SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20031
         (764 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X79238-1|CAA55820.1|  115|Homo sapiens ribosomal protein L30 pro...    67   7e-11
L05095-1|AAC15858.1|  115|Homo sapiens ribosomal protein L30 pro...    67   7e-11
BC095426-1|AAH95426.1|  115|Homo sapiens ribosomal protein L30 p...    67   7e-11
BC032700-1|AAH32700.1|  115|Homo sapiens ribosomal protein L30 p...    67   7e-11
AB070559-1|BAB79491.1|  115|Homo sapiens ribosomal protein L30 p...    67   7e-11

>X79238-1|CAA55820.1|  115|Homo sapiens ribosomal protein L30
           protein.
          Length = 115

 Score = 66.9 bits (156), Expect = 7e-11
 Identities = 32/42 (76%), Positives = 36/42 (85%)
 Frame = +3

Query: 150 MVAAKKQKKTIESINSRLALVMKSGKYCLGYKQTLKLFDKAK 275
           MVAAKK KK++ESINSRL LVMKSGKY LGYKQTLK+  + K
Sbjct: 1   MVAAKKTKKSLESINSRLQLVMKSGKYVLGYKQTLKMIRQGK 42



 Score = 37.5 bits (83), Expect = 0.052
 Identities = 17/32 (53%), Positives = 22/32 (68%)
 Frame = +2

Query: 221 GKILLRIQANFETLRQGKAKLVIIAKNAPPLR 316
           GK +L  +   + +RQGKAKLVI+A N P LR
Sbjct: 25  GKYVLGYKQTLKMIRQGKAKLVILANNCPALR 56


>L05095-1|AAC15858.1|  115|Homo sapiens ribosomal protein L30
           protein.
          Length = 115

 Score = 66.9 bits (156), Expect = 7e-11
 Identities = 32/42 (76%), Positives = 36/42 (85%)
 Frame = +3

Query: 150 MVAAKKQKKTIESINSRLALVMKSGKYCLGYKQTLKLFDKAK 275
           MVAAKK KK++ESINSRL LVMKSGKY LGYKQTLK+  + K
Sbjct: 1   MVAAKKTKKSLESINSRLQLVMKSGKYVLGYKQTLKMIRQGK 42



 Score = 37.5 bits (83), Expect = 0.052
 Identities = 17/32 (53%), Positives = 22/32 (68%)
 Frame = +2

Query: 221 GKILLRIQANFETLRQGKAKLVIIAKNAPPLR 316
           GK +L  +   + +RQGKAKLVI+A N P LR
Sbjct: 25  GKYVLGYKQTLKMIRQGKAKLVILANNCPALR 56


>BC095426-1|AAH95426.1|  115|Homo sapiens ribosomal protein L30
           protein.
          Length = 115

 Score = 66.9 bits (156), Expect = 7e-11
 Identities = 32/42 (76%), Positives = 36/42 (85%)
 Frame = +3

Query: 150 MVAAKKQKKTIESINSRLALVMKSGKYCLGYKQTLKLFDKAK 275
           MVAAKK KK++ESINSRL LVMKSGKY LGYKQTLK+  + K
Sbjct: 1   MVAAKKTKKSLESINSRLQLVMKSGKYVLGYKQTLKMIRQGK 42



 Score = 37.5 bits (83), Expect = 0.052
 Identities = 17/32 (53%), Positives = 22/32 (68%)
 Frame = +2

Query: 221 GKILLRIQANFETLRQGKAKLVIIAKNAPPLR 316
           GK +L  +   + +RQGKAKLVI+A N P LR
Sbjct: 25  GKYVLGYKQTLKMIRQGKAKLVILANNCPALR 56


>BC032700-1|AAH32700.1|  115|Homo sapiens ribosomal protein L30
           protein.
          Length = 115

 Score = 66.9 bits (156), Expect = 7e-11
 Identities = 32/42 (76%), Positives = 36/42 (85%)
 Frame = +3

Query: 150 MVAAKKQKKTIESINSRLALVMKSGKYCLGYKQTLKLFDKAK 275
           MVAAKK KK++ESINSRL LVMKSGKY LGYKQTLK+  + K
Sbjct: 1   MVAAKKTKKSLESINSRLQLVMKSGKYVLGYKQTLKMIRQGK 42



 Score = 37.5 bits (83), Expect = 0.052
 Identities = 17/32 (53%), Positives = 22/32 (68%)
 Frame = +2

Query: 221 GKILLRIQANFETLRQGKAKLVIIAKNAPPLR 316
           GK +L  +   + +RQGKAKLVI+A N P LR
Sbjct: 25  GKYVLGYKQTLKMIRQGKAKLVILANNCPALR 56


>AB070559-1|BAB79491.1|  115|Homo sapiens ribosomal protein L30
           protein.
          Length = 115

 Score = 66.9 bits (156), Expect = 7e-11
 Identities = 32/42 (76%), Positives = 36/42 (85%)
 Frame = +3

Query: 150 MVAAKKQKKTIESINSRLALVMKSGKYCLGYKQTLKLFDKAK 275
           MVAAKK KK++ESINSRL LVMKSGKY LGYKQTLK+  + K
Sbjct: 1   MVAAKKTKKSLESINSRLQLVMKSGKYVLGYKQTLKMIRQGK 42



 Score = 37.5 bits (83), Expect = 0.052
 Identities = 17/32 (53%), Positives = 22/32 (68%)
 Frame = +2

Query: 221 GKILLRIQANFETLRQGKAKLVIIAKNAPPLR 316
           GK +L  +   + +RQGKAKLVI+A N P LR
Sbjct: 25  GKYVLGYKQTLKMIRQGKAKLVILANNCPALR 56


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 101,776,075
Number of Sequences: 237096
Number of extensions: 2004552
Number of successful extensions: 2847
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 2779
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2847
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 9199990470
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -