SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20033
         (694 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC029067-1|AAH29067.1|   65|Homo sapiens chromosome 13 open read...    89   1e-17
AL138960-2|CAI12995.1|   65|Homo sapiens RP11-269C23.1 protein.        89   1e-17
CR533472-1|CAG38503.1|   66|Homo sapiens SERP1 protein.                79   2e-14
BC112365-1|AAI12366.1|   66|Homo sapiens stress-associated endop...    79   2e-14
BC112364-1|AAI12365.1|   66|Homo sapiens stress-associated endop...    79   2e-14
BC108314-1|AAI08315.1|   66|Homo sapiens stress-associated endop...    79   2e-14
AF136975-1|AAG49436.1|   66|Homo sapiens ribosome attached membr...    79   2e-14
AB022427-1|BAA81895.1|   66|Homo sapiens SERP1 protein.                79   2e-14
BC128392-1|AAI28393.1|  782|Homo sapiens zinc finger protein 786...    30   6.8  
BC109245-1|AAI09246.1|  753|Homo sapiens ZNF786 protein protein.       30   6.8  

>BC029067-1|AAH29067.1|   65|Homo sapiens chromosome 13 open reading
           frame 21 protein.
          Length = 65

 Score = 89.0 bits (211), Expect = 1e-17
 Identities = 39/56 (69%), Positives = 47/56 (83%)
 Frame = +1

Query: 88  MAPKQRMRIANEIASKNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQ 255
           M  KQR+R+ANE  SKNIT RGNV KT + +E++YPV PWLLALF+FVVCGSA+FQ
Sbjct: 1   MVAKQRIRMANEKHSKNITQRGNVAKTLRPQEEKYPVGPWLLALFVFVVCGSAIFQ 56


>AL138960-2|CAI12995.1|   65|Homo sapiens RP11-269C23.1 protein.
          Length = 65

 Score = 89.0 bits (211), Expect = 1e-17
 Identities = 39/56 (69%), Positives = 47/56 (83%)
 Frame = +1

Query: 88  MAPKQRMRIANEIASKNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQ 255
           M  KQR+R+ANE  SKNIT RGNV KT + +E++YPV PWLLALF+FVVCGSA+FQ
Sbjct: 1   MVAKQRIRMANEKHSKNITQRGNVAKTLRPQEEKYPVGPWLLALFVFVVCGSAIFQ 56


>CR533472-1|CAG38503.1|   66|Homo sapiens SERP1 protein.
          Length = 66

 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 38/57 (66%), Positives = 45/57 (78%), Gaps = 1/57 (1%)
 Frame = +1

Query: 88  MAPKQRMRIANEIASKNITMRGNVPKTTKEK-EDQYPVAPWLLALFIFVVCGSAVFQ 255
           M  KQR+R+ANE  SKNIT RGNV KT++   E++  V PWLLALFIFVVCGSA+FQ
Sbjct: 1   MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQ 57


>BC112365-1|AAI12366.1|   66|Homo sapiens stress-associated
           endoplasmic reticulum protein 1 protein.
          Length = 66

 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 38/57 (66%), Positives = 45/57 (78%), Gaps = 1/57 (1%)
 Frame = +1

Query: 88  MAPKQRMRIANEIASKNITMRGNVPKTTKEK-EDQYPVAPWLLALFIFVVCGSAVFQ 255
           M  KQR+R+ANE  SKNIT RGNV KT++   E++  V PWLLALFIFVVCGSA+FQ
Sbjct: 1   MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQ 57


>BC112364-1|AAI12365.1|   66|Homo sapiens stress-associated
           endoplasmic reticulum protein 1 protein.
          Length = 66

 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 38/57 (66%), Positives = 45/57 (78%), Gaps = 1/57 (1%)
 Frame = +1

Query: 88  MAPKQRMRIANEIASKNITMRGNVPKTTKEK-EDQYPVAPWLLALFIFVVCGSAVFQ 255
           M  KQR+R+ANE  SKNIT RGNV KT++   E++  V PWLLALFIFVVCGSA+FQ
Sbjct: 1   MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQ 57


>BC108314-1|AAI08315.1|   66|Homo sapiens stress-associated
           endoplasmic reticulum protein 1 protein.
          Length = 66

 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 38/57 (66%), Positives = 45/57 (78%), Gaps = 1/57 (1%)
 Frame = +1

Query: 88  MAPKQRMRIANEIASKNITMRGNVPKTTKEK-EDQYPVAPWLLALFIFVVCGSAVFQ 255
           M  KQR+R+ANE  SKNIT RGNV KT++   E++  V PWLLALFIFVVCGSA+FQ
Sbjct: 1   MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQ 57


>AF136975-1|AAG49436.1|   66|Homo sapiens ribosome attached membrane
           protein 4 protein.
          Length = 66

 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 38/57 (66%), Positives = 45/57 (78%), Gaps = 1/57 (1%)
 Frame = +1

Query: 88  MAPKQRMRIANEIASKNITMRGNVPKTTKEK-EDQYPVAPWLLALFIFVVCGSAVFQ 255
           M  KQR+R+ANE  SKNIT RGNV KT++   E++  V PWLLALFIFVVCGSA+FQ
Sbjct: 1   MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQ 57


>AB022427-1|BAA81895.1|   66|Homo sapiens SERP1 protein.
          Length = 66

 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 38/57 (66%), Positives = 45/57 (78%), Gaps = 1/57 (1%)
 Frame = +1

Query: 88  MAPKQRMRIANEIASKNITMRGNVPKTTKEK-EDQYPVAPWLLALFIFVVCGSAVFQ 255
           M  KQR+R+ANE  SKNIT RGNV KT++   E++  V PWLLALFIFVVCGSA+FQ
Sbjct: 1   MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQ 57


>BC128392-1|AAI28393.1|  782|Homo sapiens zinc finger protein 786
           protein.
          Length = 782

 Score = 30.3 bits (65), Expect = 6.8
 Identities = 16/58 (27%), Positives = 27/58 (46%), Gaps = 1/58 (1%)
 Frame = +3

Query: 105 NAYRQRDRQ*KHHN-EGECTQNYQGKRRPISCGTLAPCSLHLRSVWLCCVPIIQSIRL 275
           N++++ D +   H  EG C+ +  G+R P+S    +PC  H       C    +  RL
Sbjct: 351 NSHQEGDTEALQHGAEGPCSCSECGERSPMSARLASPCRAHTGEKPFQCAHCTKRFRL 408


>BC109245-1|AAI09246.1|  753|Homo sapiens ZNF786 protein protein.
          Length = 753

 Score = 30.3 bits (65), Expect = 6.8
 Identities = 16/58 (27%), Positives = 27/58 (46%), Gaps = 1/58 (1%)
 Frame = +3

Query: 105 NAYRQRDRQ*KHHN-EGECTQNYQGKRRPISCGTLAPCSLHLRSVWLCCVPIIQSIRL 275
           N++++ D +   H  EG C+ +  G+R P+S    +PC  H       C    +  RL
Sbjct: 322 NSHQEGDTEALQHGAEGPCSCSECGERSPMSARLASPCRAHTGEKPFQCAHCTKRFRL 379


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 98,860,197
Number of Sequences: 237096
Number of extensions: 2019481
Number of successful extensions: 3925
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 3764
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3919
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 7951235188
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -