SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20035
         (493 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U14968-1|AAA85656.1|  148|Homo sapiens ribosomal protein L27a pr...   102   6e-22
BC005326-1|AAH05326.1|  148|Homo sapiens ribosomal protein L27a ...   102   6e-22
AJ400879-2|CAC35388.1|  106|Homo sapiens ribosomal protein L27a ...   102   6e-22
AB020236-1|BAA77361.1|  148|Homo sapiens ribosomal protein L27A ...   102   6e-22
BC020169-1|AAH20169.1|  147|Homo sapiens Unknown (protein for IM...   101   1e-21
BC066326-1|AAH66326.1|  148|Homo sapiens ribosomal protein L27a ...    99   4e-21
AB007178-1|BAA25837.1|   34|Homo sapiens ribosomal protein L27a ...    35   0.13 
BC110340-1|AAI10341.1|  323|Homo sapiens lectin, galactoside-bin...    31   2.2  
BC105944-1|AAI05945.1|  323|Homo sapiens lectin, galactoside-bin...    31   2.2  
BC105942-1|AAI05943.1|  323|Homo sapiens lectin, galactoside-bin...    31   2.2  
AK223232-1|BAD96952.1|  323|Homo sapiens galectin 9 short isofor...    31   2.2  
AJ288083-1|CAB93851.1|  355|Homo sapiens galectin-9 protein.           31   2.2  
AB040130-3|BAB83625.1|  355|Homo sapiens galectin-9 protein.           31   2.2  
AB040130-2|BAB83624.1|  323|Homo sapiens galectin-9 protein.           31   2.2  
AB040130-1|BAB83623.1|  311|Homo sapiens galectin-9 protein.           31   2.2  
AB006782-1|BAA22166.1|  355|Homo sapiens galectin-9 isoform prot...    31   2.2  
AB005894-1|BAA31542.1|  323|Homo sapiens ecalectin protein.            31   2.2  
Z49107-1|CAA88922.1|  323|Homo sapiens galectin protein.               31   2.9  
BC105943-1|AAI05944.1|  356|Homo sapiens galectin-9 like protein.      31   2.9  
BC073889-1|AAH73889.1|  356|Homo sapiens similar to galectin 9 s...    31   2.9  
AY358091-1|AAQ88458.1|  126|Homo sapiens VFLL3057 protein.             29   6.6  
AK126225-1|BAC86496.1|  139|Homo sapiens protein ( Homo sapiens ...    29   8.8  

>U14968-1|AAA85656.1|  148|Homo sapiens ribosomal protein L27a
           protein.
          Length = 148

 Score =  102 bits (245), Expect = 6e-22
 Identities = 43/78 (55%), Positives = 54/78 (69%)
 Frame = +1

Query: 22  MATSKKKTRKLRGHVSXXXXXXXXXXXXXXXXXNAGGEHHHRINMDKYHPGYFGKLGMRN 201
           M +  +KTRKLRGHVS                 NAGG HHHRIN DKYHPGYFGK+GM++
Sbjct: 1   MPSRLRKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGLHHHRINFDKYHPGYFGKVGMKH 60

Query: 202 FHFRKNKNFCPVLNLDKL 255
           +H ++N++FCP +NLDKL
Sbjct: 61  YHLKRNQSFCPTVNLDKL 78



 Score = 58.8 bits (136), Expect = 9e-09
 Identities = 33/88 (37%), Positives = 42/88 (47%)
 Frame = +3

Query: 201 FPL*KEQEFLSSFELR*AWTLVSEQTRLKYASAPDGKVPVINIVKAXXXXXXXXXXXPKQ 380
           + L + Q F  +  L   WTLVSEQTR+  A    G  P+I++V++           PKQ
Sbjct: 61  YHLKRNQSFCPTVNLDKLWTLVSEQTRVNAAKNKTGAAPIIDVVRSGYYKVLGKGKLPKQ 120

Query: 381 PVIVXXXXXXXXXXXXXXDVGGACVLSA 464
           PVIV               VGGACVL A
Sbjct: 121 PVIVKAKFFSRRAEEKIKSVGGACVLVA 148


>BC005326-1|AAH05326.1|  148|Homo sapiens ribosomal protein L27a
           protein.
          Length = 148

 Score =  102 bits (245), Expect = 6e-22
 Identities = 43/78 (55%), Positives = 54/78 (69%)
 Frame = +1

Query: 22  MATSKKKTRKLRGHVSXXXXXXXXXXXXXXXXXNAGGEHHHRINMDKYHPGYFGKLGMRN 201
           M +  +KTRKLRGHVS                 NAGG HHHRIN DKYHPGYFGK+GM++
Sbjct: 1   MPSRLRKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGLHHHRINFDKYHPGYFGKVGMKH 60

Query: 202 FHFRKNKNFCPVLNLDKL 255
           +H ++N++FCP +NLDKL
Sbjct: 61  YHLKRNQSFCPTVNLDKL 78



 Score = 58.8 bits (136), Expect = 9e-09
 Identities = 33/88 (37%), Positives = 42/88 (47%)
 Frame = +3

Query: 201 FPL*KEQEFLSSFELR*AWTLVSEQTRLKYASAPDGKVPVINIVKAXXXXXXXXXXXPKQ 380
           + L + Q F  +  L   WTLVSEQTR+  A    G  P+I++V++           PKQ
Sbjct: 61  YHLKRNQSFCPTVNLDKLWTLVSEQTRVNAAKNKTGAAPIIDVVRSGYYKVLGKGKLPKQ 120

Query: 381 PVIVXXXXXXXXXXXXXXDVGGACVLSA 464
           PVIV               VGGACVL A
Sbjct: 121 PVIVKAKFFSRRAEEKIKSVGGACVLVA 148


>AJ400879-2|CAC35388.1|  106|Homo sapiens ribosomal protein L27a
           protein.
          Length = 106

 Score =  102 bits (245), Expect = 6e-22
 Identities = 43/78 (55%), Positives = 54/78 (69%)
 Frame = +1

Query: 22  MATSKKKTRKLRGHVSXXXXXXXXXXXXXXXXXNAGGEHHHRINMDKYHPGYFGKLGMRN 201
           M +  +KTRKLRGHVS                 NAGG HHHRIN DKYHPGYFGK+GM++
Sbjct: 1   MPSRLRKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGLHHHRINFDKYHPGYFGKVGMKH 60

Query: 202 FHFRKNKNFCPVLNLDKL 255
           +H ++N++FCP +NLDKL
Sbjct: 61  YHLKRNQSFCPTVNLDKL 78



 Score = 38.7 bits (86), Expect = 0.011
 Identities = 18/46 (39%), Positives = 27/46 (58%)
 Frame = +3

Query: 201 FPL*KEQEFLSSFELR*AWTLVSEQTRLKYASAPDGKVPVINIVKA 338
           + L + Q F  +  L   WTLVSEQTR+  A    G  P+I++V++
Sbjct: 61  YHLKRNQSFCPTVNLDKLWTLVSEQTRVNAAKNKTGAAPIIDVVRS 106


>AB020236-1|BAA77361.1|  148|Homo sapiens ribosomal protein L27A
           protein.
          Length = 148

 Score =  102 bits (245), Expect = 6e-22
 Identities = 43/78 (55%), Positives = 54/78 (69%)
 Frame = +1

Query: 22  MATSKKKTRKLRGHVSXXXXXXXXXXXXXXXXXNAGGEHHHRINMDKYHPGYFGKLGMRN 201
           M +  +KTRKLRGHVS                 NAGG HHHRIN DKYHPGYFGK+GM++
Sbjct: 1   MPSRLRKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGLHHHRINFDKYHPGYFGKVGMKH 60

Query: 202 FHFRKNKNFCPVLNLDKL 255
           +H ++N++FCP +NLDKL
Sbjct: 61  YHLKRNQSFCPTVNLDKL 78



 Score = 58.8 bits (136), Expect = 9e-09
 Identities = 33/88 (37%), Positives = 42/88 (47%)
 Frame = +3

Query: 201 FPL*KEQEFLSSFELR*AWTLVSEQTRLKYASAPDGKVPVINIVKAXXXXXXXXXXXPKQ 380
           + L + Q F  +  L   WTLVSEQTR+  A    G  P+I++V++           PKQ
Sbjct: 61  YHLKRNQSFCPTVNLDKLWTLVSEQTRVNAAKNKTGAAPIIDVVRSGYYKVLGKGKLPKQ 120

Query: 381 PVIVXXXXXXXXXXXXXXDVGGACVLSA 464
           PVIV               VGGACVL A
Sbjct: 121 PVIVKAKFFSRRAEEKIKSVGGACVLVA 148


>BC020169-1|AAH20169.1|  147|Homo sapiens Unknown (protein for
           IMAGE:3543815) protein.
          Length = 147

 Score =  101 bits (243), Expect = 1e-21
 Identities = 42/73 (57%), Positives = 52/73 (71%)
 Frame = +1

Query: 37  KKTRKLRGHVSXXXXXXXXXXXXXXXXXNAGGEHHHRINMDKYHPGYFGKLGMRNFHFRK 216
           +KTRKLRGHVS                 NAGG HHHRIN DKYHPGYFGK+GM+++H ++
Sbjct: 5   RKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGLHHHRINFDKYHPGYFGKVGMKHYHLKR 64

Query: 217 NKNFCPVLNLDKL 255
           N++FCP +NLDKL
Sbjct: 65  NQSFCPTVNLDKL 77



 Score = 58.8 bits (136), Expect = 9e-09
 Identities = 33/88 (37%), Positives = 42/88 (47%)
 Frame = +3

Query: 201 FPL*KEQEFLSSFELR*AWTLVSEQTRLKYASAPDGKVPVINIVKAXXXXXXXXXXXPKQ 380
           + L + Q F  +  L   WTLVSEQTR+  A    G  P+I++V++           PKQ
Sbjct: 60  YHLKRNQSFCPTVNLDKLWTLVSEQTRVNAAKNKTGAAPIIDVVRSGYYKVLGKGKLPKQ 119

Query: 381 PVIVXXXXXXXXXXXXXXDVGGACVLSA 464
           PVIV               VGGACVL A
Sbjct: 120 PVIVKAKFFSRRAEEKIKSVGGACVLVA 147


>BC066326-1|AAH66326.1|  148|Homo sapiens ribosomal protein L27a
           protein.
          Length = 148

 Score =   99 bits (238), Expect = 4e-21
 Identities = 42/78 (53%), Positives = 54/78 (69%)
 Frame = +1

Query: 22  MATSKKKTRKLRGHVSXXXXXXXXXXXXXXXXXNAGGEHHHRINMDKYHPGYFGKLGMRN 201
           M +  +KTRKLRGHVS                 NAGG HHHRIN DKYHPGYFGK+GM++
Sbjct: 1   MPSRLRKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGLHHHRINFDKYHPGYFGKVGMKH 60

Query: 202 FHFRKNKNFCPVLNLDKL 255
           ++ ++N++FCP +NLDKL
Sbjct: 61  YNLKRNQSFCPTVNLDKL 78



 Score = 55.6 bits (128), Expect = 9e-08
 Identities = 32/88 (36%), Positives = 41/88 (46%)
 Frame = +3

Query: 201 FPL*KEQEFLSSFELR*AWTLVSEQTRLKYASAPDGKVPVINIVKAXXXXXXXXXXXPKQ 380
           + L + Q F  +  L   WTLVSEQTR+  A    G  P+I++V++            KQ
Sbjct: 61  YNLKRNQSFCPTVNLDKLWTLVSEQTRVNAAKNKTGAAPIIDVVRSGYYKVLGKGKLAKQ 120

Query: 381 PVIVXXXXXXXXXXXXXXDVGGACVLSA 464
           PVIV               VGGACVL A
Sbjct: 121 PVIVKAKLFSRRAEEKIKSVGGACVLVA 148


>AB007178-1|BAA25837.1|   34|Homo sapiens ribosomal protein L27a
           protein.
          Length = 34

 Score = 35.1 bits (77), Expect = 0.13
 Identities = 14/28 (50%), Positives = 20/28 (71%)
 Frame = +3

Query: 255 WTLVSEQTRLKYASAPDGKVPVINIVKA 338
           WTLVSEQTR+  A    G  P+I++V++
Sbjct: 7   WTLVSEQTRVNAAKNKTGAAPIIDVVRS 34


>BC110340-1|AAI10341.1|  323|Homo sapiens lectin,
           galactoside-binding, soluble, 9 (galectin 9) protein.
          Length = 323

 Score = 31.1 bits (67), Expect = 2.2
 Identities = 12/41 (29%), Positives = 25/41 (60%)
 Frame = -1

Query: 343 YPALTILMTGTLPSGADAYFSLVCSETNVQAYLSSKLDRNS 221
           YP+ +IL++GT+   A  +   +CS  ++  +L+ + D N+
Sbjct: 204 YPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENA 244


>BC105944-1|AAI05945.1|  323|Homo sapiens lectin,
           galactoside-binding, soluble, 9 (galectin 9) protein.
          Length = 323

 Score = 31.1 bits (67), Expect = 2.2
 Identities = 12/41 (29%), Positives = 25/41 (60%)
 Frame = -1

Query: 343 YPALTILMTGTLPSGADAYFSLVCSETNVQAYLSSKLDRNS 221
           YP+ +IL++GT+   A  +   +CS  ++  +L+ + D N+
Sbjct: 204 YPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENA 244


>BC105942-1|AAI05943.1|  323|Homo sapiens lectin,
           galactoside-binding, soluble, 9 (galectin 9) protein.
          Length = 323

 Score = 31.1 bits (67), Expect = 2.2
 Identities = 12/41 (29%), Positives = 25/41 (60%)
 Frame = -1

Query: 343 YPALTILMTGTLPSGADAYFSLVCSETNVQAYLSSKLDRNS 221
           YP+ +IL++GT+   A  +   +CS  ++  +L+ + D N+
Sbjct: 204 YPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENA 244


>AK223232-1|BAD96952.1|  323|Homo sapiens galectin 9 short isoform
           variant protein.
          Length = 323

 Score = 31.1 bits (67), Expect = 2.2
 Identities = 12/41 (29%), Positives = 25/41 (60%)
 Frame = -1

Query: 343 YPALTILMTGTLPSGADAYFSLVCSETNVQAYLSSKLDRNS 221
           YP+ +IL++GT+   A  +   +CS  ++  +L+ + D N+
Sbjct: 204 YPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENA 244


>AJ288083-1|CAB93851.1|  355|Homo sapiens galectin-9 protein.
          Length = 355

 Score = 31.1 bits (67), Expect = 2.2
 Identities = 12/41 (29%), Positives = 25/41 (60%)
 Frame = -1

Query: 343 YPALTILMTGTLPSGADAYFSLVCSETNVQAYLSSKLDRNS 221
           YP+ +IL++GT+   A  +   +CS  ++  +L+ + D N+
Sbjct: 236 YPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENA 276


>AB040130-3|BAB83625.1|  355|Homo sapiens galectin-9 protein.
          Length = 355

 Score = 31.1 bits (67), Expect = 2.2
 Identities = 12/41 (29%), Positives = 25/41 (60%)
 Frame = -1

Query: 343 YPALTILMTGTLPSGADAYFSLVCSETNVQAYLSSKLDRNS 221
           YP+ +IL++GT+   A  +   +CS  ++  +L+ + D N+
Sbjct: 236 YPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENA 276


>AB040130-2|BAB83624.1|  323|Homo sapiens galectin-9 protein.
          Length = 323

 Score = 31.1 bits (67), Expect = 2.2
 Identities = 12/41 (29%), Positives = 25/41 (60%)
 Frame = -1

Query: 343 YPALTILMTGTLPSGADAYFSLVCSETNVQAYLSSKLDRNS 221
           YP+ +IL++GT+   A  +   +CS  ++  +L+ + D N+
Sbjct: 204 YPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENA 244


>AB040130-1|BAB83623.1|  311|Homo sapiens galectin-9 protein.
          Length = 311

 Score = 31.1 bits (67), Expect = 2.2
 Identities = 12/41 (29%), Positives = 25/41 (60%)
 Frame = -1

Query: 343 YPALTILMTGTLPSGADAYFSLVCSETNVQAYLSSKLDRNS 221
           YP+ +IL++GT+   A  +   +CS  ++  +L+ + D N+
Sbjct: 192 YPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENA 232


>AB006782-1|BAA22166.1|  355|Homo sapiens galectin-9 isoform
           protein.
          Length = 355

 Score = 31.1 bits (67), Expect = 2.2
 Identities = 12/41 (29%), Positives = 25/41 (60%)
 Frame = -1

Query: 343 YPALTILMTGTLPSGADAYFSLVCSETNVQAYLSSKLDRNS 221
           YP+ +IL++GT+   A  +   +CS  ++  +L+ + D N+
Sbjct: 236 YPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENA 276


>AB005894-1|BAA31542.1|  323|Homo sapiens ecalectin protein.
          Length = 323

 Score = 31.1 bits (67), Expect = 2.2
 Identities = 12/41 (29%), Positives = 25/41 (60%)
 Frame = -1

Query: 343 YPALTILMTGTLPSGADAYFSLVCSETNVQAYLSSKLDRNS 221
           YP+ +IL++GT+   A  +   +CS  ++  +L+ + D N+
Sbjct: 204 YPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENA 244


>Z49107-1|CAA88922.1|  323|Homo sapiens galectin protein.
          Length = 323

 Score = 30.7 bits (66), Expect = 2.9
 Identities = 12/41 (29%), Positives = 25/41 (60%)
 Frame = -1

Query: 343 YPALTILMTGTLPSGADAYFSLVCSETNVQAYLSSKLDRNS 221
           YP+ +IL++GT+   A  +   +CS  ++  +L+ + D N+
Sbjct: 204 YPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNLRFDENA 244


>BC105943-1|AAI05944.1|  356|Homo sapiens galectin-9 like protein.
          Length = 356

 Score = 30.7 bits (66), Expect = 2.9
 Identities = 12/47 (25%), Positives = 29/47 (61%)
 Frame = -1

Query: 361 LPSNL*YPALTILMTGTLPSGADAYFSLVCSETNVQAYLSSKLDRNS 221
           +P  L YP+ +I+++GT+   A  +   +CS +++  +++ + D N+
Sbjct: 232 IPGGL-YPSKSIILSGTVLPSAQRFHINLCSGSHIAFHMNPRFDENA 277


>BC073889-1|AAH73889.1|  356|Homo sapiens similar to galectin 9
           short isoform protein.
          Length = 356

 Score = 30.7 bits (66), Expect = 2.9
 Identities = 12/47 (25%), Positives = 29/47 (61%)
 Frame = -1

Query: 361 LPSNL*YPALTILMTGTLPSGADAYFSLVCSETNVQAYLSSKLDRNS 221
           +P  L YP+ +I+++GT+   A  +   +CS +++  +++ + D N+
Sbjct: 232 IPGGL-YPSKSIILSGTVLPSAQRFHINLCSGSHIAFHMNPRFDENA 277


>AY358091-1|AAQ88458.1|  126|Homo sapiens VFLL3057 protein.
          Length = 126

 Score = 29.5 bits (63), Expect = 6.6
 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 3/54 (5%)
 Frame = -3

Query: 191 PSLPKYPGWYLSMLIL*WCSPPALPRPPGCLRCFPIRPCP---*LT*PLSFLVF 39
           P+LPK+PG  ++ L   W S    P P G +    + PCP       PL FLV+
Sbjct: 55  PALPKWPGHLMAELQGPWLSLAHCPSPSGPI----VLPCPFRVQFEPPLQFLVW 104


>AK126225-1|BAC86496.1|  139|Homo sapiens protein ( Homo sapiens
           cDNA FLJ44237 fis, clone THYMU3007845. ).
          Length = 139

 Score = 29.1 bits (62), Expect = 8.8
 Identities = 12/43 (27%), Positives = 15/43 (34%)
 Frame = +2

Query: 335 SWILQVARQRQTPQTTCHSKSKVLLKISREENQGCGWCLCTIC 463
           +W L      Q PQ        + L   R   + C WC C  C
Sbjct: 71  AWFLSPVHHSQIPQLAACPLQSLRLSKPRSPGRCCAWCGCLNC 113


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 69,349,129
Number of Sequences: 237096
Number of extensions: 1458588
Number of successful extensions: 2950
Number of sequences better than 10.0: 22
Number of HSP's better than 10.0 without gapping: 2780
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2943
length of database: 76,859,062
effective HSP length: 85
effective length of database: 56,705,902
effective search space used: 4423060356
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -