653|Homo sapiens BiP protein.                   121   2e-27
M19645-1|AAA52614.1|  653|Homo sapiens protein ( Human 78 kdalto...   121   2e-27
M11236-1|AAA52696.1|  247|Homo sapiens HSPA1L protein.                106   9e-23
L15189-1|AAA67526.1|  679|Homo sapiens MTHSP75 protein.               101   3e-21
DQ531046-1|ABF50973.1|  679|Homo sapiens heat shock 70kDa protei...   101   3e-21
BC030634-1|AAH30634.1|  681|Homo sapiens HSPA9 protein protein.       101   3e-21
BC024034-1|AAH24034.1|  679|Homo sapiens heat shock 70kDa protei...   101   3e-21
BC000478-1|AAH00478.1|  679|Homo sapiens heat shock 70kDa protei...   101   3e-21
AK222758-1|BAD96478.1|  679|Homo sapiens heat shock 70kDa protei...   100   1e-20
AB018045-1|BAA77235.1|  151|Homo sapiens heat shock protein 72 p...    93   7e-19
DQ185038-1|ABD14419.1|  176|Homo sapiens heat shock 70 kDa prote...    92   2e-18
X51758-1|CAA36062.1|  289|Homo sapiens heat shock protein 70B' (...    81   5e-15
X67643-1|CAA47886.1|  474|Homo sapiens HS24/P52 protein.               77   6e-14
X67640-1|CAA47885.1|  266|Homo sapiens HS24/P52 protein.               77   6e-14
L12723-1|AAA02807.1|  701|Homo sapiens heat shock protein 70 pro...    77   6e-14
BC126124-1|AAI26125.1|  840|Homo sapiens heat shock 70kDa protei...    77   6e-14
BC126122-1|AAI26123.1|  840|Homo sapiens heat shock 70kDa protei...    77   6e-14
BC110861-1|AAI10862.1|  840|Homo sapiens heat shock 70kDa protei...    77   6e-14
AB209151-1|BAD92388.1|  782|Homo sapiens heat shock 70kDa protei...    77   6e-14
AB023420-1|BAA75062.1|  840|Homo sapiens apg-2 protein.                77   6e-14
U65785-1|AAC50947.1|  999|Homo sapiens 150 kDa oxygen-regulated ...    75   2e-13
DQ372932-1|ABD14370.1|  999|Homo sapiens 150 kDa oxygen-regulate...    75   2e-13
DQ350134-1|ABC75106.1|  999|Homo sapiens 150 kDa oxygen-regulate...    75   2e-13
BC072436-1|AAH72436.1|  678|Homo sapiens HYOU1 protein protein.        75   2e-13
BC017726-1|AAH17726.1|  657|Homo sapiens Unknown (protein for IM...    75   2e-13
AK222756-1|BAD96476.1|  999|Homo sapiens oxygen regulated protei...    75   2e-13
U04735-1|AAA16954.1|  471|Homo sapiens microsomal stress 70 prot...    73   8e-13
M24744-1|AAA59845.1|   65|Homo sapiens HSPA2 protein.                  73   8e-13
BC036370-1|AAH36370.1|  471|Homo sapiens stress 70 protein chape...    73   8e-13
AL163206-1|CAB90390.1|  471|Homo sapiens human microsomal stress...    73   8e-13
AK223282-1|BAD97002.1|  471|Homo sapiens stress 70 protein chape...    73   8e-13
AF130249-1|AAD21091.1|  471|Homo sapiens STCH protein.                 73   8e-13
AY290862-1|AAP44471.1|  839|Homo sapiens heat shock protein apg-...    73   1e-12
AB023421-1|BAA75063.1|  839|Homo sapiens apg-1 protein.                73   1e-12
BC015699-1|AAH15699.1|  269|Homo sapiens Unknown (protein for IM...    72   2e-12
EF197155-1|ABM69040.1|  839|Homo sapiens heat shock 70 kDa prote...    71   6e-12
D86956-1|BAA13192.2|  949|Homo sapiens KIAA0201 protein.               71   6e-12
BC040560-1|AAH40560.1|  839|Homo sapiens heat shock 70kDa protei...    71   6e-12
BC037553-1|AAH37553.1|  858|Homo sapiens heat shock 105kDa/110kD...    71   6e-12
AL137142-5|CAI12430.1|  858|Homo sapiens heat shock 105kDa/110kD...    71   6e-12
AL137142-4|CAI12428.1|  814|Homo sapiens heat shock 105kDa/110kD...    71   6e-12
AL137142-3|CAI12429.1|  817|Homo sapiens heat shock 105kDa/110kD...    71   6e-12
AF039695-1|AAC18044.1|  872|Homo sapiens antigen NY-CO-25 protein.     71   6e-12
AC093591-2|AAY40975.1|  839|Homo sapiens unknown protein.              71   6e-12
AB003334-1|BAA34780.1|  858|Homo sapiens HSP105 alpha protein.         71   6e-12
AB003333-1|BAA34779.1|  814|Homo sapiens HSP105 beta protein.          71   6e-12
DQ480334-1|ABF19573.1|  350|Homo sapiens catecholamine-regulated...    69   2e-11
BC119690-1|AAI19691.1|  509|Homo sapiens heat shock 70kDa protei...    69   2e-11
AF143723-1|AAF66640.1|  509|Homo sapiens heat shock protein HSP6...    69   2e-11
AF112210-1|AAF17198.1|  509|Homo sapiens heat shock protein hsp7...    67   7e-11
AF038963-1|AAD19826.1|  925|Homo sapiens RNA helicase protein.         30   9.5  

>Y00371-1|CAA68445.1|  646|Homo sapiens 71 Kd heat shock cognate
           protein protein.
          Length = 646

 Score =  165 bits (401), Expect = 1e-40
 Identities = 78/88 (88%), Positives = 85/88 (96%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQASIEIDSL+EGIDFYTSITRARFEELNADLFR T++PVEK+LRDAK+DK+Q
Sbjct: 271 KRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQ 330

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHDIVLVGGSTRIPK+QKLLQDFFNGKE
Sbjct: 331 IHDIVLVGGSTRIPKIQKLLQDFFNGKE 358



 Score =  164 bits (398), Expect = 3e-40
 Identities = 75/84 (89%), Positives = 80/84 (95%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKY 181
           G  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHF+ EFKRK+
Sbjct: 190 GAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKH 249

Query: 182 KKDLATNKRALRRLRTACERAKRT 253
           KKD++ NKRA+RRLRTACERAKRT
Sbjct: 250 KKDISENKRAVRRLRTACERAKRT 273



 Score = 85.4 bits (202), Expect = 2e-16
 Identities = 45/72 (62%), Positives = 45/72 (62%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  NKSINPDE           IL GDKSE VQD           GIETAGGVMT LIKR
Sbjct: 357 KELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKR 416

Query: 681 NTTIPTKQTQTF 716
           NTTIPTKQTQTF
Sbjct: 417 NTTIPTKQTQTF 428


>BC019816-1|AAH19816.1|  646|Homo sapiens heat shock 70kDa protein 8
           protein.
          Length = 646

 Score =  165 bits (401), Expect = 1e-40
 Identities = 78/88 (88%), Positives = 85/88 (96%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQASIEIDSL+EGIDFYTSITRARFEELNADLFR T++PVEK+LRDAK+DK+Q
Sbjct: 271 KRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQ 330

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHDIVLVGGSTRIPK+QKLLQDFFNGKE
Sbjct: 331 IHDIVLVGGSTRIPKIQKLLQDFFNGKE 358



 Score =  164 bits (398), Expect = 3e-40
 Identities = 75/84 (89%), Positives = 80/84 (95%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKY 181
           G  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHF+ EFKRK+
Sbjct: 190 GAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKH 249

Query: 182 KKDLATNKRALRRLRTACERAKRT 253
           KKD++ NKRA+RRLRTACERAKRT
Sbjct: 250 KKDISENKRAVRRLRTACERAKRT 273



 Score = 85.4 bits (202), Expect = 2e-16
 Identities = 45/72 (62%), Positives = 45/72 (62%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  NKSINPDE           IL GDKSE VQD           GIETAGGVMT LIKR
Sbjct: 357 KELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKR 416

Query: 681 NTTIPTKQTQTF 716
           NTTIPTKQTQTF
Sbjct: 417 NTTIPTKQTQTF 428


>BC016660-1|AAH16660.1|  646|Homo sapiens heat shock 70kDa protein 8
           protein.
          Length = 646

 Score =  165 bits (401), Expect = 1e-40
 Identities = 78/88 (88%), Positives = 85/88 (96%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQASIEIDSL+EGIDFYTSITRARFEELNADLFR T++PVEK+LRDAK+DK+Q
Sbjct: 271 KRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQ 330

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHDIVLVGGSTRIPK+QKLLQDFFNGKE
Sbjct: 331 IHDIVLVGGSTRIPKIQKLLQDFFNGKE 358



 Score =  164 bits (398), Expect = 3e-40
 Identities = 75/84 (89%), Positives = 80/84 (95%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKY 181
           G  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHF+ EFKRK+
Sbjct: 190 GAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKH 249

Query: 182 KKDLATNKRALRRLRTACERAKRT 253
           KKD++ NKRA+RRLRTACERAKRT
Sbjct: 250 KKDISENKRAVRRLRTACERAKRT 273



 Score = 85.4 bits (202), Expect = 2e-16
 Identities = 45/72 (62%), Positives = 45/72 (62%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  NKSINPDE           IL GDKSE VQD           GIETAGGVMT LIKR
Sbjct: 357 KELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKR 416

Query: 681 NTTIPTKQTQTF 716
           NTTIPTKQTQTF
Sbjct: 417 NTTIPTKQTQTF 428


>BC016179-1|AAH16179.1|  646|Homo sapiens heat shock 70kDa protein 8
           protein.
          Length = 646

 Score =  165 bits (401), Expect = 1e-40
 Identities = 78/88 (88%), Positives = 85/88 (96%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQASIEIDSL+EGIDFYTSITRARFEELNADLFR T++PVEK+LRDAK+DK+Q
Sbjct: 271 KRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQ 330

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHDIVLVGGSTRIPK+QKLLQDFFNGKE
Sbjct: 331 IHDIVLVGGSTRIPKIQKLLQDFFNGKE 358



 Score =  164 bits (398), Expect = 3e-40
 Identities = 75/84 (89%), Positives = 80/84 (95%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKY 181
           G  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHF+ EFKRK+
Sbjct: 190 GAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKH 249

Query: 182 KKDLATNKRALRRLRTACERAKRT 253
           KKD++ NKRA+RRLRTACERAKRT
Sbjct: 250 KKDISENKRAVRRLRTACERAKRT 273



 Score = 85.4 bits (202), Expect = 2e-16
 Identities = 45/72 (62%), Positives = 45/72 (62%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  NKSINPDE           IL GDKSE VQD           GIETAGGVMT LIKR
Sbjct: 357 KELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKR 416

Query: 681 NTTIPTKQTQTF 716
           NTTIPTKQTQTF
Sbjct: 417 NTTIPTKQTQTF 428


>BC007276-1|AAH07276.2|  587|Homo sapiens HSPA8 protein protein.
          Length = 587

 Score =  165 bits (401), Expect = 1e-40
 Identities = 78/88 (88%), Positives = 85/88 (96%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQASIEIDSL+EGIDFYTSITRARFEELNADLFR T++PVEK+LRDAK+DK+Q
Sbjct: 212 KRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQ 271

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHDIVLVGGSTRIPK+QKLLQDFFNGKE
Sbjct: 272 IHDIVLVGGSTRIPKIQKLLQDFFNGKE 299



 Score =  164 bits (398), Expect = 3e-40
 Identities = 75/84 (89%), Positives = 80/84 (95%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKY 181
           G  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHF+ EFKRK+
Sbjct: 131 GAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKH 190

Query: 182 KKDLATNKRALRRLRTACERAKRT 253
           KKD++ NKRA+RRLRTACERAKRT
Sbjct: 191 KKDISENKRAVRRLRTACERAKRT 214



 Score = 85.4 bits (202), Expect = 2e-16
 Identities = 45/72 (62%), Positives = 45/72 (62%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  NKSINPDE           IL GDKSE VQD           GIETAGGVMT LIKR
Sbjct: 298 KELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKR 357

Query: 681 NTTIPTKQTQTF 716
           NTTIPTKQTQTF
Sbjct: 358 NTTIPTKQTQTF 369


>AK222785-1|BAD96505.1|  646|Homo sapiens heat shock 70kDa protein 8
           isoform 1 variant protein.
          Length = 646

 Score =  165 bits (401), Expect = 1e-40
 Identities = 78/88 (88%), Positives = 85/88 (96%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQASIEIDSL+EGIDFYTSITRARFEELNADLFR T++PVEK+LRDAK+DK+Q
Sbjct: 271 KRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQ 330

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHDIVLVGGSTRIPK+QKLLQDFFNGKE
Sbjct: 331 IHDIVLVGGSTRIPKIQKLLQDFFNGKE 358



 Score =  164 bits (398), Expect = 3e-40
 Identities = 75/84 (89%), Positives = 80/84 (95%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKY 181
           G  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHF+ EFKRK+
Sbjct: 190 GAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKH 249

Query: 182 KKDLATNKRALRRLRTACERAKRT 253
           KKD++ NKRA+RRLRTACERAKRT
Sbjct: 250 KKDISENKRAVRRLRTACERAKRT 273



 Score = 85.4 bits (202), Expect = 2e-16
 Identities = 45/72 (62%), Positives = 45/72 (62%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  NKSINPDE           IL GDKSE VQD           GIETAGGVMT LIKR
Sbjct: 357 KELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKR 416

Query: 681 NTTIPTKQTQTF 716
           NTTIPTKQTQTF
Sbjct: 417 NTTIPTKQTQTF 428


>AK222628-1|BAD96348.1|  493|Homo sapiens heat shock 70kDa protein 8
           isoform 2 variant protein.
          Length = 493

 Score =  165 bits (401), Expect = 1e-40
 Identities = 78/88 (88%), Positives = 85/88 (96%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQASIEIDSL+EGIDFYTSITRARFEELNADLFR T++PVEK+LRDAK+DK+Q
Sbjct: 271 KRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQ 330

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHDIVLVGGSTRIPK+QKLLQDFFNGKE
Sbjct: 331 IHDIVLVGGSTRIPKIQKLLQDFFNGKE 358



 Score =  164 bits (398), Expect = 3e-40
 Identities = 75/84 (89%), Positives = 80/84 (95%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKY 181
           G  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHF+ EFKRK+
Sbjct: 190 GAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKH 249

Query: 182 KKDLATNKRALRRLRTACERAKRT 253
           KKD++ NKRA+RRLRTACERAKRT
Sbjct: 250 KKDISENKRAVRRLRTACERAKRT 273



 Score = 80.6 bits (190), Expect = 5e-15
 Identities = 43/72 (59%), Positives = 43/72 (59%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  NKSINPDE           IL GDKSE VQD           GIETAGGV T LIKR
Sbjct: 357 KELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVTTVLIKR 416

Query: 681 NTTIPTKQTQTF 716
           NTTIP KQTQTF
Sbjct: 417 NTTIPIKQTQTF 428


>AF352832-1|AAK17898.1|  646|Homo sapiens constitutive heat shock
           protein 70 protein.
          Length = 646

 Score =  165 bits (401), Expect = 1e-40
 Identities = 78/88 (88%), Positives = 85/88 (96%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQASIEIDSL+EGIDFYTSITRARFEELNADLFR T++PVEK+LRDAK+DK+Q
Sbjct: 271 KRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQ 330

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHDIVLVGGSTRIPK+QKLLQDFFNGKE
Sbjct: 331 IHDIVLVGGSTRIPKIQKLLQDFFNGKE 358



 Score =  164 bits (398), Expect = 3e-40
 Identities = 75/84 (89%), Positives = 80/84 (95%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKY 181
           G  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHF+ EFKRK+
Sbjct: 190 GAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKH 249

Query: 182 KKDLATNKRALRRLRTACERAKRT 253
           KKD++ NKRA+RRLRTACERAKRT
Sbjct: 250 KKDISENKRAVRRLRTACERAKRT 273



 Score = 85.4 bits (202), Expect = 2e-16
 Identities = 45/72 (62%), Positives = 45/72 (62%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  NKSINPDE           IL GDKSE VQD           GIETAGGVMT LIKR
Sbjct: 357 KELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKR 416

Query: 681 NTTIPTKQTQTF 716
           NTTIPTKQTQTF
Sbjct: 417 NTTIPTKQTQTF 428


>AB034951-1|BAB18615.1|  493|Homo sapiens heat shock cognate protein
           54 protein.
          Length = 493

 Score =  165 bits (401), Expect = 1e-40
 Identities = 78/88 (88%), Positives = 85/88 (96%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQASIEIDSL+EGIDFYTSITRARFEELNADLFR T++PVEK+LRDAK+DK+Q
Sbjct: 271 KRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQ 330

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHDIVLVGGSTRIPK+QKLLQDFFNGKE
Sbjct: 331 IHDIVLVGGSTRIPKIQKLLQDFFNGKE 358



 Score =  164 bits (398), Expect = 3e-40
 Identities = 75/84 (89%), Positives = 80/84 (95%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKY 181
           G  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHF+ EFKRK+
Sbjct: 190 GAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKH 249

Query: 182 KKDLATNKRALRRLRTACERAKRT 253
           KKD++ NKRA+RRLRTACERAKRT
Sbjct: 250 KKDISENKRAVRRLRTACERAKRT 273



 Score = 85.4 bits (202), Expect = 2e-16
 Identities = 45/72 (62%), Positives = 45/72 (62%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  NKSINPDE           IL GDKSE VQD           GIETAGGVMT LIKR
Sbjct: 357 KELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKR 416

Query: 681 NTTIPTKQTQTF 716
           NTTIPTKQTQTF
Sbjct: 417 NTTIPTKQTQTF 428


>X51757-1|CAA36061.1|  643|Homo sapiens protein ( Human heat-shock
           protein HSP70B' gene. ).
          Length = 643

 Score =  163 bits (396), Expect = 6e-40
 Identities = 77/88 (87%), Positives = 85/88 (96%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQA++EIDSLFEG+DFYTSITRARFEEL +DLFRST+EPVEK+LRDAK+DKAQ
Sbjct: 273 KRTLSSSTQATLEIDSLFEGVDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQ 332

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHD+VLVGGSTRIPKVQKLLQDFFNGKE
Sbjct: 333 IHDVVLVGGSTRIPKVQKLLQDFFNGKE 360



 Score =  147 bits (357), Expect = 3e-35
 Identities = 66/81 (81%), Positives = 77/81 (95%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNVLIFDLGGGTFDVS+L+I+ G+FEVK+TAGDTHLGGEDFDNR+VNHF++EF+RK+ KD
Sbjct: 195 RNVLIFDLGGGTFDVSVLSIDAGVFEVKATAGDTHLGGEDFDNRLVNHFMEEFRRKHGKD 254

Query: 191 LATNKRALRRLRTACERAKRT 253
           L+ NKRAL RLRTACERAKRT
Sbjct: 255 LSGNKRALGRLRTACERAKRT 275



 Score = 80.6 bits (190), Expect = 5e-15
 Identities = 41/72 (56%), Positives = 45/72 (62%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  NKSINPDE           +L GDK E+VQD           G+ETAGGVMTTLI+R
Sbjct: 359 KELNKSINPDEAVAYGAAVQAAVLMGDKCEKVQDLLLLDVAPLSLGLETAGGVMTTLIQR 418

Query: 681 NTTIPTKQTQTF 716
           N TIPTKQTQTF
Sbjct: 419 NATIPTKQTQTF 430


>DQ521571-1|ABF47108.1|  643|Homo sapiens heat shock 70kDa protein 6
           (HSP70B') protein.
          Length = 643

 Score =  163 bits (396), Expect = 6e-40
 Identities = 77/88 (87%), Positives = 85/88 (96%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQA++EIDSLFEG+DFYTSITRARFEEL +DLFRST+EPVEK+LRDAK+DKAQ
Sbjct: 273 KRTLSSSTQATLEIDSLFEGVDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQ 332

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHD+VLVGGSTRIPKVQKLLQDFFNGKE
Sbjct: 333 IHDVVLVGGSTRIPKVQKLLQDFFNGKE 360



 Score =  150 bits (364), Expect = 4e-36
 Identities = 67/81 (82%), Positives = 78/81 (96%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNVLIFDLGGGTFDVS+L+I+ G+FEVK+TAGDTHLGGEDFDNR+VNHF++EF+RK+ KD
Sbjct: 195 RNVLIFDLGGGTFDVSVLSIDAGVFEVKATAGDTHLGGEDFDNRLVNHFMEEFRRKHGKD 254

Query: 191 LATNKRALRRLRTACERAKRT 253
           L+ NKRALRRLRTACERAKRT
Sbjct: 255 LSGNKRALRRLRTACERAKRT 275



 Score = 80.6 bits (190), Expect = 5e-15
 Identities = 41/72 (56%), Positives = 45/72 (62%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  NKSINPDE           +L GDK E+VQD           G+ETAGGVMTTLI+R
Sbjct: 359 KELNKSINPDEAVAYGAAVQAAVLMGDKCEKVQDLLLLDVAPLSLGLETAGGVMTTLIQR 418

Query: 681 NTTIPTKQTQTF 716
           N TIPTKQTQTF
Sbjct: 419 NATIPTKQTQTF 430


>BC035665-1|AAH35665.1|  643|Homo sapiens heat shock 70kDa protein 6
           (HSP70B') protein.
          Length = 643

 Score =  163 bits (396), Expect = 6e-40
 Identities = 77/88 (87%), Positives = 85/88 (96%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQA++EIDSLFEG+DFYTSITRARFEEL +DLFRST+EPVEK+LRDAK+DKAQ
Sbjct: 273 KRTLSSSTQATLEIDSLFEGVDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQ 332

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHD+VLVGGSTRIPKVQKLLQDFFNGKE
Sbjct: 333 IHDVVLVGGSTRIPKVQKLLQDFFNGKE 360



 Score =  150 bits (364), Expect = 4e-36
 Identities = 67/81 (82%), Positives = 78/81 (96%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNVLIFDLGGGTFDVS+L+I+ G+FEVK+TAGDTHLGGEDFDNR+VNHF++EF+RK+ KD
Sbjct: 195 RNVLIFDLGGGTFDVSVLSIDAGVFEVKATAGDTHLGGEDFDNRLVNHFMEEFRRKHGKD 254

Query: 191 LATNKRALRRLRTACERAKRT 253
           L+ NKRALRRLRTACERAKRT
Sbjct: 255 LSGNKRALRRLRTACERAKRT 275



 Score = 80.6 bits (190), Expect = 5e-15
 Identities = 41/72 (56%), Positives = 45/72 (62%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  NKSINPDE           +L GDK E+VQD           G+ETAGGVMTTLI+R
Sbjct: 359 KELNKSINPDEAVAYGAAVQAAVLMGDKCEKVQDLLLLDVAPLSLGLETAGGVMTTLIQR 418

Query: 681 NTTIPTKQTQTF 716
           N TIPTKQTQTF
Sbjct: 419 NATIPTKQTQTF 430


>AL590385-3|CAI16120.1|  643|Homo sapiens heat shock 70kDa protein 6
           (HSP70B') protein.
          Length = 643

 Score =  163 bits (396), Expect = 6e-40
 Identities = 77/88 (87%), Positives = 85/88 (96%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQA++EIDSLFEG+DFYTSITRARFEEL +DLFRST+EPVEK+LRDAK+DKAQ
Sbjct: 273 KRTLSSSTQATLEIDSLFEGVDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQ 332

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHD+VLVGGSTRIPKVQKLLQDFFNGKE
Sbjct: 333 IHDVVLVGGSTRIPKVQKLLQDFFNGKE 360



 Score =  150 bits (364), Expect = 4e-36
 Identities = 67/81 (82%), Positives = 78/81 (96%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNVLIFDLGGGTFDVS+L+I+ G+FEVK+TAGDTHLGGEDFDNR+VNHF++EF+RK+ KD
Sbjct: 195 RNVLIFDLGGGTFDVSVLSIDAGVFEVKATAGDTHLGGEDFDNRLVNHFMEEFRRKHGKD 254

Query: 191 LATNKRALRRLRTACERAKRT 253
           L+ NKRALRRLRTACERAKRT
Sbjct: 255 LSGNKRALRRLRTACERAKRT 275



 Score = 80.6 bits (190), Expect = 5e-15
 Identities = 41/72 (56%), Positives = 45/72 (62%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  NKSINPDE           +L GDK E+VQD           G+ETAGGVMTTLI+R
Sbjct: 359 KELNKSINPDEAVAYGAAVQAAVLMGDKCEKVQDLLLLDVAPLSLGLETAGGVMTTLIQR 418

Query: 681 NTTIPTKQTQTF 716
           N TIPTKQTQTF
Sbjct: 419 NATIPTKQTQTF 430


>M59830-1|AAA63227.1|  641|Homo sapiens heat shock-induced protein
           protein.
          Length = 641

 Score =  162 bits (393), Expect = 1e-39
 Identities = 77/88 (87%), Positives = 85/88 (96%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQAS+EIDSLFEGIDFYTSITRARFEEL +DLFRST+EPVEK+LRDAK+DKAQ
Sbjct: 271 KRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQ 330

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHD+VLVGGSTRIPKVQKLLQDFFNG++
Sbjct: 331 IHDLVLVGGSTRIPKVQKLLQDFFNGRD 358



 Score =  159 bits (387), Expect = 7e-39
 Identities = 72/81 (88%), Positives = 80/81 (98%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNVLIFDLGGGTFDVSILTI+DGIFEVK+TAGDTHLGGEDFDNR+VNHFV+EFKRK+KKD
Sbjct: 193 RNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKD 252

Query: 191 LATNKRALRRLRTACERAKRT 253
           ++ NKRA+RRLRTACERAKRT
Sbjct: 253 ISQNKRAVRRLRTACERAKRT 273



 Score = 79.4 bits (187), Expect = 1e-14
 Identities = 41/69 (59%), Positives = 43/69 (62%)
 Frame = +3

Query: 510 NKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTT 689
           NKSINPDE           IL GDKSE VQD           G+ETAGGVMT LIKRN+T
Sbjct: 360 NKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNST 419

Query: 690 IPTKQTQTF 716
           IPTKQTQ F
Sbjct: 420 IPTKQTQIF 428


>M59828-1|AAA63226.1|  641|Homo sapiens heat shock-induced protein
           protein.
          Length = 641

 Score =  162 bits (393), Expect = 1e-39
 Identities = 77/88 (87%), Positives = 85/88 (96%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQAS+EIDSLFEGIDFYTSITRARFEEL +DLFRST+EPVEK+LRDAK+DKAQ
Sbjct: 271 KRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQ 330

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHD+VLVGGSTRIPKVQKLLQDFFNG++
Sbjct: 331 IHDLVLVGGSTRIPKVQKLLQDFFNGRD 358



 Score =  159 bits (387), Expect = 7e-39
 Identities = 72/81 (88%), Positives = 80/81 (98%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNVLIFDLGGGTFDVSILTI+DGIFEVK+TAGDTHLGGEDFDNR+VNHFV+EFKRK+KKD
Sbjct: 193 RNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKD 252

Query: 191 LATNKRALRRLRTACERAKRT 253
           ++ NKRA+RRLRTACERAKRT
Sbjct: 253 ISQNKRAVRRLRTACERAKRT 273



 Score = 79.4 bits (187), Expect = 1e-14
 Identities = 41/69 (59%), Positives = 43/69 (62%)
 Frame = +3

Query: 510 NKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTT 689
           NKSINPDE           IL GDKSE VQD           G+ETAGGVMT LIKRN+T
Sbjct: 360 NKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNST 419

Query: 690 IPTKQTQTF 716
           IPTKQTQ F
Sbjct: 420 IPTKQTQIF 428


>M11717-1|AAA52697.1|  640|Homo sapiens heat shock protein protein.
          Length = 640

 Score =  162 bits (393), Expect = 1e-39
 Identities = 77/88 (87%), Positives = 85/88 (96%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQAS+EIDSLFEGIDFYTSITRARFEEL +DLFRST+EPVEK+LRDAK+DKAQ
Sbjct: 271 KRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQ 330

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHD+VLVGGSTRIPKVQKLLQDFFNG++
Sbjct: 331 IHDLVLVGGSTRIPKVQKLLQDFFNGRD 358



 Score =  159 bits (387), Expect = 7e-39
 Identities = 72/81 (88%), Positives = 80/81 (98%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNVLIFDLGGGTFDVSILTI+DGIFEVK+TAGDTHLGGEDFDNR+VNHFV+EFKRK+KKD
Sbjct: 193 RNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKD 252

Query: 191 LATNKRALRRLRTACERAKRT 253
           ++ NKRA+RRLRTACERAKRT
Sbjct: 253 ISQNKRAVRRLRTACERAKRT 273



 Score = 79.4 bits (187), Expect = 1e-14
 Identities = 41/69 (59%), Positives = 43/69 (62%)
 Frame = +3

Query: 510 NKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTT 689
           NKSINPDE           IL GDKSE VQD           G+ETAGGVMT LIKRN+T
Sbjct: 360 NKSINPDEAVGYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNST 419

Query: 690 IPTKQTQTF 716
           IPTKQTQ F
Sbjct: 420 IPTKQTQIF 428


>DQ451402-1|ABD96830.1|  641|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 641

 Score =  162 bits (393), Expect = 1e-39
 Identities = 77/88 (87%), Positives = 85/88 (96%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQAS+EIDSLFEGIDFYTSITRARFEEL +DLFRST+EPVEK+LRDAK+DKAQ
Sbjct: 271 KRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQ 330

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHD+VLVGGSTRIPKVQKLLQDFFNG++
Sbjct: 331 IHDLVLVGGSTRIPKVQKLLQDFFNGRD 358



 Score =  159 bits (387), Expect = 7e-39
 Identities = 72/81 (88%), Positives = 80/81 (98%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNVLIFDLGGGTFDVSILTI+DGIFEVK+TAGDTHLGGEDFDNR+VNHFV+EFKRK+KKD
Sbjct: 193 RNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKD 252

Query: 191 LATNKRALRRLRTACERAKRT 253
           ++ NKRA+RRLRTACERAKRT
Sbjct: 253 ISQNKRAVRRLRTACERAKRT 273



 Score = 79.4 bits (187), Expect = 1e-14
 Identities = 41/69 (59%), Positives = 43/69 (62%)
 Frame = +3

Query: 510 NKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTT 689
           NKSINPDE           IL GDKSE VQD           G+ETAGGVMT LIKRN+T
Sbjct: 360 NKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNST 419

Query: 690 IPTKQTQTF 716
           IPTKQTQ F
Sbjct: 420 IPTKQTQIF 428


>DQ388429-1|ABD48956.1|  641|Homo sapiens heat shock 70kDa protein
           1B protein.
          Length = 641

 Score =  162 bits (393), Expect = 1e-39
 Identities = 77/88 (87%), Positives = 85/88 (96%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQAS+EIDSLFEGIDFYTSITRARFEEL +DLFRST+EPVEK+LRDAK+DKAQ
Sbjct: 271 KRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQ 330

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHD+VLVGGSTRIPKVQKLLQDFFNG++
Sbjct: 331 IHDLVLVGGSTRIPKVQKLLQDFFNGRD 358



 Score =  159 bits (387), Expect = 7e-39
 Identities = 72/81 (88%), Positives = 80/81 (98%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNVLIFDLGGGTFDVSILTI+DGIFEVK+TAGDTHLGGEDFDNR+VNHFV+EFKRK+KKD
Sbjct: 193 RNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKD 252

Query: 191 LATNKRALRRLRTACERAKRT 253
           ++ NKRA+RRLRTACERAKRT
Sbjct: 253 ISQNKRAVRRLRTACERAKRT 273



 Score = 79.4 bits (187), Expect = 1e-14
 Identities = 41/69 (59%), Positives = 43/69 (62%)
 Frame = +3

Query: 510 NKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTT 689
           NKSINPDE           IL GDKSE VQD           G+ETAGGVMT LIKRN+T
Sbjct: 360 NKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNST 419

Query: 690 IPTKQTQTF 716
           IPTKQTQ F
Sbjct: 420 IPTKQTQIF 428


>BC063507-1|AAH63507.1|  641|Homo sapiens heat shock 70kDa protein
           1B protein.
          Length = 641

 Score =  162 bits (393), Expect = 1e-39
 Identities = 77/88 (87%), Positives = 85/88 (96%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQAS+EIDSLFEGIDFYTSITRARFEEL +DLFRST+EPVEK+LRDAK+DKAQ
Sbjct: 271 KRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQ 330

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHD+VLVGGSTRIPKVQKLLQDFFNG++
Sbjct: 331 IHDLVLVGGSTRIPKVQKLLQDFFNGRD 358



 Score =  159 bits (387), Expect = 7e-39
 Identities = 72/81 (88%), Positives = 80/81 (98%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNVLIFDLGGGTFDVSILTI+DGIFEVK+TAGDTHLGGEDFDNR+VNHFV+EFKRK+KKD
Sbjct: 193 RNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKD 252

Query: 191 LATNKRALRRLRTACERAKRT 253
           ++ NKRA+RRLRTACERAKRT
Sbjct: 253 ISQNKRAVRRLRTACERAKRT 273



 Score = 79.4 bits (187), Expect = 1e-14
 Identities = 41/69 (59%), Positives = 43/69 (62%)
 Frame = +3

Query: 510 NKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTT 689
           NKSINPDE           IL GDKSE VQD           G+ETAGGVMT LIKRN+T
Sbjct: 360 NKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNST 419

Query: 690 IPTKQTQTF 716
           IPTKQTQ F
Sbjct: 420 IPTKQTQIF 428


>BC057397-1|AAH57397.1|  641|Homo sapiens heat shock 70kDa protein
           1B protein.
          Length = 641

 Score =  162 bits (393), Expect = 1e-39
 Identities = 77/88 (87%), Positives = 85/88 (96%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQAS+EIDSLFEGIDFYTSITRARFEEL +DLFRST+EPVEK+LRDAK+DKAQ
Sbjct: 271 KRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQ 330

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHD+VLVGGSTRIPKVQKLLQDFFNG++
Sbjct: 331 IHDLVLVGGSTRIPKVQKLLQDFFNGRD 358



 Score =  159 bits (387), Expect = 7e-39
 Identities = 72/81 (88%), Positives = 80/81 (98%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNVLIFDLGGGTFDVSILTI+DGIFEVK+TAGDTHLGGEDFDNR+VNHFV+EFKRK+KKD
Sbjct: 193 RNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKD 252

Query: 191 LATNKRALRRLRTACERAKRT 253
           ++ NKRA+RRLRTACERAKRT
Sbjct: 253 ISQNKRAVRRLRTACERAKRT 273



 Score = 79.4 bits (187), Expect = 1e-14
 Identities = 41/69 (59%), Positives = 43/69 (62%)
 Frame = +3

Query: 510 NKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTT 689
           NKSINPDE           IL GDKSE VQD           G+ETAGGVMT LIKRN+T
Sbjct: 360 NKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNST 419

Query: 690 IPTKQTQTF 716
           IPTKQTQ F
Sbjct: 420 IPTKQTQIF 428


>BC018740-1|AAH18740.1|  641|Homo sapiens HSPA1A protein protein.
          Length = 641

 Score =  162 bits (393), Expect = 1e-39
 Identities = 77/88 (87%), Positives = 85/88 (96%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQAS+EIDSLFEGIDFYTSITRARFEEL +DLFRST+EPVEK+LRDAK+DKAQ
Sbjct: 271 KRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQ 330

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHD+VLVGGSTRIPKVQKLLQDFFNG++
Sbjct: 331 IHDLVLVGGSTRIPKVQKLLQDFFNGRD 358



 Score =  159 bits (387), Expect = 7e-39
 Identities = 72/81 (88%), Positives = 80/81 (98%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNVLIFDLGGGTFDVSILTI+DGIFEVK+TAGDTHLGGEDFDNR+VNHFV+EFKRK+KKD
Sbjct: 193 RNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKD 252

Query: 191 LATNKRALRRLRTACERAKRT 253
           ++ NKRA+RRLRTACERAKRT
Sbjct: 253 ISQNKRAVRRLRTACERAKRT 273



 Score = 79.4 bits (187), Expect = 1e-14
 Identities = 41/69 (59%), Positives = 43/69 (62%)
 Frame = +3

Query: 510 NKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTT 689
           NKSINPDE           IL GDKSE VQD           G+ETAGGVMT LIKRN+T
Sbjct: 360 NKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNST 419

Query: 690 IPTKQTQTF 716
           IPTKQTQ F
Sbjct: 420 IPTKQTQIF 428


>BC009322-1|AAH09322.1|  641|Homo sapiens HSPA1A protein protein.
          Length = 641

 Score =  162 bits (393), Expect = 1e-39
 Identities = 77/88 (87%), Positives = 85/88 (96%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQAS+EIDSLFEGIDFYTSITRARFEEL +DLFRST+EPVEK+LRDAK+DKAQ
Sbjct: 271 KRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQ 330

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHD+VLVGGSTRIPKVQKLLQDFFNG++
Sbjct: 331 IHDLVLVGGSTRIPKVQKLLQDFFNGRD 358



 Score =  159 bits (387), Expect = 7e-39
 Identities = 72/81 (88%), Positives = 80/81 (98%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNVLIFDLGGGTFDVSILTI+DGIFEVK+TAGDTHLGGEDFDNR+VNHFV+EFKRK+KKD
Sbjct: 193 RNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKD 252

Query: 191 LATNKRALRRLRTACERAKRT 253
           ++ NKRA+RRLRTACERAKRT
Sbjct: 253 ISQNKRAVRRLRTACERAKRT 273



 Score = 79.4 bits (187), Expect = 1e-14
 Identities = 41/69 (59%), Positives = 43/69 (62%)
 Frame = +3

Query: 510 NKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTT 689
           NKSINPDE           IL GDKSE VQD           G+ETAGGVMT LIKRN+T
Sbjct: 360 NKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNST 419

Query: 690 IPTKQTQTF 716
           IPTKQTQ F
Sbjct: 420 IPTKQTQIF 428


>BC002453-1|AAH02453.1|  641|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 641

 Score =  162 bits (393), Expect = 1e-39
 Identities = 77/88 (87%), Positives = 85/88 (96%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQAS+EIDSLFEGIDFYTSITRARFEEL +DLFRST+EPVEK+LRDAK+DKAQ
Sbjct: 271 KRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQ 330

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHD+VLVGGSTRIPKVQKLLQDFFNG++
Sbjct: 331 IHDLVLVGGSTRIPKVQKLLQDFFNGRD 358



 Score =  159 bits (387), Expect = 7e-39
 Identities = 72/81 (88%), Positives = 80/81 (98%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNVLIFDLGGGTFDVSILTI+DGIFEVK+TAGDTHLGGEDFDNR+VNHFV+EFKRK+KKD
Sbjct: 193 RNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKD 252

Query: 191 LATNKRALRRLRTACERAKRT 253
           ++ NKRA+RRLRTACERAKRT
Sbjct: 253 ISQNKRAVRRLRTACERAKRT 273



 Score = 79.4 bits (187), Expect = 1e-14
 Identities = 41/69 (59%), Positives = 43/69 (62%)
 Frame = +3

Query: 510 NKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTT 689
           NKSINPDE           IL GDKSE VQD           G+ETAGGVMT LIKRN+T
Sbjct: 360 NKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNST 419

Query: 690 IPTKQTQTF 716
           IPTKQTQ F
Sbjct: 420 IPTKQTQIF 428


>BA000025-9|BAB63300.1|  641|Homo sapiens heat shock protein
           protein.
          Length = 641

 Score =  162 bits (393), Expect = 1e-39
 Identities = 77/88 (87%), Positives = 85/88 (96%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQAS+EIDSLFEGIDFYTSITRARFEEL +DLFRST+EPVEK+LRDAK+DKAQ
Sbjct: 271 KRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQ 330

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHD+VLVGGSTRIPKVQKLLQDFFNG++
Sbjct: 331 IHDLVLVGGSTRIPKVQKLLQDFFNGRD 358



 Score =  159 bits (387), Expect = 7e-39
 Identities = 72/81 (88%), Positives = 80/81 (98%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNVLIFDLGGGTFDVSILTI+DGIFEVK+TAGDTHLGGEDFDNR+VNHFV+EFKRK+KKD
Sbjct: 193 RNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKD 252

Query: 191 LATNKRALRRLRTACERAKRT 253
           ++ NKRA+RRLRTACERAKRT
Sbjct: 253 ISQNKRAVRRLRTACERAKRT 273



 Score = 79.4 bits (187), Expect = 1e-14
 Identities = 41/69 (59%), Positives = 43/69 (62%)
 Frame = +3

Query: 510 NKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTT 689
           NKSINPDE           IL GDKSE VQD           G+ETAGGVMT LIKRN+T
Sbjct: 360 NKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNST 419

Query: 690 IPTKQTQTF 716
           IPTKQTQ F
Sbjct: 420 IPTKQTQIF 428


>BA000025-8|BAB63299.1|  641|Homo sapiens heat shock protein
           protein.
          Length = 641

 Score =  162 bits (393), Expect = 1e-39
 Identities = 77/88 (87%), Positives = 85/88 (96%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQAS+EIDSLFEGIDFYTSITRARFEEL +DLFRST+EPVEK+LRDAK+DKAQ
Sbjct: 271 KRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQ 330

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHD+VLVGGSTRIPKVQKLLQDFFNG++
Sbjct: 331 IHDLVLVGGSTRIPKVQKLLQDFFNGRD 358



 Score =  159 bits (387), Expect = 7e-39
 Identities = 72/81 (88%), Positives = 80/81 (98%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNVLIFDLGGGTFDVSILTI+DGIFEVK+TAGDTHLGGEDFDNR+VNHFV+EFKRK+KKD
Sbjct: 193 RNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKD 252

Query: 191 LATNKRALRRLRTACERAKRT 253
           ++ NKRA+RRLRTACERAKRT
Sbjct: 253 ISQNKRAVRRLRTACERAKRT 273



 Score = 79.4 bits (187), Expect = 1e-14
 Identities = 41/69 (59%), Positives = 43/69 (62%)
 Frame = +3

Query: 510 NKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTT 689
           NKSINPDE           IL GDKSE VQD           G+ETAGGVMT LIKRN+T
Sbjct: 360 NKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNST 419

Query: 690 IPTKQTQTF 716
           IPTKQTQ F
Sbjct: 420 IPTKQTQIF 428


>AL929592-7|CAI18466.1|  641|Homo sapiens heat shock 70kDa protein
           1B protein.
          Length = 641

 Score =  162 bits (393), Expect = 1e-39
 Identities = 77/88 (87%), Positives = 85/88 (96%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQAS+EIDSLFEGIDFYTSITRARFEEL +DLFRST+EPVEK+LRDAK+DKAQ
Sbjct: 271 KRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQ 330

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHD+VLVGGSTRIPKVQKLLQDFFNG++
Sbjct: 331 IHDLVLVGGSTRIPKVQKLLQDFFNGRD 358



 Score =  159 bits (387), Expect = 7e-39
 Identities = 72/81 (88%), Positives = 80/81 (98%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNVLIFDLGGGTFDVSILTI+DGIFEVK+TAGDTHLGGEDFDNR+VNHFV+EFKRK+KKD
Sbjct: 193 RNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKD 252

Query: 191 LATNKRALRRLRTACERAKRT 253
           ++ NKRA+RRLRTACERAKRT
Sbjct: 253 ISQNKRAVRRLRTACERAKRT 273



 Score = 79.4 bits (187), Expect = 1e-14
 Identities = 41/69 (59%), Positives = 43/69 (62%)
 Frame = +3

Query: 510 NKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTT 689
           NKSINPDE           IL GDKSE VQD           G+ETAGGVMT LIKRN+T
Sbjct: 360 NKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNST 419

Query: 690 IPTKQTQTF 716
           IPTKQTQ F
Sbjct: 420 IPTKQTQIF 428


>AL929592-6|CAI18465.1|  476|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 476

 Score =  162 bits (393), Expect = 1e-39
 Identities = 77/88 (87%), Positives = 85/88 (96%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQAS+EIDSLFEGIDFYTSITRARFEEL +DLFRST+EPVEK+LRDAK+DKAQ
Sbjct: 106 KRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQ 165

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHD+VLVGGSTRIPKVQKLLQDFFNG++
Sbjct: 166 IHDLVLVGGSTRIPKVQKLLQDFFNGRD 193



 Score =  159 bits (387), Expect = 7e-39
 Identities = 72/81 (88%), Positives = 80/81 (98%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNVLIFDLGGGTFDVSILTI+DGIFEVK+TAGDTHLGGEDFDNR+VNHFV+EFKRK+KKD
Sbjct: 28  RNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKD 87

Query: 191 LATNKRALRRLRTACERAKRT 253
           ++ NKRA+RRLRTACERAKRT
Sbjct: 88  ISQNKRAVRRLRTACERAKRT 108



 Score = 79.4 bits (187), Expect = 1e-14
 Identities = 41/69 (59%), Positives = 43/69 (62%)
 Frame = +3

Query: 510 NKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTT 689
           NKSINPDE           IL GDKSE VQD           G+ETAGGVMT LIKRN+T
Sbjct: 195 NKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNST 254

Query: 690 IPTKQTQTF 716
           IPTKQTQ F
Sbjct: 255 IPTKQTQIF 263


>AL929592-5|CAI18464.1|  641|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 641

 Score =  162 bits (393), Expect = 1e-39
 Identities = 77/88 (87%), Positives = 85/88 (96%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQAS+EIDSLFEGIDFYTSITRARFEEL +DLFRST+EPVEK+LRDAK+DKAQ
Sbjct: 271 KRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQ 330

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHD+VLVGGSTRIPKVQKLLQDFFNG++
Sbjct: 331 IHDLVLVGGSTRIPKVQKLLQDFFNGRD 358



 Score =  159 bits (387), Expect = 7e-39
 Identities = 72/81 (88%), Positives = 80/81 (98%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNVLIFDLGGGTFDVSILTI+DGIFEVK+TAGDTHLGGEDFDNR+VNHFV+EFKRK+KKD
Sbjct: 193 RNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKD 252

Query: 191 LATNKRALRRLRTACERAKRT 253
           ++ NKRA+RRLRTACERAKRT
Sbjct: 253 ISQNKRAVRRLRTACERAKRT 273



 Score = 79.4 bits (187), Expect = 1e-14
 Identities = 41/69 (59%), Positives = 43/69 (62%)
 Frame = +3

Query: 510 NKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTT 689
           NKSINPDE           IL GDKSE VQD           G+ETAGGVMT LIKRN+T
Sbjct: 360 NKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNST 419

Query: 690 IPTKQTQTF 716
           IPTKQTQ F
Sbjct: 420 IPTKQTQIF 428


>AL671762-7|CAI18217.1|  641|Homo sapiens heat shock 70kDa protein
           1B protein.
          Length = 641

 Score =  162 bits (393), Expect = 1e-39
 Identities = 77/88 (87%), Positives = 85/88 (96%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQAS+EIDSLFEGIDFYTSITRARFEEL +DLFRST+EPVEK+LRDAK+DKAQ
Sbjct: 271 KRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQ 330

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHD+VLVGGSTRIPKVQKLLQDFFNG++
Sbjct: 331 IHDLVLVGGSTRIPKVQKLLQDFFNGRD 358



 Score =  159 bits (387), Expect = 7e-39
 Identities = 72/81 (88%), Positives = 80/81 (98%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNVLIFDLGGGTFDVSILTI+DGIFEVK+TAGDTHLGGEDFDNR+VNHFV+EFKRK+KKD
Sbjct: 193 RNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKD 252

Query: 191 LATNKRALRRLRTACERAKRT 253
           ++ NKRA+RRLRTACERAKRT
Sbjct: 253 ISQNKRAVRRLRTACERAKRT 273



 Score = 79.4 bits (187), Expect = 1e-14
 Identities = 41/69 (59%), Positives = 43/69 (62%)
 Frame = +3

Query: 510 NKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTT 689
           NKSINPDE           IL GDKSE VQD           G+ETAGGVMT LIKRN+T
Sbjct: 360 NKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNST 419

Query: 690 IPTKQTQTF 716
           IPTKQTQ F
Sbjct: 420 IPTKQTQIF 428


>AL671762-6|CAI18216.1|  641|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 641

 Score =  162 bits (393), Expect = 1e-39
 Identities = 77/88 (87%), Positives = 85/88 (96%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQAS+EIDSLFEGIDFYTSITRARFEEL +DLFRST+EPVEK+LRDAK+DKAQ
Sbjct: 271 KRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQ 330

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHD+VLVGGSTRIPKVQKLLQDFFNG++
Sbjct: 331 IHDLVLVGGSTRIPKVQKLLQDFFNGRD 358



 Score =  159 bits (387), Expect = 7e-39
 Identities = 72/81 (88%), Positives = 80/81 (98%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNVLIFDLGGGTFDVSILTI+DGIFEVK+TAGDTHLGGEDFDNR+VNHFV+EFKRK+KKD
Sbjct: 193 RNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKD 252

Query: 191 LATNKRALRRLRTACERAKRT 253
           ++ NKRA+RRLRTACERAKRT
Sbjct: 253 ISQNKRAVRRLRTACERAKRT 273



 Score = 79.4 bits (187), Expect = 1e-14
 Identities = 41/69 (59%), Positives = 43/69 (62%)
 Frame = +3

Query: 510 NKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTT 689
           NKSINPDE           IL GDKSE VQD           G+ETAGGVMT LIKRN+T
Sbjct: 360 NKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNST 419

Query: 690 IPTKQTQTF 716
           IPTKQTQ F
Sbjct: 420 IPTKQTQIF 428


>AL671762-5|CAM25532.1|  476|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 476

 Score =  162 bits (393), Expect = 1e-39
 Identities = 77/88 (87%), Positives = 85/88 (96%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQAS+EIDSLFEGIDFYTSITRARFEEL +DLFRST+EPVEK+LRDAK+DKAQ
Sbjct: 106 KRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQ 165

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHD+VLVGGSTRIPKVQKLLQDFFNG++
Sbjct: 166 IHDLVLVGGSTRIPKVQKLLQDFFNGRD 193



 Score =  159 bits (387), Expect = 7e-39
 Identities = 72/81 (88%), Positives = 80/81 (98%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNVLIFDLGGGTFDVSILTI+DGIFEVK+TAGDTHLGGEDFDNR+VNHFV+EFKRK+KKD
Sbjct: 28  RNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKD 87

Query: 191 LATNKRALRRLRTACERAKRT 253
           ++ NKRA+RRLRTACERAKRT
Sbjct: 88  ISQNKRAVRRLRTACERAKRT 108



 Score = 79.4 bits (187), Expect = 1e-14
 Identities = 41/69 (59%), Positives = 43/69 (62%)
 Frame = +3

Query: 510 NKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTT 689
           NKSINPDE           IL GDKSE VQD           G+ETAGGVMT LIKRN+T
Sbjct: 195 NKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNST 254

Query: 690 IPTKQTQTF 716
           IPTKQTQ F
Sbjct: 255 IPTKQTQIF 263


>AL662834-18|CAI17738.1|  641|Homo sapiens heat shock 70kDa protein
           1B protein.
          Length = 641

 Score =  162 bits (393), Expect = 1e-39
 Identities = 77/88 (87%), Positives = 85/88 (96%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQAS+EIDSLFEGIDFYTSITRARFEEL +DLFRST+EPVEK+LRDAK+DKAQ
Sbjct: 271 KRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQ 330

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHD+VLVGGSTRIPKVQKLLQDFFNG++
Sbjct: 331 IHDLVLVGGSTRIPKVQKLLQDFFNGRD 358



 Score =  159 bits (387), Expect = 7e-39
 Identities = 72/81 (88%), Positives = 80/81 (98%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNVLIFDLGGGTFDVSILTI+DGIFEVK+TAGDTHLGGEDFDNR+VNHFV+EFKRK+KKD
Sbjct: 193 RNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKD 252

Query: 191 LATNKRALRRLRTACERAKRT 253
           ++ NKRA+RRLRTACERAKRT
Sbjct: 253 ISQNKRAVRRLRTACERAKRT 273



 Score = 79.4 bits (187), Expect = 1e-14
 Identities = 41/69 (59%), Positives = 43/69 (62%)
 Frame = +3

Query: 510 NKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTT 689
           NKSINPDE           IL GDKSE VQD           G+ETAGGVMT LIKRN+T
Sbjct: 360 NKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNST 419

Query: 690 IPTKQTQTF 716
           IPTKQTQ F
Sbjct: 420 IPTKQTQIF 428


>AL662834-17|CAI17737.1|  641|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 641

 Score =  162 bits (393), Expect = 1e-39
 Identities = 77/88 (87%), Positives = 85/88 (96%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQAS+EIDSLFEGIDFYTSITRARFEEL +DLFRST+EPVEK+LRDAK+DKAQ
Sbjct: 271 KRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQ 330

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHD+VLVGGSTRIPKVQKLLQDFFNG++
Sbjct: 331 IHDLVLVGGSTRIPKVQKLLQDFFNGRD 358



 Score =  159 bits (387), Expect = 7e-39
 Identities = 72/81 (88%), Positives = 80/81 (98%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNVLIFDLGGGTFDVSILTI+DGIFEVK+TAGDTHLGGEDFDNR+VNHFV+EFKRK+KKD
Sbjct: 193 RNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKD 252

Query: 191 LATNKRALRRLRTACERAKRT 253
           ++ NKRA+RRLRTACERAKRT
Sbjct: 253 ISQNKRAVRRLRTACERAKRT 273



 Score = 79.4 bits (187), Expect = 1e-14
 Identities = 41/69 (59%), Positives = 43/69 (62%)
 Frame = +3

Query: 510 NKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTT 689
           NKSINPDE           IL GDKSE VQD           G+ETAGGVMT LIKRN+T
Sbjct: 360 NKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNST 419

Query: 690 IPTKQTQTF 716
           IPTKQTQ F
Sbjct: 420 IPTKQTQIF 428


>AL662834-16|CAM24989.1|  476|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 476

 Score =  162 bits (393), Expect = 1e-39
 Identities = 77/88 (87%), Positives = 85/88 (96%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQAS+EIDSLFEGIDFYTSITRARFEEL +DLFRST+EPVEK+LRDAK+DKAQ
Sbjct: 106 KRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQ 165

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHD+VLVGGSTRIPKVQKLLQDFFNG++
Sbjct: 166 IHDLVLVGGSTRIPKVQKLLQDFFNGRD 193



 Score =  159 bits (387), Expect = 7e-39
 Identities = 72/81 (88%), Positives = 80/81 (98%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNVLIFDLGGGTFDVSILTI+DGIFEVK+TAGDTHLGGEDFDNR+VNHFV+EFKRK+KKD
Sbjct: 28  RNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKD 87

Query: 191 LATNKRALRRLRTACERAKRT 253
           ++ NKRA+RRLRTACERAKRT
Sbjct: 88  ISQNKRAVRRLRTACERAKRT 108



 Score = 79.4 bits (187), Expect = 1e-14
 Identities = 41/69 (59%), Positives = 43/69 (62%)
 Frame = +3

Query: 510 NKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTT 689
           NKSINPDE           IL GDKSE VQD           G+ETAGGVMT LIKRN+T
Sbjct: 195 NKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNST 254

Query: 690 IPTKQTQTF 716
           IPTKQTQ F
Sbjct: 255 IPTKQTQIF 263


>AK223362-1|BAD97082.1|  643|Homo sapiens heat shock 70kDa protein 6
           (HSP70B') variant protein.
          Length = 643

 Score =  162 bits (393), Expect = 1e-39
 Identities = 76/88 (86%), Positives = 85/88 (96%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           +  LSSSTQA++EIDSLFEG+DFYTSITRARFEEL +DLFRST+EPVEK+LRDAK+DKAQ
Sbjct: 273 RRTLSSSTQATLEIDSLFEGVDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQ 332

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHD+VLVGGSTRIPKVQKLLQDFFNGKE
Sbjct: 333 IHDVVLVGGSTRIPKVQKLLQDFFNGKE 360



 Score =  147 bits (357), Expect = 3e-35
 Identities = 65/81 (80%), Positives = 77/81 (95%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNV IFDLGGGTFDVS+L+I+ G+FEVK+TAGDTHLGGEDFDNR+VNHF++EF+RK+ KD
Sbjct: 195 RNVFIFDLGGGTFDVSVLSIDAGVFEVKATAGDTHLGGEDFDNRLVNHFMEEFRRKHGKD 254

Query: 191 LATNKRALRRLRTACERAKRT 253
           L+ NKRALRRLRTACERA+RT
Sbjct: 255 LSGNKRALRRLRTACERARRT 275



 Score = 80.6 bits (190), Expect = 5e-15
 Identities = 41/72 (56%), Positives = 45/72 (62%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  NKSINPDE           +L GDK E+VQD           G+ETAGGVMTTLI+R
Sbjct: 359 KELNKSINPDEAVAYGAAVQAAVLMGDKCEKVQDLLLLDVAPLSLGLETAGGVMTTLIQR 418

Query: 681 NTTIPTKQTQTF 716
           N TIPTKQTQTF
Sbjct: 419 NATIPTKQTQTF 430


>AF134726-7|AAD21816.1|  641|Homo sapiens HSP70-1 protein.
          Length = 641

 Score =  162 bits (393), Expect = 1e-39
 Identities = 77/88 (87%), Positives = 85/88 (96%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQAS+EIDSLFEGIDFYTSITRARFEEL +DLFRST+EPVEK+LRDAK+DKAQ
Sbjct: 271 KRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQ 330

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHD+VLVGGSTRIPKVQKLLQDFFNG++
Sbjct: 331 IHDLVLVGGSTRIPKVQKLLQDFFNGRD 358



 Score =  159 bits (387), Expect = 7e-39
 Identities = 72/81 (88%), Positives = 80/81 (98%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNVLIFDLGGGTFDVSILTI+DGIFEVK+TAGDTHLGGEDFDNR+VNHFV+EFKRK+KKD
Sbjct: 193 RNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKD 252

Query: 191 LATNKRALRRLRTACERAKRT 253
           ++ NKRA+RRLRTACERAKRT
Sbjct: 253 ISQNKRAVRRLRTACERAKRT 273



 Score = 79.4 bits (187), Expect = 1e-14
 Identities = 41/69 (59%), Positives = 43/69 (62%)
 Frame = +3

Query: 510 NKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTT 689
           NKSINPDE           IL GDKSE VQD           G+ETAGGVMT LIKRN+T
Sbjct: 360 NKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNST 419

Query: 690 IPTKQTQTF 716
           IPTKQTQ F
Sbjct: 420 IPTKQTQIF 428


>AF134726-6|AAD21815.1|  641|Homo sapiens HSP70-2 protein.
          Length = 641

 Score =  162 bits (393), Expect = 1e-39
 Identities = 77/88 (87%), Positives = 85/88 (96%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQAS+EIDSLFEGIDFYTSITRARFEEL +DLFRST+EPVEK+LRDAK+DKAQ
Sbjct: 271 KRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQ 330

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHD+VLVGGSTRIPKVQKLLQDFFNG++
Sbjct: 331 IHDLVLVGGSTRIPKVQKLLQDFFNGRD 358



 Score =  159 bits (387), Expect = 7e-39
 Identities = 72/81 (88%), Positives = 80/81 (98%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNVLIFDLGGGTFDVSILTI+DGIFEVK+TAGDTHLGGEDFDNR+VNHFV+EFKRK+KKD
Sbjct: 193 RNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKD 252

Query: 191 LATNKRALRRLRTACERAKRT 253
           ++ NKRA+RRLRTACERAKRT
Sbjct: 253 ISQNKRAVRRLRTACERAKRT 273



 Score = 79.4 bits (187), Expect = 1e-14
 Identities = 41/69 (59%), Positives = 43/69 (62%)
 Frame = +3

Query: 510 NKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTT 689
           NKSINPDE           IL GDKSE VQD           G+ETAGGVMT LIKRN+T
Sbjct: 360 NKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNST 419

Query: 690 IPTKQTQTF 716
           IPTKQTQ F
Sbjct: 420 IPTKQTQIF 428


>AB209818-1|BAD93055.1|  709|Homo sapiens heat shock 70kDa protein
           1A variant protein.
          Length = 709

 Score =  162 bits (393), Expect = 1e-39
 Identities = 77/88 (87%), Positives = 85/88 (96%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQAS+EIDSLFEGIDFYTSITRARFEEL +DLFRST+EPVEK+LRDAK+DKAQ
Sbjct: 339 KRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQ 398

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHD+VLVGGSTRIPKVQKLLQDFFNG++
Sbjct: 399 IHDLVLVGGSTRIPKVQKLLQDFFNGRD 426



 Score =  159 bits (387), Expect = 7e-39
 Identities = 72/81 (88%), Positives = 80/81 (98%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNVLIFDLGGGTFDVSILTI+DGIFEVK+TAGDTHLGGEDFDNR+VNHFV+EFKRK+KKD
Sbjct: 261 RNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKD 320

Query: 191 LATNKRALRRLRTACERAKRT 253
           ++ NKRA+RRLRTACERAKRT
Sbjct: 321 ISQNKRAVRRLRTACERAKRT 341



 Score = 79.4 bits (187), Expect = 1e-14
 Identities = 41/69 (59%), Positives = 43/69 (62%)
 Frame = +3

Query: 510 NKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTT 689
           NKSINPDE           IL GDKSE VQD           G+ETAGGVMT LIKRN+T
Sbjct: 428 NKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNST 487

Query: 690 IPTKQTQTF 716
           IPTKQTQ F
Sbjct: 488 IPTKQTQIF 496


>U56725-1|AAD11466.1|  639|Homo sapiens heat shock protein protein.
          Length = 639

 Score =  161 bits (390), Expect = 3e-39
 Identities = 76/88 (86%), Positives = 83/88 (94%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQASIEIDSL+EG+DFYTSITRARFEELNADLFR T+EPVEK+LRDAK+DK Q
Sbjct: 274 KRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLDKGQ 333

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           I +IVLVGGSTRIPK+QKLLQDFFNGKE
Sbjct: 334 IQEIVLVGGSTRIPKIQKLLQDFFNGKE 361



 Score =  155 bits (375), Expect = 2e-37
 Identities = 71/84 (84%), Positives = 77/84 (91%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKY 181
           G  +NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMV+H  +EFKRK+
Sbjct: 193 GGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKH 252

Query: 182 KKDLATNKRALRRLRTACERAKRT 253
           KKD+  NKRA+RR RTACERAKRT
Sbjct: 253 KKDIGPNKRAVRRSRTACERAKRT 276



 Score = 84.2 bits (199), Expect = 4e-16
 Identities = 45/72 (62%), Positives = 45/72 (62%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  NKSINPDE           IL GDKSE VQD           GIETAGGVMT LIKR
Sbjct: 360 KELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKR 419

Query: 681 NTTIPTKQTQTF 716
           NTTIPTKQTQTF
Sbjct: 420 NTTIPTKQTQTF 431


>L26336-1|AAA52698.1|  639|Homo sapiens heat shock protein protein.
          Length = 639

 Score =  161 bits (390), Expect = 3e-39
 Identities = 76/88 (86%), Positives = 83/88 (94%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQASIEIDSL+EG+DFYTSITRARFEELNADLFR T+EPVEK+LRDAK+DK Q
Sbjct: 274 KRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLDKGQ 333

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           I +IVLVGGSTRIPK+QKLLQDFFNGKE
Sbjct: 334 IQEIVLVGGSTRIPKIQKLLQDFFNGKE 361



 Score =  157 bits (381), Expect = 4e-38
 Identities = 72/84 (85%), Positives = 78/84 (92%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKY 181
           G  +NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMV+H  +EFKRK+
Sbjct: 193 GGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKH 252

Query: 182 KKDLATNKRALRRLRTACERAKRT 253
           KKD+  NKRA+RRLRTACERAKRT
Sbjct: 253 KKDIGPNKRAVRRLRTACERAKRT 276



 Score = 84.2 bits (199), Expect = 4e-16
 Identities = 45/72 (62%), Positives = 45/72 (62%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  NKSINPDE           IL GDKSE VQD           GIETAGGVMT LIKR
Sbjct: 360 KELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKR 419

Query: 681 NTTIPTKQTQTF 716
           NTTIPTKQTQTF
Sbjct: 420 NTTIPTKQTQTF 431


>DQ489378-1|ABE96830.1|  639|Homo sapiens heat shock 70kDa protein 2
           protein.
          Length = 639

 Score =  161 bits (390), Expect = 3e-39
 Identities = 76/88 (86%), Positives = 83/88 (94%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQASIEIDSL+EG+DFYTSITRARFEELNADLFR T+EPVEK+LRDAK+DK Q
Sbjct: 274 KRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLDKGQ 333

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           I +IVLVGGSTRIPK+QKLLQDFFNGKE
Sbjct: 334 IQEIVLVGGSTRIPKIQKLLQDFFNGKE 361



 Score =  157 bits (381), Expect = 4e-38
 Identities = 72/84 (85%), Positives = 78/84 (92%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKY 181
           G  +NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMV+H  +EFKRK+
Sbjct: 193 GGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKH 252

Query: 182 KKDLATNKRALRRLRTACERAKRT 253
           KKD+  NKRA+RRLRTACERAKRT
Sbjct: 253 KKDIGPNKRAVRRLRTACERAKRT 276



 Score = 84.2 bits (199), Expect = 4e-16
 Identities = 45/72 (62%), Positives = 45/72 (62%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  NKSINPDE           IL GDKSE VQD           GIETAGGVMT LIKR
Sbjct: 360 KELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKR 419

Query: 681 NTTIPTKQTQTF 716
           NTTIPTKQTQTF
Sbjct: 420 NTTIPTKQTQTF 431


>BT009815-1|AAP88817.1|  639|Homo sapiens heat shock 70kDa protein 2
           protein.
          Length = 639

 Score =  161 bits (390), Expect = 3e-39
 Identities = 76/88 (86%), Positives = 83/88 (94%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQASIEIDSL+EG+DFYTSITRARFEELNADLFR T+EPVEK+LRDAK+DK Q
Sbjct: 274 KRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLDKGQ 333

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           I +IVLVGGSTRIPK+QKLLQDFFNGKE
Sbjct: 334 IQEIVLVGGSTRIPKIQKLLQDFFNGKE 361



 Score =  157 bits (381), Expect = 4e-38
 Identities = 72/84 (85%), Positives = 78/84 (92%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKY 181
           G  +NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMV+H  +EFKRK+
Sbjct: 193 GGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKH 252

Query: 182 KKDLATNKRALRRLRTACERAKRT 253
           KKD+  NKRA+RRLRTACERAKRT
Sbjct: 253 KKDIGPNKRAVRRLRTACERAKRT 276



 Score = 84.2 bits (199), Expect = 4e-16
 Identities = 45/72 (62%), Positives = 45/72 (62%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  NKSINPDE           IL GDKSE VQD           GIETAGGVMT LIKR
Sbjct: 360 KELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKR 419

Query: 681 NTTIPTKQTQTF 716
           NTTIPTKQTQTF
Sbjct: 420 NTTIPTKQTQTF 431


>BC036107-1|AAH36107.1|  639|Homo sapiens HSPA2 protein protein.
          Length = 639

 Score =  161 bits (390), Expect = 3e-39
 Identities = 76/88 (86%), Positives = 83/88 (94%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQASIEIDSL+EG+DFYTSITRARFEELNADLFR T+EPVEK+LRDAK+DK Q
Sbjct: 274 KRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLDKGQ 333

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           I +IVLVGGSTRIPK+QKLLQDFFNGKE
Sbjct: 334 IQEIVLVGGSTRIPKIQKLLQDFFNGKE 361



 Score =  157 bits (381), Expect = 4e-38
 Identities = 72/84 (85%), Positives = 78/84 (92%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKY 181
           G  +NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMV+H  +EFKRK+
Sbjct: 193 GGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKH 252

Query: 182 KKDLATNKRALRRLRTACERAKRT 253
           KKD+  NKRA+RRLRTACERAKRT
Sbjct: 253 KKDIGPNKRAVRRLRTACERAKRT 276



 Score = 84.2 bits (199), Expect = 4e-16
 Identities = 45/72 (62%), Positives = 45/72 (62%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  NKSINPDE           IL GDKSE VQD           GIETAGGVMT LIKR
Sbjct: 360 KELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKR 419

Query: 681 NTTIPTKQTQTF 716
           NTTIPTKQTQTF
Sbjct: 420 NTTIPTKQTQTF 431


>BC001752-1|AAH01752.1|  639|Homo sapiens heat shock 70kDa protein 2
           protein.
          Length = 639

 Score =  161 bits (390), Expect = 3e-39
 Identities = 76/88 (86%), Positives = 83/88 (94%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQASIEIDSL+EG+DFYTSITRARFEELNADLFR T+EPVEK+LRDAK+DK Q
Sbjct: 274 KRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLDKGQ 333

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           I +IVLVGGSTRIPK+QKLLQDFFNGKE
Sbjct: 334 IQEIVLVGGSTRIPKIQKLLQDFFNGKE 361



 Score =  157 bits (381), Expect = 4e-38
 Identities = 72/84 (85%), Positives = 78/84 (92%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKY 181
           G  +NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMV+H  +EFKRK+
Sbjct: 193 GGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKH 252

Query: 182 KKDLATNKRALRRLRTACERAKRT 253
           KKD+  NKRA+RRLRTACERAKRT
Sbjct: 253 KKDIGPNKRAVRRLRTACERAKRT 276



 Score = 84.2 bits (199), Expect = 4e-16
 Identities = 45/72 (62%), Positives = 45/72 (62%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  NKSINPDE           IL GDKSE VQD           GIETAGGVMT LIKR
Sbjct: 360 KELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKR 419

Query: 681 NTTIPTKQTQTF 716
           NTTIPTKQTQTF
Sbjct: 420 NTTIPTKQTQTF 431


>M59829-1|AAA63228.1|  641|Homo sapiens heat shock-induced protein
           protein.
          Length = 641

 Score =  157 bits (381), Expect = 4e-38
 Identities = 74/88 (84%), Positives = 84/88 (95%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQA++EIDSL+EGIDFYTSITRARFEEL ADLFR T+EPVEK+LRDAKMDKA+
Sbjct: 273 KRTLSSSTQANLEIDSLYEGIDFYTSITRARFEELCADLFRGTLEPVEKALRDAKMDKAK 332

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHDIVLVGGSTRIPKVQ+LLQD+FNG++
Sbjct: 333 IHDIVLVGGSTRIPKVQRLLQDYFNGRD 360



 Score =  155 bits (377), Expect = 1e-37
 Identities = 70/81 (86%), Positives = 80/81 (98%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           R+VLIFDLGGGTFDVSILTI+DGIFEVK+TAGDTHLGGEDFDNR+V+HFV+EFKRK+KKD
Sbjct: 195 RHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKD 254

Query: 191 LATNKRALRRLRTACERAKRT 253
           ++ NKRA+RRLRTACERAKRT
Sbjct: 255 ISQNKRAVRRLRTACERAKRT 275



 Score = 75.8 bits (178), Expect = 1e-13
 Identities = 39/69 (56%), Positives = 42/69 (60%)
 Frame = +3

Query: 510 NKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTT 689
           NKSINPDE           IL GDKSE+VQD           G+ET GGVMT LIKRN+T
Sbjct: 362 NKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETVGGVMTALIKRNST 421

Query: 690 IPTKQTQTF 716
           IP KQTQ F
Sbjct: 422 IPPKQTQIF 430


>D85730-1|BAA32521.1|  641|Homo sapiens Heat shock protein 70 testis
           variant protein.
          Length = 641

 Score =  157 bits (381), Expect = 4e-38
 Identities = 74/88 (84%), Positives = 84/88 (95%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQA++EIDSL+EGIDFYTSITRARFEEL ADLFR T+EPVEK+LRDAKMDKA+
Sbjct: 273 KRTLSSSTQANLEIDSLYEGIDFYTSITRARFEELCADLFRGTLEPVEKALRDAKMDKAK 332

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHDIVLVGGSTRIPKVQ+LLQD+FNG++
Sbjct: 333 IHDIVLVGGSTRIPKVQRLLQDYFNGRD 360



 Score =  155 bits (377), Expect = 1e-37
 Identities = 70/81 (86%), Positives = 80/81 (98%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           R+VLIFDLGGGTFDVSILTI+DGIFEVK+TAGDTHLGGEDFDNR+V+HFV+EFKRK+KKD
Sbjct: 195 RHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKD 254

Query: 191 LATNKRALRRLRTACERAKRT 253
           ++ NKRA+RRLRTACERAKRT
Sbjct: 255 ISQNKRAVRRLRTACERAKRT 275



 Score = 79.8 bits (188), Expect = 9e-15
 Identities = 41/69 (59%), Positives = 44/69 (63%)
 Frame = +3

Query: 510 NKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTT 689
           NKSINPDE           IL GDKSE+VQD           G+ETAGGVMT LIKRN+T
Sbjct: 362 NKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTALIKRNST 421

Query: 690 IPTKQTQTF 716
           IPTKQTQ F
Sbjct: 422 IPTKQTQIF 430


>DQ383515-1|ABC88476.1|  641|Homo sapiens heat shock 70kDa protein
           1-like protein.
          Length = 641

 Score =  157 bits (381), Expect = 4e-38
 Identities = 74/88 (84%), Positives = 84/88 (95%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQA++EIDSL+EGIDFYTSITRARFEEL ADLFR T+EPVEK+LRDAKMDKA+
Sbjct: 273 KRTLSSSTQANLEIDSLYEGIDFYTSITRARFEELCADLFRGTLEPVEKALRDAKMDKAK 332

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHDIVLVGGSTRIPKVQ+LLQD+FNG++
Sbjct: 333 IHDIVLVGGSTRIPKVQRLLQDYFNGRD 360



 Score =  155 bits (377), Expect = 1e-37
 Identities = 70/81 (86%), Positives = 80/81 (98%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           R+VLIFDLGGGTFDVSILTI+DGIFEVK+TAGDTHLGGEDFDNR+V+HFV+EFKRK+KKD
Sbjct: 195 RHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKD 254

Query: 191 LATNKRALRRLRTACERAKRT 253
           ++ NKRA+RRLRTACERAKRT
Sbjct: 255 ISQNKRAVRRLRTACERAKRT 275



 Score = 79.8 bits (188), Expect = 9e-15
 Identities = 41/69 (59%), Positives = 44/69 (63%)
 Frame = +3

Query: 510 NKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTT 689
           NKSINPDE           IL GDKSE+VQD           G+ETAGGVMT LIKRN+T
Sbjct: 362 NKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTALIKRNST 421

Query: 690 IPTKQTQTF 716
           IPTKQTQ F
Sbjct: 422 IPTKQTQIF 430


>BC034483-1|AAH34483.1|  641|Homo sapiens heat shock 70kDa protein
           1-like protein.
          Length = 641

 Score =  157 bits (381), Expect = 4e-38
 Identities = 74/88 (84%), Positives = 84/88 (95%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQA++EIDSL+EGIDFYTSITRARFEEL ADLFR T+EPVEK+LRDAKMDKA+
Sbjct: 273 KRTLSSSTQANLEIDSLYEGIDFYTSITRARFEELCADLFRGTLEPVEKALRDAKMDKAK 332

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHDIVLVGGSTRIPKVQ+LLQD+FNG++
Sbjct: 333 IHDIVLVGGSTRIPKVQRLLQDYFNGRD 360



 Score =  155 bits (377), Expect = 1e-37
 Identities = 70/81 (86%), Positives = 80/81 (98%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           R+VLIFDLGGGTFDVSILTI+DGIFEVK+TAGDTHLGGEDFDNR+V+HFV+EFKRK+KKD
Sbjct: 195 RHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKD 254

Query: 191 LATNKRALRRLRTACERAKRT 253
           ++ NKRA+RRLRTACERAKRT
Sbjct: 255 ISQNKRAVRRLRTACERAKRT 275



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 40/69 (57%), Positives = 44/69 (63%)
 Frame = +3

Query: 510 NKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTT 689
           NKSINPDE           IL GDKSE+VQD           G+ETAGGVMT L+KRN+T
Sbjct: 362 NKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTALMKRNST 421

Query: 690 IPTKQTQTF 716
           IPTKQTQ F
Sbjct: 422 IPTKQTQIF 430


>BA000025-10|BAB63301.1|  641|Homo sapiens heat shock protein
           protein.
          Length = 641

 Score =  157 bits (381), Expect = 4e-38
 Identities = 74/88 (84%), Positives = 84/88 (95%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQA++EIDSL+EGIDFYTSITRARFEEL ADLFR T+EPVEK+LRDAKMDKA+
Sbjct: 273 KRTLSSSTQANLEIDSLYEGIDFYTSITRARFEELCADLFRGTLEPVEKALRDAKMDKAK 332

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHDIVLVGGSTRIPKVQ+LLQD+FNG++
Sbjct: 333 IHDIVLVGGSTRIPKVQRLLQDYFNGRD 360



 Score =  155 bits (377), Expect = 1e-37
 Identities = 70/81 (86%), Positives = 80/81 (98%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           R+VLIFDLGGGTFDVSILTI+DGIFEVK+TAGDTHLGGEDFDNR+V+HFV+EFKRK+KKD
Sbjct: 195 RHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKD 254

Query: 191 LATNKRALRRLRTACERAKRT 253
           ++ NKRA+RRLRTACERAKRT
Sbjct: 255 ISQNKRAVRRLRTACERAKRT 275



 Score = 79.8 bits (188), Expect = 9e-15
 Identities = 41/69 (59%), Positives = 44/69 (63%)
 Frame = +3

Query: 510 NKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTT 689
           NKSINPDE           IL GDKSE+VQD           G+ETAGGVMT LIKRN+T
Sbjct: 362 NKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTALIKRNST 421

Query: 690 IPTKQTQTF 716
           IPTKQTQ F
Sbjct: 422 IPTKQTQIF 430


>AL929592-4|CAI18463.1|  641|Homo sapiens heat shock 70kDa protein
           1-like protein.
          Length = 641

 Score =  157 bits (381), Expect = 4e-38
 Identities = 74/88 (84%), Positives = 84/88 (95%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQA++EIDSL+EGIDFYTSITRARFEEL ADLFR T+EPVEK+LRDAKMDKA+
Sbjct: 273 KRTLSSSTQANLEIDSLYEGIDFYTSITRARFEELCADLFRGTLEPVEKALRDAKMDKAK 332

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHDIVLVGGSTRIPKVQ+LLQD+FNG++
Sbjct: 333 IHDIVLVGGSTRIPKVQRLLQDYFNGRD 360



 Score =  155 bits (377), Expect = 1e-37
 Identities = 70/81 (86%), Positives = 80/81 (98%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           R+VLIFDLGGGTFDVSILTI+DGIFEVK+TAGDTHLGGEDFDNR+V+HFV+EFKRK+KKD
Sbjct: 195 RHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKD 254

Query: 191 LATNKRALRRLRTACERAKRT 253
           ++ NKRA+RRLRTACERAKRT
Sbjct: 255 ISQNKRAVRRLRTACERAKRT 275



 Score = 79.8 bits (188), Expect = 9e-15
 Identities = 41/69 (59%), Positives = 44/69 (63%)
 Frame = +3

Query: 510 NKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTT 689
           NKSINPDE           IL GDKSE+VQD           G+ETAGGVMT LIKRN+T
Sbjct: 362 NKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTALIKRNST 421

Query: 690 IPTKQTQTF 716
           IPTKQTQ F
Sbjct: 422 IPTKQTQIF 430


>AL671762-4|CAI18215.1|  641|Homo sapiens heat shock 70kDa protein
           1-like protein.
          Length = 641

 Score =  157 bits (381), Expect = 4e-38
 Identities = 74/88 (84%), Positives = 84/88 (95%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQA++EIDSL+EGIDFYTSITRARFEEL ADLFR T+EPVEK+LRDAKMDKA+
Sbjct: 273 KRTLSSSTQANLEIDSLYEGIDFYTSITRARFEELCADLFRGTLEPVEKALRDAKMDKAK 332

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHDIVLVGGSTRIPKVQ+LLQD+FNG++
Sbjct: 333 IHDIVLVGGSTRIPKVQRLLQDYFNGRD 360



 Score =  155 bits (377), Expect = 1e-37
 Identities = 70/81 (86%), Positives = 80/81 (98%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           R+VLIFDLGGGTFDVSILTI+DGIFEVK+TAGDTHLGGEDFDNR+V+HFV+EFKRK+KKD
Sbjct: 195 RHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKD 254

Query: 191 LATNKRALRRLRTACERAKRT 253
           ++ NKRA+RRLRTACERAKRT
Sbjct: 255 ISQNKRAVRRLRTACERAKRT 275



 Score = 79.8 bits (188), Expect = 9e-15
 Identities = 41/69 (59%), Positives = 44/69 (63%)
 Frame = +3

Query: 510 NKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTT 689
           NKSINPDE           IL GDKSE+VQD           G+ETAGGVMT LIKRN+T
Sbjct: 362 NKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTALIKRNST 421

Query: 690 IPTKQTQTF 716
           IPTKQTQ F
Sbjct: 422 IPTKQTQIF 430


>AL662834-15|CAI17736.1|  641|Homo sapiens heat shock 70kDa protein
           1-like protein.
          Length = 641

 Score =  157 bits (381), Expect = 4e-38
 Identities = 74/88 (84%), Positives = 84/88 (95%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQA++EIDSL+EGIDFYTSITRARFEEL ADLFR T+EPVEK+LRDAKMDKA+
Sbjct: 273 KRTLSSSTQANLEIDSLYEGIDFYTSITRARFEELCADLFRGTLEPVEKALRDAKMDKAK 332

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHDIVLVGGSTRIPKVQ+LLQD+FNG++
Sbjct: 333 IHDIVLVGGSTRIPKVQRLLQDYFNGRD 360



 Score =  155 bits (377), Expect = 1e-37
 Identities = 70/81 (86%), Positives = 80/81 (98%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           R+VLIFDLGGGTFDVSILTI+DGIFEVK+TAGDTHLGGEDFDNR+V+HFV+EFKRK+KKD
Sbjct: 195 RHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKD 254

Query: 191 LATNKRALRRLRTACERAKRT 253
           ++ NKRA+RRLRTACERAKRT
Sbjct: 255 ISQNKRAVRRLRTACERAKRT 275



 Score = 79.8 bits (188), Expect = 9e-15
 Identities = 41/69 (59%), Positives = 44/69 (63%)
 Frame = +3

Query: 510 NKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTT 689
           NKSINPDE           IL GDKSE+VQD           G+ETAGGVMT LIKRN+T
Sbjct: 362 NKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTALIKRNST 421

Query: 690 IPTKQTQTF 716
           IPTKQTQ F
Sbjct: 422 IPTKQTQIF 430


>AK223386-1|BAD97106.1|  641|Homo sapiens heat shock 70kDa protein
           1-like variant protein.
          Length = 641

 Score =  157 bits (381), Expect = 4e-38
 Identities = 74/88 (84%), Positives = 84/88 (95%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQA++EIDSL+EGIDFYTSITRARFEEL ADLFR T+EPVEK+LRDAKMDKA+
Sbjct: 273 KRTLSSSTQANLEIDSLYEGIDFYTSITRARFEELCADLFRGTLEPVEKALRDAKMDKAK 332

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHDIVLVGGSTRIPKVQ+LLQD+FNG++
Sbjct: 333 IHDIVLVGGSTRIPKVQRLLQDYFNGRD 360



 Score =  155 bits (377), Expect = 1e-37
 Identities = 70/81 (86%), Positives = 80/81 (98%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           R+VLIFDLGGGTFDVSILTI+DGIFEVK+TAGDTHLGGEDFDNR+V+HFV+EFKRK+KKD
Sbjct: 195 RHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKD 254

Query: 191 LATNKRALRRLRTACERAKRT 253
           ++ NKRA+RRLRTACERAKRT
Sbjct: 255 ISQNKRAVRRLRTACERAKRT 275



 Score = 79.8 bits (188), Expect = 9e-15
 Identities = 41/69 (59%), Positives = 44/69 (63%)
 Frame = +3

Query: 510 NKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTT 689
           NKSINPDE           IL GDKSE+VQD           G+ETAGGVMT LIKRN+T
Sbjct: 362 NKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTALIKRNST 421

Query: 690 IPTKQTQTF 716
           IPTKQTQ F
Sbjct: 422 IPTKQTQIF 430


>AF134726-8|AAD21817.1|  641|Homo sapiens HSP70-HOM protein.
          Length = 641

 Score =  157 bits (381), Expect = 4e-38
 Identities = 74/88 (84%), Positives = 84/88 (95%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSSTQA++EIDSL+EGIDFYTSITRARFEEL ADLFR T+EPVEK+LRDAKMDKA+
Sbjct: 273 KRTLSSSTQANLEIDSLYEGIDFYTSITRARFEELCADLFRGTLEPVEKALRDAKMDKAK 332

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           IHDIVLVGGSTRIPKVQ+LLQD+FNG++
Sbjct: 333 IHDIVLVGGSTRIPKVQRLLQDYFNGRD 360



 Score =  155 bits (377), Expect = 1e-37
 Identities = 70/81 (86%), Positives = 80/81 (98%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           R+VLIFDLGGGTFDVSILTI+DGIFEVK+TAGDTHLGGEDFDNR+V+HFV+EFKRK+KKD
Sbjct: 195 RHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKD 254

Query: 191 LATNKRALRRLRTACERAKRT 253
           ++ NKRA+RRLRTACERAKRT
Sbjct: 255 ISQNKRAVRRLRTACERAKRT 275



 Score = 79.8 bits (188), Expect = 9e-15
 Identities = 41/69 (59%), Positives = 44/69 (63%)
 Frame = +3

Query: 510 NKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTT 689
           NKSINPDE           IL GDKSE+VQD           G+ETAGGVMT LIKRN+T
Sbjct: 362 NKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTALIKRNST 421

Query: 690 IPTKQTQTF 716
           IPTKQTQ F
Sbjct: 422 IPTKQTQIF 430


>BC112963-1|AAI12964.1|  655|Homo sapiens HSPA5 protein protein.
          Length = 655

 Score =  124 bits (298), Expect = 4e-28
 Identities = 58/91 (63%), Positives = 74/91 (81%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDK 417
           + K  LSS  QA IEI+S FEG DF  ++TRA+FEELN DLFRSTM+PV+K L D+ + K
Sbjct: 295 KAKRALSSQHQARIEIESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKK 354

Query: 418 AQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           + I +IVLVGGSTRIPK+Q+L+++FFNGKEP
Sbjct: 355 SDIDEIVLVGGSTRIPKIQQLVKEFFNGKEP 385



 Score =  114 bits (274), Expect = 3e-25
 Identities = 48/87 (55%), Positives = 69/87 (79%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           +N+L+FDLGGGTFDVS+LTI++G+FEV +T GDTHLGGEDFD R++ HF++ +K+K  KD
Sbjct: 219 KNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKD 278

Query: 191 LATNKRALRRLRTACERAKRTCHRPHK 271
           +  + RA+++LR   E+AKR     H+
Sbjct: 279 VRKDNRAVQKLRREVEKAKRALSSQHQ 305



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 31/85 (36%), Positives = 41/85 (48%)
 Frame = +3

Query: 462 PQGAEAPARFL*WKGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGI 641
           P+  +    F   K  ++ INPDE           +L GD  ++  D           GI
Sbjct: 370 PKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGD--QDTGDLVLLDVCPLTLGI 427

Query: 642 ETAGGVMTTLIKRNTTIPTKQTQTF 716
           ET GGVMT LI RNT +PTK++Q F
Sbjct: 428 ETVGGVMTKLIPRNTVVPTKKSQIF 452


>DQ385847-1|ABD04090.1|  654|Homo sapiens heat shock 70kDa protein 5
           (glucose-regulated protein, 78kDa) protein.
          Length = 654

 Score =  122 bits (295), Expect = 1e-27
 Identities = 57/91 (62%), Positives = 74/91 (81%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDK 417
           + K  LSS  QA IEI+S +EG DF  ++TRA+FEELN DLFRSTM+PV+K L D+ + K
Sbjct: 294 KAKRALSSQHQARIEIESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKK 353

Query: 418 AQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           + I +IVLVGGSTRIPK+Q+L+++FFNGKEP
Sbjct: 354 SDIDEIVLVGGSTRIPKIQQLVKEFFNGKEP 384



 Score =  114 bits (274), Expect = 3e-25
 Identities = 48/87 (55%), Positives = 69/87 (79%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           +N+L+FDLGGGTFDVS+LTI++G+FEV +T GDTHLGGEDFD R++ HF++ +K+K  KD
Sbjct: 218 KNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKD 277

Query: 191 LATNKRALRRLRTACERAKRTCHRPHK 271
           +  + RA+++LR   E+AKR     H+
Sbjct: 278 VRKDNRAVQKLRREVEKAKRALSSQHQ 304



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 31/85 (36%), Positives = 41/85 (48%)
 Frame = +3

Query: 462 PQGAEAPARFL*WKGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGI 641
           P+  +    F   K  ++ INPDE           +L GD  ++  D           GI
Sbjct: 369 PKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGD--QDTGDLVLLDVCPLTLGI 426

Query: 642 ETAGGVMTTLIKRNTTIPTKQTQTF 716
           ET GGVMT LI RNT +PTK++Q F
Sbjct: 427 ETVGGVMTKLIPRNTVVPTKKSQIF 451


>BC020235-1|AAH20235.1|  654|Homo sapiens heat shock 70kDa protein 5
           (glucose-regulated protein, 78kDa) protein.
          Length = 654

 Score =  122 bits (295), Expect = 1e-27
 Identities = 57/91 (62%), Positives = 74/91 (81%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDK 417
           + K  LSS  QA IEI+S +EG DF  ++TRA+FEELN DLFRSTM+PV+K L D+ + K
Sbjct: 294 KAKRALSSQHQARIEIESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKK 353

Query: 418 AQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           + I +IVLVGGSTRIPK+Q+L+++FFNGKEP
Sbjct: 354 SDIDEIVLVGGSTRIPKIQQLVKEFFNGKEP 384



 Score =  114 bits (274), Expect = 3e-25
 Identities = 48/87 (55%), Positives = 69/87 (79%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           +N+L+FDLGGGTFDVS+LTI++G+FEV +T GDTHLGGEDFD R++ HF++ +K+K  KD
Sbjct: 218 KNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKD 277

Query: 191 LATNKRALRRLRTACERAKRTCHRPHK 271
           +  + RA+++LR   E+AKR     H+
Sbjct: 278 VRKDNRAVQKLRREVEKAKRALSSQHQ 304



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 31/85 (36%), Positives = 41/85 (48%)
 Frame = +3

Query: 462 PQGAEAPARFL*WKGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGI 641
           P+  +    F   K  ++ INPDE           +L GD  ++  D           GI
Sbjct: 369 PKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGD--QDTGDLVLLDVCPLTLGI 426

Query: 642 ETAGGVMTTLIKRNTTIPTKQTQTF 716
           ET GGVMT LI RNT +PTK++Q F
Sbjct: 427 ETVGGVMTKLIPRNTVVPTKKSQIF 451


>AJ271729-1|CAB71335.1|  654|Homo sapiens glucose-regulated protein
           protein.
          Length = 654

 Score =  122 bits (295), Expect = 1e-27
 Identities = 57/91 (62%), Positives = 74/91 (81%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDK 417
           + K  LSS  QA IEI+S +EG DF  ++TRA+FEELN DLFRSTM+PV+K L D+ + K
Sbjct: 294 KAKRALSSQHQARIEIESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKK 353

Query: 418 AQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           + I +IVLVGGSTRIPK+Q+L+++FFNGKEP
Sbjct: 354 SDIDEIVLVGGSTRIPKIQQLVKEFFNGKEP 384



 Score =  114 bits (274), Expect = 3e-25
 Identities = 48/87 (55%), Positives = 69/87 (79%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           +N+L+FDLGGGTFDVS+LTI++G+FEV +T GDTHLGGEDFD R++ HF++ +K+K  KD
Sbjct: 218 KNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKD 277

Query: 191 LATNKRALRRLRTACERAKRTCHRPHK 271
           +  + RA+++LR   E+AKR     H+
Sbjct: 278 VRKDNRAVQKLRREVEKAKRALSSQHQ 304



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 31/85 (36%), Positives = 41/85 (48%)
 Frame = +3

Query: 462 PQGAEAPARFL*WKGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGI 641
           P+  +    F   K  ++ INPDE           +L GD  ++  D           GI
Sbjct: 369 PKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGD--QDTGDLVLLDVCPLTLGI 426

Query: 642 ETAGGVMTTLIKRNTTIPTKQTQTF 716
           ET GGVMT LI RNT +PTK++Q F
Sbjct: 427 ETVGGVMTKLIPRNTVVPTKKSQIF 451


>AF216292-1|AAF42836.1|  654|Homo sapiens endoplasmic reticulum
           lumenal Ca2+ binding protein grp78 protein.
          Length = 654

 Score =  122 bits (295), Expect = 1e-27
 Identities = 57/91 (62%), Positives = 74/91 (81%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDK 417
           + K  LSS  QA IEI+S +EG DF  ++TRA+FEELN DLFRSTM+PV+K L D+ + K
Sbjct: 294 KAKRALSSQHQARIEIESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKK 353

Query: 418 AQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           + I +IVLVGGSTRIPK+Q+L+++FFNGKEP
Sbjct: 354 SDIDEIVLVGGSTRIPKIQQLVKEFFNGKEP 384



 Score =  114 bits (274), Expect = 3e-25
 Identities = 48/87 (55%), Positives = 69/87 (79%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           +N+L+FDLGGGTFDVS+LTI++G+FEV +T GDTHLGGEDFD R++ HF++ +K+K  KD
Sbjct: 218 KNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKD 277

Query: 191 LATNKRALRRLRTACERAKRTCHRPHK 271
           +  + RA+++LR   E+AKR     H+
Sbjct: 278 VRKDNRAVQKLRREVEKAKRALSSQHQ 304



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 31/85 (36%), Positives = 41/85 (48%)
 Frame = +3

Query: 462 PQGAEAPARFL*WKGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGI 641
           P+  +    F   K  ++ INPDE           +L GD  ++  D           GI
Sbjct: 369 PKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGD--QDTGDLVLLDVCPLTLGI 426

Query: 642 ETAGGVMTTLIKRNTTIPTKQTQTF 716
           ET GGVMT LI RNT +PTK++Q F
Sbjct: 427 ETVGGVMTKLIPRNTVVPTKKSQIF 451


>AF188611-1|AAF13605.1|  639|Homo sapiens BiP protein protein.
          Length = 639

 Score =  122 bits (295), Expect = 1e-27
 Identities = 57/91 (62%), Positives = 74/91 (81%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDK 417
           + K  LSS  QA IEI+S +EG DF  ++TRA+FEELN DLFRSTM+PV+K L D+ + K
Sbjct: 276 KAKRALSSQHQARIEIESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKK 335

Query: 418 AQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           + I +IVLVGGSTRIPK+Q+L+++FFNGKEP
Sbjct: 336 SDIDEIVLVGGSTRIPKIQQLVKEFFNGKEP 366



 Score =  114 bits (274), Expect = 3e-25
 Identities = 48/87 (55%), Positives = 69/87 (79%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           +N+L+FDLGGGTFDVS+LTI++G+FEV +T GDTHLGGEDFD R++ HF++ +K+K  KD
Sbjct: 200 KNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKD 259

Query: 191 LATNKRALRRLRTACERAKRTCHRPHK 271
           +  + RA+++LR   E+AKR     H+
Sbjct: 260 VRKDNRAVQKLRREVEKAKRALSSQHQ 286



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 31/85 (36%), Positives = 41/85 (48%)
 Frame = +3

Query: 462 PQGAEAPARFL*WKGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGI 641
           P+  +    F   K  ++ INPDE           +L GD  ++  D           GI
Sbjct: 351 PKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGD--QDTGDLVLLDVCPLTLGI 408

Query: 642 ETAGGVMTTLIKRNTTIPTKQTQTF 716
           ET GGVMT LI RNT +PTK++Q F
Sbjct: 409 ETVGGVMTKLIPRNTVVPTKKSQIF 433


>X87949-1|CAA61201.1|  653|Homo sapiens BiP protein.
          Length = 653

 Score =  121 bits (292), Expect = 2e-27
 Identities = 57/91 (62%), Positives = 74/91 (81%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDK 417
           E  + LSS  QA IEI+S +EG DF  ++TRA+FEELN DLFRSTM+PV+K L D+ + K
Sbjct: 293 EKAKALSSQHQARIEIESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKK 352

Query: 418 AQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           + I +IVLVGGSTRIPK+Q+L+++FFNGKEP
Sbjct: 353 SDIDEIVLVGGSTRIPKIQQLVKEFFNGKEP 383



 Score =  110 bits (264), Expect = 6e-24
 Identities = 46/79 (58%), Positives = 66/79 (83%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           +N+L+FDLGGGTFDVS+LTI++G+FEV +T GDTHLGGEDFD R++ HF++ +K+K  KD
Sbjct: 218 KNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKD 277

Query: 191 LATNKRALRRLRTACERAK 247
           +  + RA+++LR   E+AK
Sbjct: 278 VRKDNRAVQKLRREVEKAK 296



 Score = 51.6 bits (118), Expect = 3e-06
 Identities = 30/85 (35%), Positives = 39/85 (45%)
 Frame = +3

Query: 462 PQGAEAPARFL*WKGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGI 641
           P+  +    F   K  ++ INPDE           +L GD  ++  D           GI
Sbjct: 368 PKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGD--QDTGDLVLLHVCPLTLGI 425

Query: 642 ETAGGVMTTLIKRNTTIPTKQTQTF 716
           ET GGVMT LI  NT +PTK +Q F
Sbjct: 426 ETVGGVMTKLIPSNTVVPTKNSQIF 450


>M19645-1|AAA52614.1|  653|Homo sapiens protein ( Human 78 kdalton
           glucose-regulated protein (GRP78) gene, complete cds. ).
          Length = 653

 Score =  121 bits (292), Expect = 2e-27
 Identities = 57/91 (62%), Positives = 74/91 (81%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDK 417
           E  + LSS  QA IEI+S +EG DF  ++TRA+FEELN DLFRSTM+PV+K L D+ + K
Sbjct: 293 EKAKALSSQHQARIEIESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKK 352

Query: 418 AQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           + I +IVLVGGSTRIPK+Q+L+++FFNGKEP
Sbjct: 353 SDIDEIVLVGGSTRIPKIQQLVKEFFNGKEP 383



 Score =  110 bits (264), Expect = 6e-24
 Identities = 46/79 (58%), Positives = 66/79 (83%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           +N+L+FDLGGGTFDVS+LTI++G+FEV +T GDTHLGGEDFD R++ HF++ +K+K  KD
Sbjct: 218 KNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKD 277

Query: 191 LATNKRALRRLRTACERAK 247
           +  + RA+++LR   E+AK
Sbjct: 278 VRKDNRAVQKLRREVEKAK 296



 Score = 51.6 bits (118), Expect = 3e-06
 Identities = 30/85 (35%), Positives = 39/85 (45%)
 Frame = +3

Query: 462 PQGAEAPARFL*WKGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGI 641
           P+  +    F   K  ++ INPDE           +L GD  ++  D           GI
Sbjct: 368 PKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGD--QDTGDLVLLHVCPLTLGI 425

Query: 642 ETAGGVMTTLIKRNTTIPTKQTQTF 716
           ET GGVMT LI  NT +PTK +Q F
Sbjct: 426 ETVGGVMTKLIPSNTVVPTKNSQIF 450


>M11236-1|AAA52696.1|  247|Homo sapiens HSPA1L protein.
          Length = 247

 Score =  106 bits (254), Expect = 9e-23
 Identities = 45/54 (83%), Positives = 53/54 (98%)
 Frame = +2

Query: 8   RRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEF 169
           +RNVLIFDLGGGTFDVS+LTI+ G+FEVK+TAGDTHLGGEDFDNR+VNHF++EF
Sbjct: 194 KRNVLIFDLGGGTFDVSVLTIDAGVFEVKATAGDTHLGGEDFDNRLVNHFMEEF 247


>L15189-1|AAA67526.1|  679|Homo sapiens MTHSP75 protein.
          Length = 679

 Score =  101 bits (242), Expect = 3e-21
 Identities = 45/77 (58%), Positives = 59/77 (76%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           + ++DLGGGTFD+SIL I+ G+FEVKST GDT LGGEDFD  ++ H V+EFKR+   DL 
Sbjct: 240 IAVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDQALLRHIVKEFKRETGVDLT 299

Query: 197 TNKRALRRLRTACERAK 247
            +  AL+R+R A E+AK
Sbjct: 300 KDNMALQRVREAAEKAK 316



 Score = 70.9 bits (166), Expect = 4e-12
 Identities = 38/95 (40%), Positives = 59/95 (62%), Gaps = 4/95 (4%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGID----FYTSITRARFEELNADLFRSTMEPVEKSLRDA 405
           + K +LSSS Q  I +  L             +TRA+FE +  DL R T+ P +K+++DA
Sbjct: 314 KAKCELSSSVQTDINLPYLTMDSSGPKHLNMKLTRAQFEGIVTDLIRRTIAPCQKAMQDA 373

Query: 406 KMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           ++ K+ I +++LVGG TR+PKVQ+ +QD F G+ P
Sbjct: 374 EVSKSDIGEVILVGGMTRMPKVQQTVQDLF-GRAP 407



 Score = 54.0 bits (124), Expect = 5e-07
 Identities = 30/72 (41%), Positives = 37/72 (51%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           +  +K++NPDE           +L GD    V D           GIET GGV T LI R
Sbjct: 405 RAPSKAVNPDEAVAIGAAIQGGVLAGD----VTDVLLLDVTPLSLGIETLGGVFTKLINR 460

Query: 681 NTTIPTKQTQTF 716
           NTTIPTK++Q F
Sbjct: 461 NTTIPTKKSQVF 472


>DQ531046-1|ABF50973.1|  679|Homo sapiens heat shock 70kDa protein
           9B (mortalin-2) protein.
          Length = 679

 Score =  101 bits (242), Expect = 3e-21
 Identities = 45/77 (58%), Positives = 59/77 (76%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           + ++DLGGGTFD+SIL I+ G+FEVKST GDT LGGEDFD  ++ H V+EFKR+   DL 
Sbjct: 240 IAVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDQALLRHIVKEFKRETGVDLT 299

Query: 197 TNKRALRRLRTACERAK 247
            +  AL+R+R A E+AK
Sbjct: 300 KDNMALQRVREAAEKAK 316



 Score = 70.9 bits (166), Expect = 4e-12
 Identities = 38/95 (40%), Positives = 59/95 (62%), Gaps = 4/95 (4%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGID----FYTSITRARFEELNADLFRSTMEPVEKSLRDA 405
           + K +LSSS Q  I +  L             +TRA+FE +  DL R T+ P +K+++DA
Sbjct: 314 KAKCELSSSVQTDINLPYLTMDSSGPKHLNMKLTRAQFEGIVTDLIRRTIAPCQKAMQDA 373

Query: 406 KMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           ++ K+ I +++LVGG TR+PKVQ+ +QD F G+ P
Sbjct: 374 EVSKSDIGEVILVGGMTRMPKVQQTVQDLF-GRAP 407



 Score = 54.0 bits (124), Expect = 5e-07
 Identities = 30/72 (41%), Positives = 37/72 (51%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           +  +K++NPDE           +L GD    V D           GIET GGV T LI R
Sbjct: 405 RAPSKAVNPDEAVAIGAAIQGGVLAGD----VTDVLLLDVTPLSLGIETLGGVFTKLINR 460

Query: 681 NTTIPTKQTQTF 716
           NTTIPTK++Q F
Sbjct: 461 NTTIPTKKSQVF 472


>BC030634-1|AAH30634.1|  681|Homo sapiens HSPA9 protein protein.
          Length = 681

 Score =  101 bits (242), Expect = 3e-21
 Identities = 45/77 (58%), Positives = 59/77 (76%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           + ++DLGGGTFD+SIL I+ G+FEVKST GDT LGGEDFD  ++ H V+EFKR+   DL 
Sbjct: 242 IAVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDQALLRHIVKEFKRETGVDLT 301

Query: 197 TNKRALRRLRTACERAK 247
            +  AL+R+R A E+AK
Sbjct: 302 KDNMALQRVREAAEKAK 318



 Score = 70.9 bits (166), Expect = 4e-12
 Identities = 38/95 (40%), Positives = 59/95 (62%), Gaps = 4/95 (4%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGID----FYTSITRARFEELNADLFRSTMEPVEKSLRDA 405
           + K +LSSS Q  I +  L             +TRA+FE +  DL R T+ P +K+++DA
Sbjct: 316 KAKCELSSSVQTDINLPYLTMDSSGPKHLNMKLTRAQFEGIVTDLIRRTIAPCQKAMQDA 375

Query: 406 KMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           ++ K+ I +++LVGG TR+PKVQ+ +QD F G+ P
Sbjct: 376 EVSKSDIGEVILVGGMTRMPKVQQTVQDLF-GRAP 409



 Score = 54.0 bits (124), Expect = 5e-07
 Identities = 30/72 (41%), Positives = 37/72 (51%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           +  +K++NPDE           +L GD    V D           GIET GGV T LI R
Sbjct: 407 RAPSKAVNPDEAVAIGAAIQGGVLAGD----VTDVLLLDVTPLSLGIETLGGVFTKLINR 462

Query: 681 NTTIPTKQTQTF 716
           NTTIPTK++Q F
Sbjct: 463 NTTIPTKKSQVF 474


>BC024034-1|AAH24034.1|  679|Homo sapiens heat shock 70kDa protein 9
           (mortalin) protein.
          Length = 679

 Score =  101 bits (242), Expect = 3e-21
 Identities = 45/77 (58%), Positives = 59/77 (76%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           + ++DLGGGTFD+SIL I+ G+FEVKST GDT LGGEDFD  ++ H V+EFKR+   DL 
Sbjct: 240 IAVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDQALLRHIVKEFKRETGVDLT 299

Query: 197 TNKRALRRLRTACERAK 247
            +  AL+R+R A E+AK
Sbjct: 300 KDNMALQRVREAAEKAK 316



 Score = 70.9 bits (166), Expect = 4e-12
 Identities = 38/95 (40%), Positives = 59/95 (62%), Gaps = 4/95 (4%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGID----FYTSITRARFEELNADLFRSTMEPVEKSLRDA 405
           + K +LSSS Q  I +  L             +TRA+FE +  DL R T+ P +K+++DA
Sbjct: 314 KAKCELSSSVQTDINLPYLTMDSSGPKHLNMKLTRAQFEGIVTDLIRRTIAPCQKAMQDA 373

Query: 406 KMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           ++ K+ I +++LVGG TR+PKVQ+ +QD F G+ P
Sbjct: 374 EVSKSDIGEVILVGGMTRMPKVQQTVQDLF-GRAP 407



 Score = 54.0 bits (124), Expect = 5e-07
 Identities = 30/72 (41%), Positives = 37/72 (51%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           +  +K++NPDE           +L GD    V D           GIET GGV T LI R
Sbjct: 405 RAPSKAVNPDEAVAIGAAIQGGVLAGD----VTDVLLLDVTPLSLGIETLGGVFTKLINR 460

Query: 681 NTTIPTKQTQTF 716
           NTTIPTK++Q F
Sbjct: 461 NTTIPTKKSQVF 472


>BC000478-1|AAH00478.1|  679|Homo sapiens heat shock 70kDa protein 9
           (mortalin) protein.
          Length = 679

 Score =  101 bits (242), Expect = 3e-21
 Identities = 45/77 (58%), Positives = 59/77 (76%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           + ++DLGGGTFD+SIL I+ G+FEVKST GDT LGGEDFD  ++ H V+EFKR+   DL 
Sbjct: 240 IAVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDQALLRHIVKEFKRETGVDLT 299

Query: 197 TNKRALRRLRTACERAK 247
            +  AL+R+R A E+AK
Sbjct: 300 KDNMALQRVREAAEKAK 316



 Score = 70.9 bits (166), Expect = 4e-12
 Identities = 38/95 (40%), Positives = 59/95 (62%), Gaps = 4/95 (4%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGID----FYTSITRARFEELNADLFRSTMEPVEKSLRDA 405
           + K +LSSS Q  I +  L             +TRA+FE +  DL R T+ P +K+++DA
Sbjct: 314 KAKCELSSSVQTDINLPYLTMDSSGPKHLNMKLTRAQFEGIVTDLIRRTIAPCQKAMQDA 373

Query: 406 KMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           ++ K+ I +++LVGG TR+PKVQ+ +QD F G+ P
Sbjct: 374 EVSKSDIGEVILVGGMTRMPKVQQTVQDLF-GRAP 407



 Score = 54.0 bits (124), Expect = 5e-07
 Identities = 30/72 (41%), Positives = 37/72 (51%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           +  +K++NPDE           +L GD    V D           GIET GGV T LI R
Sbjct: 405 RAPSKAVNPDEAVAIGAAIQGGVLAGD----VTDVLLLDVTPLSLGIETLGGVFTKLINR 460

Query: 681 NTTIPTKQTQTF 716
           NTTIPTK++Q F
Sbjct: 461 NTTIPTKKSQVF 472


>AK222758-1|BAD96478.1|  679|Homo sapiens heat shock 70kDa protein
           9B precursor variant protein.
          Length = 679

 Score = 99.5 bits (237), Expect = 1e-20
 Identities = 44/77 (57%), Positives = 58/77 (75%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           + ++DLGGG FD+SIL I+ G+FEVKST GDT LGGEDFD  ++ H V+EFKR+   DL 
Sbjct: 240 IAVYDLGGGAFDISILEIQKGVFEVKSTNGDTFLGGEDFDQALLRHIVKEFKRETGVDLT 299

Query: 197 TNKRALRRLRTACERAK 247
            +  AL+R+R A E+AK
Sbjct: 300 KDNMALQRVREAAEKAK 316



 Score = 68.1 bits (159), Expect = 3e-11
 Identities = 37/95 (38%), Positives = 58/95 (61%), Gaps = 4/95 (4%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGID----FYTSITRARFEELNADLFRSTMEPVEKSLRDA 405
           + K +LSSS Q  I +  L             +TRA+FE +  DL R T+ P +K+++DA
Sbjct: 314 KAKCELSSSVQTDINLPYLTMDSSGPKHLNMKLTRAQFEGIVTDLIRRTIAPCQKAMQDA 373

Query: 406 KMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           ++ K+ I +++ VGG TR+PKVQ+ +QD F G+ P
Sbjct: 374 EVSKSDIGEVIPVGGMTRMPKVQQTVQDLF-GRAP 407



 Score = 54.0 bits (124), Expect = 5e-07
 Identities = 30/72 (41%), Positives = 37/72 (51%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           +  +K++NPDE           +L GD    V D           GIET GGV T LI R
Sbjct: 405 RAPSKAVNPDEAVAIGAAIQGGVLAGD----VTDVLLLDVTPLSLGIETLGGVFTKLINR 460

Query: 681 NTTIPTKQTQTF 716
           NTTIPTK++Q F
Sbjct: 461 NTTIPTKKSQVF 472


>AB018045-1|BAA77235.1|  151|Homo sapiens heat shock protein 72
           protein.
          Length = 151

 Score = 93.5 bits (222), Expect = 7e-19
 Identities = 42/44 (95%), Positives = 44/44 (100%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNR 142
           RNVLIFDLGGGTFDVSILTI+DGIFEVK+TAGDTHLGGEDFDNR
Sbjct: 107 RNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNR 150


>DQ185038-1|ABD14419.1|  176|Homo sapiens heat shock 70 kDa protein
           9B protein.
          Length = 176

 Score = 91.9 bits (218), Expect = 2e-18
 Identities = 40/69 (57%), Positives = 53/69 (76%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           + ++DLGGGTFD+SIL I+ G+FEVKST GDT LGGEDFD  ++ H V+EFKR+   DL 
Sbjct: 108 IAVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDQALLRHIVKEFKRETGVDLT 167

Query: 197 TNKRALRRL 223
            +  AL+R+
Sbjct: 168 KDNMALQRV 176


>X51758-1|CAA36062.1|  289|Homo sapiens heat shock protein 70B' (AA
           355-643) protein.
          Length = 289

 Score = 80.6 bits (190), Expect = 5e-15
 Identities = 41/72 (56%), Positives = 45/72 (62%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  NKSINPDE           +L GDK E+VQD           G+ETAGGVMTTLI+R
Sbjct: 5   KELNKSINPDEAVAYGAAVQAAVLMGDKCEKVQDLLLLDVAPLSLGLETAGGVMTTLIQR 64

Query: 681 NTTIPTKQTQTF 716
           N TIPTKQTQTF
Sbjct: 65  NATIPTKQTQTF 76


>X67643-1|CAA47886.1|  474|Homo sapiens HS24/P52 protein.
          Length = 474

 Score = 77.0 bits (181), Expect = 6e-14
 Identities = 36/80 (45%), Positives = 49/80 (61%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNV+  D+G   + VS+     G  +V +TA DT LGG  FD  +VNHF +EF +KYK D
Sbjct: 196 RNVVFVDMGHSAYQVSVCAFNRGKLKVLATAFDTTLGGRKFDEVLVNHFCEEFGKKYKLD 255

Query: 191 LATNKRALRRLRTACERAKR 250
           + +  RAL RL   CE+ K+
Sbjct: 256 IKSKIRALLRLSQECEKLKK 275



 Score = 51.2 bits (117), Expect = 4e-06
 Identities = 25/84 (29%), Positives = 45/84 (53%)
 Frame = +1

Query: 256 SSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDI 435
           ++++   + I+     +D   ++ R +F E+  DL      P+   L   K+ K  I+ +
Sbjct: 279 ANASDLPLSIECFMNDVDVSGTMNRGKFLEMCNDLLARVEPPLRSVLEQTKLKKEDIYAV 338

Query: 436 VLVGGSTRIPKVQKLLQDFFNGKE 507
            +VGG+TRIP V++ +  FF GKE
Sbjct: 339 EIVGGATRIPAVKEKISKFF-GKE 361


>X67640-1|CAA47885.1|  266|Homo sapiens HS24/P52 protein.
          Length = 266

 Score = 77.0 bits (181), Expect = 6e-14
 Identities = 36/80 (45%), Positives = 49/80 (61%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNV+  D+G   + VS+     G  +V +TA DT LGG  FD  +VNHF +EF +KYK D
Sbjct: 160 RNVVFVDMGHSAYQVSVCAFNRGKLKVLATAFDTTLGGRKFDEVLVNHFCEEFGKKYKLD 219

Query: 191 LATNKRALRRLRTACERAKR 250
           + +  RAL RL   CE+ K+
Sbjct: 220 IKSKIRALLRLSQECEKLKK 239


>L12723-1|AAA02807.1|  701|Homo sapiens heat shock protein 70
           protein.
          Length = 701

 Score = 77.0 bits (181), Expect = 6e-14
 Identities = 36/80 (45%), Positives = 49/80 (61%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNV+  D+G   + VS+     G  +V +TA DT LGG  FD  +VNHF +EF +KYK D
Sbjct: 196 RNVVFVDMGHSAYQVSVCAFNRGKLKVLATAFDTTLGGRKFDEVLVNHFCEEFGKKYKLD 255

Query: 191 LATNKRALRRLRTACERAKR 250
           + +  RAL RL   CE+ K+
Sbjct: 256 IKSKIRALLRLSQECEKLKK 275



 Score = 51.2 bits (117), Expect = 4e-06
 Identities = 25/84 (29%), Positives = 45/84 (53%)
 Frame = +1

Query: 256 SSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDI 435
           ++++   + I+     +D   ++ R +F E+  DL      P+   L   K+ K  I+ +
Sbjct: 279 ANASDLPLSIECFMNDVDVSGTMNRGKFLEMCNDLLARVEPPLRSVLEQTKLKKEDIYAV 338

Query: 436 VLVGGSTRIPKVQKLLQDFFNGKE 507
            +VGG+TRIP V++ +  FF GKE
Sbjct: 339 EIVGGATRIPAVKEKISKFF-GKE 361


>BC126124-1|AAI26125.1|  840|Homo sapiens heat shock 70kDa protein 4
           protein.
          Length = 840

 Score = 77.0 bits (181), Expect = 6e-14
 Identities = 36/80 (45%), Positives = 49/80 (61%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNV+  D+G   + VS+     G  +V +TA DT LGG  FD  +VNHF +EF +KYK D
Sbjct: 196 RNVVFVDMGHSAYQVSVCAFNRGKLKVLATAFDTTLGGRKFDEVLVNHFCEEFGKKYKLD 255

Query: 191 LATNKRALRRLRTACERAKR 250
           + +  RAL RL   CE+ K+
Sbjct: 256 IKSKIRALLRLSQECEKLKK 275



 Score = 51.2 bits (117), Expect = 4e-06
 Identities = 25/84 (29%), Positives = 45/84 (53%)
 Frame = +1

Query: 256 SSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDI 435
           ++++   + I+     +D   ++ R +F E+  DL      P+   L   K+ K  I+ +
Sbjct: 279 ANASDLPLSIECFMNDVDVSGTMNRGKFLEMCNDLLARVEPPLRSVLEQTKLKKEDIYAV 338

Query: 436 VLVGGSTRIPKVQKLLQDFFNGKE 507
            +VGG+TRIP V++ +  FF GKE
Sbjct: 339 EIVGGATRIPAVKEKISKFF-GKE 361


>BC126122-1|AAI26123.1|  840|Homo sapiens heat shock 70kDa protein 4
           protein.
          Length = 840

 Score = 77.0 bits (181), Expect = 6e-14
 Identities = 36/80 (45%), Positives = 49/80 (61%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNV+  D+G   + VS+     G  +V +TA DT LGG  FD  +VNHF +EF +KYK D
Sbjct: 196 RNVVFVDMGHSAYQVSVCAFNRGKLKVLATAFDTTLGGRKFDEVLVNHFCEEFGKKYKLD 255

Query: 191 LATNKRALRRLRTACERAKR 250
           + +  RAL RL   CE+ K+
Sbjct: 256 IKSKIRALLRLSQECEKLKK 275



 Score = 51.2 bits (117), Expect = 4e-06
 Identities = 25/84 (29%), Positives = 45/84 (53%)
 Frame = +1

Query: 256 SSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDI 435
           ++++   + I+     +D   ++ R +F E+  DL      P+   L   K+ K  I+ +
Sbjct: 279 ANASDLPLSIECFMNDVDVSGTMNRGKFLEMCNDLLARVEPPLRSVLEQTKLKKEDIYAV 338

Query: 436 VLVGGSTRIPKVQKLLQDFFNGKE 507
            +VGG+TRIP V++ +  FF GKE
Sbjct: 339 EIVGGATRIPAVKEKISKFF-GKE 361


>BC110861-1|AAI10862.1|  840|Homo sapiens heat shock 70kDa protein 4
           protein.
          Length = 840

 Score = 77.0 bits (181), Expect = 6e-14
 Identities = 36/80 (45%), Positives = 49/80 (61%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNV+  D+G   + VS+     G  +V +TA DT LGG  FD  +VNHF +EF +KYK D
Sbjct: 196 RNVVFVDMGHSAYQVSVCAFNRGKLKVLATAFDTTLGGRKFDEVLVNHFCEEFGKKYKLD 255

Query: 191 LATNKRALRRLRTACERAKR 250
           + +  RAL RL   CE+ K+
Sbjct: 256 IKSKIRALLRLSQECEKLKK 275



 Score = 51.2 bits (117), Expect = 4e-06
 Identities = 25/84 (29%), Positives = 45/84 (53%)
 Frame = +1

Query: 256 SSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDI 435
           ++++   + I+     +D   ++ R +F E+  DL      P+   L   K+ K  I+ +
Sbjct: 279 ANASDLPLSIECFMNDVDVSGTMNRGKFLEMCNDLLARVEPPLRSVLEQTKLKKEDIYAV 338

Query: 436 VLVGGSTRIPKVQKLLQDFFNGKE 507
            +VGG+TRIP V++ +  FF GKE
Sbjct: 339 EIVGGATRIPAVKEKISKFF-GKE 361


>AB209151-1|BAD92388.1|  782|Homo sapiens heat shock 70kDa protein 4
           isoform a variant protein.
          Length = 782

 Score = 77.0 bits (181), Expect = 6e-14
 Identities = 36/80 (45%), Positives = 49/80 (61%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNV+  D+G   + VS+     G  +V +TA DT LGG  FD  +VNHF +EF +KYK D
Sbjct: 219 RNVVFVDMGHSAYQVSVCAFNRGKLKVLATAFDTTLGGRKFDEVLVNHFCEEFGKKYKLD 278

Query: 191 LATNKRALRRLRTACERAKR 250
           + +  RAL RL   CE+ K+
Sbjct: 279 IKSKIRALLRLSQECEKLKK 298



 Score = 51.2 bits (117), Expect = 4e-06
 Identities = 25/84 (29%), Positives = 45/84 (53%)
 Frame = +1

Query: 256 SSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDI 435
           ++++   + I+     +D   ++ R +F E+  DL      P+   L   K+ K  I+ +
Sbjct: 302 ANASDLPLSIECFMNDVDVSGTMNRGKFLEMCNDLLARVEPPLRSVLEQTKLKKEDIYAV 361

Query: 436 VLVGGSTRIPKVQKLLQDFFNGKE 507
            +VGG+TRIP V++ +  FF GKE
Sbjct: 362 EIVGGATRIPAVKEKISKFF-GKE 384


>AB023420-1|BAA75062.1|  840|Homo sapiens apg-2 protein.
          Length = 840

 Score = 77.0 bits (181), Expect = 6e-14
 Identities = 36/80 (45%), Positives = 49/80 (61%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNV+  D+G   + VS+     G  +V +TA DT LGG  FD  +VNHF +EF +KYK D
Sbjct: 196 RNVVFVDMGHSAYQVSVCAFNRGKLKVLATAFDTTLGGRKFDEVLVNHFCEEFGKKYKLD 255

Query: 191 LATNKRALRRLRTACERAKR 250
           + +  RAL RL   CE+ K+
Sbjct: 256 IKSKIRALLRLSQECEKLKK 275



 Score = 51.2 bits (117), Expect = 4e-06
 Identities = 25/84 (29%), Positives = 45/84 (53%)
 Frame = +1

Query: 256 SSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDI 435
           ++++   + I+     +D   ++ R +F E+  DL      P+   L   K+ K  I+ +
Sbjct: 279 ANASDLPLSIECFMNDVDVSGTMNRGKFLEMCNDLLARVEPPLRSVLEQTKLKKEDIYAV 338

Query: 436 VLVGGSTRIPKVQKLLQDFFNGKE 507
            +VGG+TRIP V++ +  FF GKE
Sbjct: 339 EIVGGATRIPAVKEKISKFF-GKE 361


>U65785-1|AAC50947.1|  999|Homo sapiens 150 kDa oxygen-regulated
           protein ORP150 protein.
          Length = 999

 Score = 75.4 bits (177), Expect = 2e-13
 Identities = 42/112 (37%), Positives = 68/112 (60%), Gaps = 5/112 (4%)
 Frame = +1

Query: 163 GVQEEIQKGPRYQ--QESS*AFAYCM*EG---KEDLSSSTQASIEIDSLFEGIDFYTSIT 327
           G+  E +KG R +  +E+  A A  + E    K  LS++     +I+ L + +DF   +T
Sbjct: 285 GLFNEQRKGQRAKDVRENPRAMAKLLREANRLKTVLSANADHMAQIEGLMDDVDFKAKVT 344

Query: 328 RARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLL 483
           R  FEEL ADLF     PV+++L+ A+M   +I  ++LVGG+TR+P+VQ++L
Sbjct: 345 RVEFEELCADLFERVPGPVQQALQSAEMSLDEIEQVILVGGATRVPRVQEVL 396


>DQ372932-1|ABD14370.1|  999|Homo sapiens 150 kDa oxygen-regulated
           protein variant 1 protein.
          Length = 999

 Score = 75.4 bits (177), Expect = 2e-13
 Identities = 42/112 (37%), Positives = 68/112 (60%), Gaps = 5/112 (4%)
 Frame = +1

Query: 163 GVQEEIQKGPRYQ--QESS*AFAYCM*EG---KEDLSSSTQASIEIDSLFEGIDFYTSIT 327
           G+  E +KG R +  +E+  A A  + E    K  LS++     +I+ L + +DF   +T
Sbjct: 285 GLFNEQRKGQRAKDVRENPRAMAKLLREANRLKTVLSANADHMAQIEGLMDDVDFKAKVT 344

Query: 328 RARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLL 483
           R  FEEL ADLF     PV+++L+ A+M   +I  ++LVGG+TR+P+VQ++L
Sbjct: 345 RVEFEELCADLFERVPGPVQQALQSAEMSLDEIEQVILVGGATRVPRVQEVL 396


>DQ350134-1|ABC75106.1|  999|Homo sapiens 150 kDa oxygen-regulated
           protein protein.
          Length = 999

 Score = 75.4 bits (177), Expect = 2e-13
 Identities = 42/112 (37%), Positives = 68/112 (60%), Gaps = 5/112 (4%)
 Frame = +1

Query: 163 GVQEEIQKGPRYQ--QESS*AFAYCM*EG---KEDLSSSTQASIEIDSLFEGIDFYTSIT 327
           G+  E +KG R +  +E+  A A  + E    K  LS++     +I+ L + +DF   +T
Sbjct: 285 GLFNEQRKGQRAKDVRENPRAMAKLLREANRLKTVLSANADHMAQIEGLMDDVDFKAKVT 344

Query: 328 RARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLL 483
           R  FEEL ADLF     PV+++L+ A+M   +I  ++LVGG+TR+P+VQ++L
Sbjct: 345 RVEFEELCADLFERVPGPVQQALQSAEMSLDEIEQVILVGGATRVPRVQEVL 396


>BC072436-1|AAH72436.1|  678|Homo sapiens HYOU1 protein protein.
          Length = 678

 Score = 75.4 bits (177), Expect = 2e-13
 Identities = 42/112 (37%), Positives = 68/112 (60%), Gaps = 5/112 (4%)
 Frame = +1

Query: 163 GVQEEIQKGPRYQ--QESS*AFAYCM*EG---KEDLSSSTQASIEIDSLFEGIDFYTSIT 327
           G+  E +KG R +  +E+  A A  + E    K  LS++     +I+ L + +DF   +T
Sbjct: 285 GLFNEQRKGQRAKDVRENPRAMAKLLREANRLKTVLSANADHMAQIEGLMDDVDFKAKVT 344

Query: 328 RARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLL 483
           R  FEEL ADLF     PV+++L+ A+M   +I  ++LVGG+TR+P+VQ++L
Sbjct: 345 RVEFEELCADLFERVPGPVQQALQSAEMSLDEIEQVILVGGATRVPRVQEVL 396


>BC017726-1|AAH17726.1|  657|Homo sapiens Unknown (protein for
           IMAGE:3898847) protein.
          Length = 657

 Score = 75.4 bits (177), Expect = 2e-13
 Identities = 42/112 (37%), Positives = 68/112 (60%), Gaps = 5/112 (4%)
 Frame = +1

Query: 163 GVQEEIQKGPRYQ--QESS*AFAYCM*EG---KEDLSSSTQASIEIDSLFEGIDFYTSIT 327
           G+  E +KG R +  +E+  A A  + E    K  LS++     +I+ L + +DF   +T
Sbjct: 285 GLFNEQRKGQRAKDVRENPRAMAKLLREANRLKTVLSANADHMAQIEGLMDDVDFKAKVT 344

Query: 328 RARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLL 483
           R  FEEL ADLF     PV+++L+ A+M   +I  ++LVGG+TR+P+VQ++L
Sbjct: 345 RVEFEELCADLFERVPGPVQQALQSAEMSLDEIEQVILVGGATRVPRVQEVL 396


>AK222756-1|BAD96476.1|  999|Homo sapiens oxygen regulated protein
           precursor variant protein.
          Length = 999

 Score = 75.4 bits (177), Expect = 2e-13
 Identities = 42/112 (37%), Positives = 68/112 (60%), Gaps = 5/112 (4%)
 Frame = +1

Query: 163 GVQEEIQKGPRYQ--QESS*AFAYCM*EG---KEDLSSSTQASIEIDSLFEGIDFYTSIT 327
           G+  E +KG R +  +E+  A A  + E    K  LS++     +I+ L + +DF   +T
Sbjct: 285 GLFNEQRKGQRAKDVRENPRAMAKLLREANRLKTVLSANADHMAQIEGLMDDVDFKAKVT 344

Query: 328 RARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLL 483
           R  FEEL ADLF     PV+++L+ A+M   +I  ++LVGG+TR+P+VQ++L
Sbjct: 345 RVEFEELCADLFERVPGPVQQALQSAEMSLDEIEQVILVGGATRVPRVQEVL 396



 Score = 31.5 bits (68), Expect = 3.1
 Identities = 24/94 (25%), Positives = 44/94 (46%), Gaps = 13/94 (13%)
 Frame = +2

Query: 5   TRRNVLIFDLGGGTFDVSILTI------EDGI---FEVKSTAGDTHLGGEDFD----NRM 145
           T +N++ +D+G G+   +I+T       E G     +++    D  LGG + +     R+
Sbjct: 224 TAQNIMFYDMGSGSTVCTIVTYQMVKTKEAGTQPQLQIRGVGFDRTLGGLEMELRLRERL 283

Query: 146 VNHFVQEFKRKYKKDLATNKRALRRLRTACERAK 247
              F ++ K +  KD+  N RA+ +L     R K
Sbjct: 284 AGLFNEQRKGQRAKDVRENPRAMAKLLREANRLK 317


>U04735-1|AAA16954.1|  471|Homo sapiens microsomal stress 70 protein
           ATPase core protein.
          Length = 471

 Score = 73.3 bits (172), Expect = 8e-13
 Identities = 30/67 (44%), Positives = 52/67 (77%)
 Frame = +1

Query: 310 FYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQD 489
           F T I+R  F+ LN DLF+  + P+++ L++  ++K +I ++VLVGGSTRIP++++++Q+
Sbjct: 361 FETEISRKLFDTLNEDLFQKILVPIQQVLKEGHLEKTEIDEVVLVGGSTRIPRIRQVIQE 420

Query: 490 FFNGKEP 510
           FF GK+P
Sbjct: 421 FF-GKDP 426



 Score = 62.9 bits (146), Expect = 1e-09
 Identities = 29/78 (37%), Positives = 49/78 (62%)
 Frame = +2

Query: 14  NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDL 193
           +VL+ DLGGGT DVS+L  + G+F  ++ +G+  LGG+DF+ R++ +  ++  + Y   +
Sbjct: 220 HVLVIDLGGGTLDVSLLNKQGGMFLTRAMSGNNKLGGQDFNQRLLQYLYKQIYQTY-GFV 278

Query: 194 ATNKRALRRLRTACERAK 247
            + K  + RLR A E  K
Sbjct: 279 PSRKEEIHRLRQAVEMVK 296


>M24744-1|AAA59845.1|   65|Homo sapiens HSPA2 protein.
          Length = 65

 Score = 73.3 bits (172), Expect = 8e-13
 Identities = 38/65 (58%), Positives = 40/65 (61%)
 Frame = +3

Query: 510 NKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTT 689
           NKSINPDE           IL GDKSE VQD           G+ETAGGVMT LIKRN+T
Sbjct: 1   NKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNST 60

Query: 690 IPTKQ 704
           IPTKQ
Sbjct: 61  IPTKQ 65


>BC036370-1|AAH36370.1|  471|Homo sapiens stress 70 protein
           chaperone, microsome-associated, 60kDa protein.
          Length = 471

 Score = 73.3 bits (172), Expect = 8e-13
 Identities = 30/67 (44%), Positives = 52/67 (77%)
 Frame = +1

Query: 310 FYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQD 489
           F T I+R  F+ LN DLF+  + P+++ L++  ++K +I ++VLVGGSTRIP++++++Q+
Sbjct: 361 FETEISRKLFDTLNEDLFQKILVPIQQVLKEGHLEKTEIDEVVLVGGSTRIPRIRQVIQE 420

Query: 490 FFNGKEP 510
           FF GK+P
Sbjct: 421 FF-GKDP 426



 Score = 62.9 bits (146), Expect = 1e-09
 Identities = 29/78 (37%), Positives = 49/78 (62%)
 Frame = +2

Query: 14  NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDL 193
           +VL+ DLGGGT DVS+L  + G+F  ++ +G+  LGG+DF+ R++ +  ++  + Y   +
Sbjct: 220 HVLVIDLGGGTLDVSLLNKQGGMFLTRAMSGNNKLGGQDFNQRLLQYLYKQIYQTY-GFV 278

Query: 194 ATNKRALRRLRTACERAK 247
            + K  + RLR A E  K
Sbjct: 279 PSRKEEIHRLRQAVEMVK 296


>AL163206-1|CAB90390.1|  471|Homo sapiens human microsomal stress70
           protein ATPase core precursor protein.
          Length = 471

 Score = 73.3 bits (172), Expect = 8e-13
 Identities = 30/67 (44%), Positives = 52/67 (77%)
 Frame = +1

Query: 310 FYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQD 489
           F T I+R  F+ LN DLF+  + P+++ L++  ++K +I ++VLVGGSTRIP++++++Q+
Sbjct: 361 FETEISRKLFDTLNEDLFQKILVPIQQVLKEGHLEKTEIDEVVLVGGSTRIPRIRQVIQE 420

Query: 490 FFNGKEP 510
           FF GK+P
Sbjct: 421 FF-GKDP 426



 Score = 62.9 bits (146), Expect = 1e-09
 Identities = 29/78 (37%), Positives = 49/78 (62%)
 Frame = +2

Query: 14  NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDL 193
           +VL+ DLGGGT DVS+L  + G+F  ++ +G+  LGG+DF+ R++ +  ++  + Y   +
Sbjct: 220 HVLVIDLGGGTLDVSLLNKQGGMFLTRAMSGNNKLGGQDFNQRLLQYLYKQIYQTY-GFV 278

Query: 194 ATNKRALRRLRTACERAK 247
            + K  + RLR A E  K
Sbjct: 279 PSRKEEIHRLRQAVEMVK 296


>AK223282-1|BAD97002.1|  471|Homo sapiens stress 70 protein
           chaperone, microsome-associated, 60kDa precursor variant
           protein.
          Length = 471

 Score = 73.3 bits (172), Expect = 8e-13
 Identities = 30/67 (44%), Positives = 52/67 (77%)
 Frame = +1

Query: 310 FYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQD 489
           F T I+R  F+ LN DLF+  + P+++ L++  ++K +I ++VLVGGSTRIP++++++Q+
Sbjct: 361 FETEISRKLFDTLNEDLFQKILVPIQQVLKEGHLEKTEIDEVVLVGGSTRIPRIRQVIQE 420

Query: 490 FFNGKEP 510
           FF GK+P
Sbjct: 421 FF-GKDP 426



 Score = 62.9 bits (146), Expect = 1e-09
 Identities = 29/78 (37%), Positives = 49/78 (62%)
 Frame = +2

Query: 14  NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDL 193
           +VL+ DLGGGT DVS+L  + G+F  ++ +G+  LGG+DF+ R++ +  ++  + Y   +
Sbjct: 220 HVLVIDLGGGTLDVSLLNKQGGMFLTRAMSGNNKLGGQDFNQRLLQYLYKQIYQTY-GFV 278

Query: 194 ATNKRALRRLRTACERAK 247
            + K  + RLR A E  K
Sbjct: 279 PSRKEEIHRLRQAVEMVK 296


>AF130249-1|AAD21091.1|  471|Homo sapiens STCH protein.
          Length = 471

 Score = 73.3 bits (172), Expect = 8e-13
 Identities = 30/67 (44%), Positives = 52/67 (77%)
 Frame = +1

Query: 310 FYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQD 489
           F T I+R  F+ LN DLF+  + P+++ L++  ++K +I ++VLVGGSTRIP++++++Q+
Sbjct: 361 FETEISRKLFDTLNEDLFQKILVPIQQVLKEGHLEKTEIDEVVLVGGSTRIPRIRQVIQE 420

Query: 490 FFNGKEP 510
           FF GK+P
Sbjct: 421 FF-GKDP 426



 Score = 62.9 bits (146), Expect = 1e-09
 Identities = 29/78 (37%), Positives = 49/78 (62%)
 Frame = +2

Query: 14  NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDL 193
           +VL+ DLGGGT DVS+L  + G+F  ++ +G+  LGG+DF+ R++ +  ++  + Y   +
Sbjct: 220 HVLVIDLGGGTLDVSLLNKQGGMFLTRAMSGNNKLGGQDFNQRLLQYLYKQIYQTY-GFV 278

Query: 194 ATNKRALRRLRTACERAK 247
            + K  + RLR A E  K
Sbjct: 279 PSRKEEIHRLRQAVEMVK 296


>AY290862-1|AAP44471.1|  839|Homo sapiens heat shock protein apg-1
           protein.
          Length = 839

 Score = 72.9 bits (171), Expect = 1e-12
 Identities = 33/80 (41%), Positives = 48/80 (60%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNV+  D+G   + VS+     G  +V +T  D +LGG +FD  +V++F  EFK KYK +
Sbjct: 196 RNVVFIDMGHSAYQVSVCAFNKGKLKVLATTFDPYLGGRNFDEALVDYFCDEFKTKYKIN 255

Query: 191 LATNKRALRRLRTACERAKR 250
           +  N RAL RL   CE+ K+
Sbjct: 256 VKENSRALLRLYQECEKLKK 275



 Score = 51.2 bits (117), Expect = 4e-06
 Identities = 23/80 (28%), Positives = 44/80 (55%)
 Frame = +1

Query: 256 SSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDI 435
           ++++   + I+     +D  + + RA+FE+L A L      P++  +  A + +  I  I
Sbjct: 279 ANASDLPLNIECFMNDLDVSSKMNRAQFEQLCASLLARVEPPLKAVMEQANLQREDISSI 338

Query: 436 VLVGGSTRIPKVQKLLQDFF 495
            +VGG+TRIP V++ +  FF
Sbjct: 339 EIVGGATRIPAVKEQITKFF 358


>AB023421-1|BAA75063.1|  839|Homo sapiens apg-1 protein.
          Length = 839

 Score = 72.9 bits (171), Expect = 1e-12
 Identities = 33/80 (41%), Positives = 48/80 (60%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNV+  D+G   + VS+     G  +V +T  D +LGG +FD  +V++F  EFK KYK +
Sbjct: 196 RNVVFIDMGHSAYQVSVCAFNKGKLKVLATTFDPYLGGRNFDEALVDYFCDEFKTKYKIN 255

Query: 191 LATNKRALRRLRTACERAKR 250
           +  N RAL RL   CE+ K+
Sbjct: 256 VKENSRALLRLYQECEKLKK 275



 Score = 51.2 bits (117), Expect = 4e-06
 Identities = 23/80 (28%), Positives = 44/80 (55%)
 Frame = +1

Query: 256 SSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDI 435
           ++++   + I+     +D  + + RA+FE+L A L      P++  +  A + +  I  I
Sbjct: 279 ANASDLPLNIECFMNDLDVSSKMNRAQFEQLCASLLARVEPPLKAVMEQANLQREDISSI 338

Query: 436 VLVGGSTRIPKVQKLLQDFF 495
            +VGG+TRIP V++ +  FF
Sbjct: 339 EIVGGATRIPAVKEQITKFF 358


>BC015699-1|AAH15699.1|  269|Homo sapiens Unknown (protein for
           IMAGE:3906958) protein.
          Length = 269

 Score = 71.7 bits (168), Expect = 2e-12
 Identities = 36/50 (72%), Positives = 36/50 (72%)
 Frame = +3

Query: 567 ILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTTIPTKQTQTF 716
           IL GDKSE VQD           GIETAGGVMT LIKRNTTIPTKQTQTF
Sbjct: 2   ILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTF 51


>EF197155-1|ABM69040.1|  839|Homo sapiens heat shock 70 kDa protein
           4-like protein protein.
          Length = 839

 Score = 70.5 bits (165), Expect = 6e-12
 Identities = 32/80 (40%), Positives = 47/80 (58%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNV+  D+G   + V +     G  +V +T  D +LGG +FD  +V++F  EFK KYK +
Sbjct: 196 RNVVFIDMGHSAYQVLVCAFNKGKLKVLATTFDPYLGGRNFDEALVDYFCDEFKTKYKIN 255

Query: 191 LATNKRALRRLRTACERAKR 250
           +  N RAL RL   CE+ K+
Sbjct: 256 VKENSRALLRLYQECEKLKK 275



 Score = 51.2 bits (117), Expect = 4e-06
 Identities = 23/80 (28%), Positives = 44/80 (55%)
 Frame = +1

Query: 256 SSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDI 435
           ++++   + I+     +D  + + RA+FE+L A L      P++  +  A + +  I  I
Sbjct: 279 ANASDLPLNIECFMNDLDVSSKMNRAQFEQLCASLLARVEPPLKAVMEQANLQREDISSI 338

Query: 436 VLVGGSTRIPKVQKLLQDFF 495
            +VGG+TRIP V++ +  FF
Sbjct: 339 EIVGGATRIPAVKEQITKFF 358


>D86956-1|BAA13192.2|  949|Homo sapiens KIAA0201 protein.
          Length = 949

 Score = 70.5 bits (165), Expect = 6e-12
 Identities = 35/80 (43%), Positives = 45/80 (56%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           R V+  D+G   F VS      G  +V  TA D  LGG++FD ++V HF  EFK KYK D
Sbjct: 287 RIVVFVDMGHSAFQVSACAFNKGKLKVLGTAFDPFLGGKNFDEKLVEHFCAEFKTKYKLD 346

Query: 191 LATNKRALRRLRTACERAKR 250
             +  RAL RL   CE+ K+
Sbjct: 347 AKSKIRALLRLYQECEKLKK 366



 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 26/84 (30%), Positives = 44/84 (52%)
 Frame = +1

Query: 256 SSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDI 435
           S+ST   + I+      D    + R++FEEL A+L +    P+   L    +    +  +
Sbjct: 370 SNSTDLPLNIECFMNDKDVSGKMNRSQFEELCAELLQKIEVPLYSLLEQTHLKVEDVSAV 429

Query: 436 VLVGGSTRIPKVQKLLQDFFNGKE 507
            +VGG+TRIP V++ +  FF GK+
Sbjct: 430 EIVGGATRIPAVKERIAKFF-GKD 452


>BC040560-1|AAH40560.1|  839|Homo sapiens heat shock 70kDa protein
           4-like protein.
          Length = 839

 Score = 70.5 bits (165), Expect = 6e-12
 Identities = 32/80 (40%), Positives = 47/80 (58%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNV+  D+G   + V +     G  +V +T  D +LGG +FD  +V++F  EFK KYK +
Sbjct: 196 RNVVFIDMGHSAYQVLVCAFNKGKLKVLATTFDPYLGGRNFDEALVDYFCDEFKTKYKIN 255

Query: 191 LATNKRALRRLRTACERAKR 250
           +  N RAL RL   CE+ K+
Sbjct: 256 VKENSRALLRLYQECEKLKK 275



 Score = 51.2 bits (117), Expect = 4e-06
 Identities = 23/80 (28%), Positives = 44/80 (55%)
 Frame = +1

Query: 256 SSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDI 435
           ++++   + I+     +D  + + RA+FE+L A L      P++  +  A + +  I  I
Sbjct: 279 ANASDLPLNIECFMNDLDVSSKMNRAQFEQLCASLLARVEPPLKAVMEQANLQREDISSI 338

Query: 436 VLVGGSTRIPKVQKLLQDFF 495
            +VGG+TRIP V++ +  FF
Sbjct: 339 EIVGGATRIPAVKEQITKFF 358


>BC037553-1|AAH37553.1|  858|Homo sapiens heat shock 105kDa/110kDa
           protein 1 protein.
          Length = 858

 Score = 70.5 bits (165), Expect = 6e-12
 Identities = 35/80 (43%), Positives = 45/80 (56%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           R V+  D+G   F VS      G  +V  TA D  LGG++FD ++V HF  EFK KYK D
Sbjct: 196 RIVVFVDMGHSAFQVSACAFNKGKLKVLGTAFDPFLGGKNFDEKLVEHFCAEFKTKYKLD 255

Query: 191 LATNKRALRRLRTACERAKR 250
             +  RAL RL   CE+ K+
Sbjct: 256 AKSKIRALLRLYQECEKLKK 275



 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 26/84 (30%), Positives = 44/84 (52%)
 Frame = +1

Query: 256 SSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDI 435
           S+ST   + I+      D    + R++FEEL A+L +    P+   L    +    +  +
Sbjct: 279 SNSTDLPLNIECFMNDKDVSGKMNRSQFEELCAELLQKIEVPLYSLLEQTHLKVEDVSAV 338

Query: 436 VLVGGSTRIPKVQKLLQDFFNGKE 507
            +VGG+TRIP V++ +  FF GK+
Sbjct: 339 EIVGGATRIPAVKERIAKFF-GKD 361


>AL137142-5|CAI12430.1|  858|Homo sapiens heat shock 105kDa/110kDa
           protein 1 protein.
          Length = 858

 Score = 70.5 bits (165), Expect = 6e-12
 Identities = 35/80 (43%), Positives = 45/80 (56%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           R V+  D+G   F VS      G  +V  TA D  LGG++FD ++V HF  EFK KYK D
Sbjct: 196 RIVVFVDMGHSAFQVSACAFNKGKLKVLGTAFDPFLGGKNFDEKLVEHFCAEFKTKYKLD 255

Query: 191 LATNKRALRRLRTACERAKR 250
             +  RAL RL   CE+ K+
Sbjct: 256 AKSKIRALLRLYQECEKLKK 275



 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 26/84 (30%), Positives = 44/84 (52%)
 Frame = +1

Query: 256 SSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDI 435
           S+ST   + I+      D    + R++FEEL A+L +    P+   L    +    +  +
Sbjct: 279 SNSTDLPLNIECFMNDKDVSGKMNRSQFEELCAELLQKIEVPLYSLLEQTHLKVEDVSAV 338

Query: 436 VLVGGSTRIPKVQKLLQDFFNGKE 507
            +VGG+TRIP V++ +  FF GK+
Sbjct: 339 EIVGGATRIPAVKERIAKFF-GKD 361


>AL137142-4|CAI12428.1|  814|Homo sapiens heat shock 105kDa/110kDa
           protein 1 protein.
          Length = 814

 Score = 70.5 bits (165), Expect = 6e-12
 Identities = 35/80 (43%), Positives = 45/80 (56%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           R V+  D+G   F VS      G  +V  TA D  LGG++FD ++V HF  EFK KYK D
Sbjct: 196 RIVVFVDMGHSAFQVSACAFNKGKLKVLGTAFDPFLGGKNFDEKLVEHFCAEFKTKYKLD 255

Query: 191 LATNKRALRRLRTACERAKR 250
             +  RAL RL   CE+ K+
Sbjct: 256 AKSKIRALLRLYQECEKLKK 275



 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 26/84 (30%), Positives = 44/84 (52%)
 Frame = +1

Query: 256 SSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDI 435
           S+ST   + I+      D    + R++FEEL A+L +    P+   L    +    +  +
Sbjct: 279 SNSTDLPLNIECFMNDKDVSGKMNRSQFEELCAELLQKIEVPLYSLLEQTHLKVEDVSAV 338

Query: 436 VLVGGSTRIPKVQKLLQDFFNGKE 507
            +VGG+TRIP V++ +  FF GK+
Sbjct: 339 EIVGGATRIPAVKERIAKFF-GKD 361


>AL137142-3|CAI12429.1|  817|Homo sapiens heat shock 105kDa/110kDa
           protein 1 protein.
          Length = 817

 Score = 70.5 bits (165), Expect = 6e-12
 Identities = 35/80 (43%), Positives = 45/80 (56%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           R V+  D+G   F VS      G  +V  TA D  LGG++FD ++V HF  EFK KYK D
Sbjct: 155 RIVVFVDMGHSAFQVSACAFNKGKLKVLGTAFDPFLGGKNFDEKLVEHFCAEFKTKYKLD 214

Query: 191 LATNKRALRRLRTACERAKR 250
             +  RAL RL   CE+ K+
Sbjct: 215 AKSKIRALLRLYQECEKLKK 234



 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 26/84 (30%), Positives = 44/84 (52%)
 Frame = +1

Query: 256 SSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDI 435
           S+ST   + I+      D    + R++FEEL A+L +    P+   L    +    +  +
Sbjct: 238 SNSTDLPLNIECFMNDKDVSGKMNRSQFEELCAELLQKIEVPLYSLLEQTHLKVEDVSAV 297

Query: 436 VLVGGSTRIPKVQKLLQDFFNGKE 507
            +VGG+TRIP V++ +  FF GK+
Sbjct: 298 EIVGGATRIPAVKERIAKFF-GKD 320


>AF039695-1|AAC18044.1|  872|Homo sapiens antigen NY-CO-25 protein.
          Length = 872

 Score = 70.5 bits (165), Expect = 6e-12
 Identities = 35/80 (43%), Positives = 45/80 (56%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           R V+  D+G   F VS      G  +V  TA D  LGG++FD ++V HF  EFK KYK D
Sbjct: 210 RIVVFVDMGHSAFQVSACAFNKGKLKVLGTAFDPFLGGKNFDEKLVEHFCAEFKTKYKLD 269

Query: 191 LATNKRALRRLRTACERAKR 250
             +  RAL RL   CE+ K+
Sbjct: 270 AKSKIRALLRLYQECEKLKK 289



 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 26/84 (30%), Positives = 44/84 (52%)
 Frame = +1

Query: 256 SSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDI 435
           S+ST   + I+      D    + R++FEEL A+L +    P+   L    +    +  +
Sbjct: 293 SNSTDLPLNIECFMNDKDVSGKMNRSQFEELCAELLQKIEVPLYSLLEQTHLKVEDVSAV 352

Query: 436 VLVGGSTRIPKVQKLLQDFFNGKE 507
            +VGG+TRIP V++ +  FF GK+
Sbjct: 353 EIVGGATRIPAVKERIAKFF-GKD 375


>AC093591-2|AAY40975.1|  839|Homo sapiens unknown protein.
          Length = 839

 Score = 70.5 bits (165), Expect = 6e-12
 Identities = 32/80 (40%), Positives = 47/80 (58%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNV+  D+G   + V +     G  +V +T  D +LGG +FD  +V++F  EFK KYK +
Sbjct: 196 RNVVFIDMGHSAYQVLVCAFNKGKLKVLATTFDPYLGGRNFDEALVDYFCDEFKTKYKIN 255

Query: 191 LATNKRALRRLRTACERAKR 250
           +  N RAL RL   CE+ K+
Sbjct: 256 VKENSRALLRLYQECEKLKK 275



 Score = 51.2 bits (117), Expect = 4e-06
 Identities = 23/80 (28%), Positives = 44/80 (55%)
 Frame = +1

Query: 256 SSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDI 435
           ++++   + I+     +D  + + RA+FE+L A L      P++  +  A + +  I  I
Sbjct: 279 ANASDLPLNIECFMNDLDVSSKMNRAQFEQLCASLLARVEPPLKAVMEQANLQREDISSI 338

Query: 436 VLVGGSTRIPKVQKLLQDFF 495
            +VGG+TRIP V++ +  FF
Sbjct: 339 EIVGGATRIPAVKEQITKFF 358


>AB003334-1|BAA34780.1|  858|Homo sapiens HSP105 alpha protein.
          Length = 858

 Score = 70.5 bits (165), Expect = 6e-12
 Identities = 35/80 (43%), Positives = 45/80 (56%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           R V+  D+G   F VS      G  +V  TA D  LGG++FD ++V HF  EFK KYK D
Sbjct: 196 RIVVFVDMGHSAFQVSACAFNKGKLKVLGTAFDPFLGGKNFDEKLVEHFCAEFKTKYKLD 255

Query: 191 LATNKRALRRLRTACERAKR 250
             +  RAL RL   CE+ K+
Sbjct: 256 AKSKIRALLRLYQECEKLKK 275



 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 26/84 (30%), Positives = 44/84 (52%)
 Frame = +1

Query: 256 SSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDI 435
           S+ST   + I+      D    + R++FEEL A+L +    P+   L    +    +  +
Sbjct: 279 SNSTDLPLNIECFMNDKDVSGKMNRSQFEELCAELLQKIEVPLYSLLEQTHLKVEDVSAV 338

Query: 436 VLVGGSTRIPKVQKLLQDFFNGKE 507
            +VGG+TRIP V++ +  FF GK+
Sbjct: 339 EIVGGATRIPAVKERIAKFF-GKD 361


>AB003333-1|BAA34779.1|  814|Homo sapiens HSP105 beta protein.
          Length = 814

 Score = 70.5 bits (165), Expect = 6e-12
 Identities = 35/80 (43%), Positives = 45/80 (56%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           R V+  D+G   F VS      G  +V  TA D  LGG++FD ++V HF  EFK KYK D
Sbjct: 196 RIVVFVDMGHSAFQVSACAFNKGKLKVLGTAFDPFLGGKNFDEKLVEHFCAEFKTKYKLD 255

Query: 191 LATNKRALRRLRTACERAKR 250
             +  RAL RL   CE+ K+
Sbjct: 256 AKSKIRALLRLYQECEKLKK 275



 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 26/84 (30%), Positives = 44/84 (52%)
 Frame = +1

Query: 256 SSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDI 435
           S+ST   + I+      D    + R++FEEL A+L +    P+   L    +    +  +
Sbjct: 279 SNSTDLPLNIECFMNDKDVSGKMNRSQFEELCAELLQKIEVPLYSLLEQTHLKVEDVSAV 338

Query: 436 VLVGGSTRIPKVQKLLQDFFNGKE 507
            +VGG+TRIP V++ +  FF GK+
Sbjct: 339 EIVGGATRIPAVKERIAKFF-GKD 361


>DQ480334-1|ABF19573.1|  350|Homo sapiens catecholamine-regulated
           protein 40 protein.
          Length = 350

 Score = 68.9 bits (161), Expect = 2e-11
 Identities = 30/63 (47%), Positives = 48/63 (76%)
 Frame = +1

Query: 322 ITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNG 501
           +TRA+FE +  DL R T+ P +K+++DA++ K+ I +++LVGG TR+PKVQ+ +QD F G
Sbjct: 13  LTRAQFEGIVTDLIRRTIAPCQKAMQDAEVSKSDIGEVILVGGMTRMPKVQQTVQDLF-G 71

Query: 502 KEP 510
           + P
Sbjct: 72  RAP 74



 Score = 54.0 bits (124), Expect = 5e-07
 Identities = 30/72 (41%), Positives = 37/72 (51%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           +  +K++NPDE           +L GD    V D           GIET GGV T LI R
Sbjct: 72  RAPSKAVNPDEAVAIGAAIQGGVLAGD----VTDVLLLDVTPLSLGIETLGGVFTKLINR 127

Query: 681 NTTIPTKQTQTF 716
           NTTIPTK++Q F
Sbjct: 128 NTTIPTKKSQVF 139


>BC119690-1|AAI19691.1|  509|Homo sapiens heat shock 70kDa protein
           14 protein.
          Length = 509

 Score = 68.5 bits (160), Expect = 2e-11
 Identities = 36/88 (40%), Positives = 53/88 (60%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LS+   A+  +DSL+EG DF  +++RARFE L + LF   +E +   L         
Sbjct: 269 KHSLSTLGSANCFLDSLYEGQDFDCNVSRARFELLCSPLFNKCIEAIRGLLDQNGFTADD 328

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           I+ +VL GGS+RIPK+Q+L++D F   E
Sbjct: 329 INKVVLCGGSSRIPKLQQLIKDLFPAVE 356



 Score = 66.9 bits (156), Expect = 7e-11
 Identities = 28/82 (34%), Positives = 48/82 (58%)
 Frame = +2

Query: 8   RRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKK 187
           + N+L+F LGG +  +S++ +  GI+ V ST  D ++GG  F   +  +   EF+R +K 
Sbjct: 190 KSNILVFKLGGTSLSLSVMEVNSGIYRVLSTNTDDNIGGAHFTETLAQYLASEFQRSFKH 249

Query: 188 DLATNKRALRRLRTACERAKRT 253
           D+  N RA+ +L  + E AK +
Sbjct: 250 DVRGNARAMMKLTNSAEVAKHS 271


>AF143723-1|AAF66640.1|  509|Homo sapiens heat shock protein HSP60
           protein.
          Length = 509

 Score = 68.5 bits (160), Expect = 2e-11
 Identities = 36/88 (40%), Positives = 53/88 (60%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LS+   A+  +DSL+EG DF  +++RARFE L + LF   +E +   L         
Sbjct: 269 KHSLSTLGSANCFLDSLYEGQDFDCNVSRARFELLCSPLFNKCIEAIRGLLDQNGFTADD 328

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           I+ +VL GGS+RIPK+Q+L++D F   E
Sbjct: 329 INKVVLCGGSSRIPKLQQLIKDLFPAVE 356



 Score = 66.9 bits (156), Expect = 7e-11
 Identities = 28/82 (34%), Positives = 48/82 (58%)
 Frame = +2

Query: 8   RRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKK 187
           + N+L+F LGG +  +S++ +  GI+ V ST  D ++GG  F   +  +   EF+R +K 
Sbjct: 190 KSNILVFKLGGTSLSLSVMEVNSGIYRVLSTNTDDNIGGAHFTETLAQYLASEFQRSFKH 249

Query: 188 DLATNKRALRRLRTACERAKRT 253
           D+  N RA+ +L  + E AK +
Sbjct: 250 DVRGNARAMMKLTNSAEVAKHS 271


>AF112210-1|AAF17198.1|  509|Homo sapiens heat shock protein
           hsp70-related protein protein.
          Length = 509

 Score = 66.9 bits (156), Expect = 7e-11
 Identities = 28/82 (34%), Positives = 48/82 (58%)
 Frame = +2

Query: 8   RRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKK 187
           + N+L+F LGG +  +S++ +  GI+ V ST  D ++GG  F   +  +   EF+R +K 
Sbjct: 190 KSNILVFKLGGTSLSLSVMEVNSGIYRVLSTNTDDNIGGAHFTETLAQYLASEFQRSFKH 249

Query: 188 DLATNKRALRRLRTACERAKRT 253
           D+  N RA+ +L  + E AK +
Sbjct: 250 DVRGNARAMMKLTNSAEVAKHS 271



 Score = 66.9 bits (156), Expect = 7e-11
 Identities = 36/88 (40%), Positives = 52/88 (59%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LS+   A+   DSL+EG DF  +++RARFE L + LF   +E +   L         
Sbjct: 269 KHSLSTLGSANCFPDSLYEGQDFDCNVSRARFELLCSPLFNKCLEAIRGLLDQNGFTADD 328

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           I+ +VL GGS+RIPK+Q+L++D F   E
Sbjct: 329 INKVVLCGGSSRIPKLQQLIKDLFPAVE 356


>AF038963-1|AAD19826.1|  925|Homo sapiens RNA helicase protein.
          Length = 925

 Score = 29.9 bits (64), Expect = 9.5
 Identities = 13/49 (26%), Positives = 26/49 (53%), Gaps = 3/49 (6%)
 Frame = +1

Query: 307 DFYTSITRARFEELNADL---FRSTMEPVEKSLRDAKMDKAQIHDIVLV 444
           DF++++  A FEE+  DL   F   ++ +E   RD   +  ++ D+  +
Sbjct: 569 DFFSNVRAAGFEEIEQDLTQRFEEKLQELESVSRDPSNENPKLEDLCFI 617


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 113,059,505
Number of Sequences: 237096
Number of extensions: 2668290
Number of successful extensions: 7283
Number of sequences better than 10.0: 111
Number of HSP's better than 10.0 without gapping: 6581
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7260
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8399192100
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -