SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20030
         (713 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X16869-1|CAA34756.1|  462|Homo sapiens protein ( Human mRNA for ...   283   6e-76
AK223046-1|BAD96766.1|  462|Homo sapiens eukaryotic translation ...   283   6e-76
X03558-1|CAA27245.1|  462|Homo sapiens protein ( Human mRNA for ...   282   8e-76
J04617-1|AAA52343.1|  462|Homo sapiens EEF1A protein.                 282   8e-76
EF362804-1|ABO30531.1|  462|Homo sapiens EF1a protein.                282   8e-76
BC111051-1|AAI11052.1|  462|Homo sapiens eukaryotic translation ...   282   8e-76
BC082268-1|AAH82268.1|  462|Homo sapiens eukaryotic translation ...   282   8e-76
BC072385-1|AAH72385.1|  462|Homo sapiens eukaryotic translation ...   282   8e-76
BC071841-1|AAH71841.1|  462|Homo sapiens eukaryotic translation ...   282   8e-76
BC071741-1|AAH71741.1|  462|Homo sapiens eukaryotic translation ...   282   8e-76
BC066893-1|AAH66893.1|  462|Homo sapiens eukaryotic translation ...   282   8e-76
BC057391-1|AAH57391.1|  462|Homo sapiens eukaryotic translation ...   282   8e-76
BC038339-1|AAH38339.1|  462|Homo sapiens eukaryotic translation ...   282   8e-76
BC028674-1|AAH28674.1|  462|Homo sapiens eukaryotic translation ...   282   8e-76
BC021686-1|AAH21686.1|  462|Homo sapiens eukaryotic translation ...   282   8e-76
BC019669-1|AAH19669.1|  462|Homo sapiens EEF1A1 protein protein.      282   8e-76
BC018641-1|AAH18641.1|  462|Homo sapiens eukaryotic translation ...   282   8e-76
BC018150-1|AAH18150.1|  462|Homo sapiens eukaryotic translation ...   282   8e-76
BC014224-1|AAH14224.1|  462|Homo sapiens eukaryotic translation ...   282   8e-76
BC012891-1|AAH12891.1|  462|Homo sapiens eukaryotic translation ...   282   8e-76
BC010735-1|AAH10735.1|  462|Homo sapiens eukaryotic translation ...   282   8e-76
BC009875-1|AAH09875.1|  462|Homo sapiens eukaryotic translation ...   282   8e-76
BC009733-1|AAH09733.1|  462|Homo sapiens eukaryotic translation ...   282   8e-76
BC008587-1|AAH08587.1|  462|Homo sapiens eukaryotic translation ...   282   8e-76
AY043301-1|AAK95378.1|  462|Homo sapiens elongation factor 1-alp...   282   8e-76
AL603910-8|CAI14883.1|  462|Homo sapiens eukaryotic translation ...   282   8e-76
AL593851-4|CAH73620.1|  462|Homo sapiens eukaryotic translation ...   282   8e-76
AK223030-1|BAD96750.1|  462|Homo sapiens eukaryotic translation ...   282   8e-76
AK222982-1|BAD96702.1|  462|Homo sapiens eukaryotic translation ...   282   8e-76
AK222551-1|BAD96271.1|  462|Homo sapiens eukaryotic translation ...   282   8e-76
AK222523-1|BAD96243.1|  462|Homo sapiens eukaryotic translation ...   282   8e-76
AK222515-1|BAD96235.1|  462|Homo sapiens eukaryotic translation ...   282   8e-76
AF267861-1|AAG44730.1|  427|Homo sapiens EF1a-like protein protein.   282   8e-76
X70940-1|CAA50280.1|  463|Homo sapiens elongation factor 1 alpha...   279   7e-75
BC110409-1|AAI10410.1|  463|Homo sapiens eukaryotic translation ...   279   7e-75
BC000432-1|AAH00432.1|  463|Homo sapiens eukaryotic translation ...   279   7e-75
AL121829-9|CAC15522.1|  463|Homo sapiens EEF1A2 protein.              279   7e-75
AF163763-1|AAF80488.1|  463|Homo sapiens elongation factor 1 A-2...   279   7e-75
BC071727-1|AAH71727.1|  462|Homo sapiens eukaryotic translation ...   278   2e-74
AK223042-1|BAD96762.1|  433|Homo sapiens eukaryotic translation ...   237   3e-62
L10340-1|AAA91835.1|  435|Homo sapiens elongation factor-1 alpha...   236   5e-62
AL603910-9|CAI40951.1|  145|Homo sapiens eukaryotic translation ...   232   8e-61
BC071619-1|AAH71619.1|  441|Homo sapiens EEF1A1 protein protein.      225   1e-58
AF174496-1|AAF36537.1|  426|Homo sapiens glucocorticoid receptor...   205   1e-52
AB209064-1|BAD92301.1|  340|Homo sapiens eukaryotic translation ...   196   5e-50
U87791-1|AAD00645.1|  684|Homo sapiens eRFS protein.                  175   2e-43
BC040849-1|AAH40849.1|  684|Homo sapiens HBS1-like (S. cerevisia...   175   2e-43
BC001465-1|AAH01465.1|  684|Homo sapiens HBS1-like (S. cerevisia...   175   2e-43
AL445190-5|CAI95161.1|  684|Homo sapiens HBS1-like (S. cerevisia...   175   2e-43
AL353596-2|CAI17912.1|  684|Homo sapiens HBS1-like (S. cerevisia...   175   2e-43
AJ459826-1|CAD30873.1|  684|Homo sapiens HBS1-like protein protein.   175   2e-43
AB028961-1|BAA82990.1|  496|Homo sapiens KIAA1038 protein protein.    175   2e-43
AF397403-1|AAK93966.1|  398|Homo sapiens translation elongation ...   165   1e-40
L41498-1|AAC09386.1|  398|Homo sapiens longation factor 1-alpha ...   163   4e-40
L41490-1|AAC09385.1|  398|Homo sapiens eukaryotic translation el...   163   4e-40
AY062434-1|AAL38981.1|  398|Homo sapiens elongation factor 1-alp...   163   4e-40
X17644-1|CAA35635.1|  499|Homo sapiens protein ( Human GST1-Hs m...   163   7e-40
U95742-2|AAB67250.1|  499|Homo sapiens G1 to S phase transition ...   163   7e-40
BT006722-1|AAP35368.1|  498|Homo sapiens G1 to S phase transitio...   163   7e-40
BC009503-1|AAH09503.2|  633|Homo sapiens GSPT1 protein protein.       163   7e-40
AL929101-2|CAH71524.1|  628|Homo sapiens G1 to S phase transitio...   159   7e-39
AL603910-10|CAO03613.1|  107|Homo sapiens eukaryotic translation...   159   7e-39
AK023155-1|BAB14435.1|  504|Homo sapiens protein ( Homo sapiens ...   159   7e-39
AJ251548-1|CAB91089.1|  628|Homo sapiens polypeptide chain relea...   159   7e-39
BC036077-1|AAH36077.1|  628|Homo sapiens G1 to S phase transitio...   159   9e-39
AK001303-1|BAA91612.1|  628|Homo sapiens protein ( Homo sapiens ...   159   9e-39
AK222519-1|BAD96239.1|  366|Homo sapiens eukaryotic translation ...   149   1e-35
AF328730-1|AAN09722.1|  361|Homo sapiens CTCL tumor antigen HD-C...   138   2e-32
AF322220-1|AAN51932.1|  361|Homo sapiens cervical cancer suppres...   138   2e-32
X03689-1|CAA27325.1|   94|Homo sapiens protein ( Human mRNA frag...   132   2e-30
BC070131-1|AAH70131.1|  111|Homo sapiens EEF1A1 protein protein.      132   2e-30
M29548-1|AAA52367.1|  327|Homo sapiens EEF1A protein.                 115   2e-25
BC094687-1|AAH94687.1|  308|Homo sapiens EEF1A1 protein protein.      115   2e-25
BC063511-1|AAH63511.1|  290|Homo sapiens EEF1A1 protein protein.      115   2e-25
BC014377-1|AAH14377.1|  287|Homo sapiens Unknown (protein for IM...   113   8e-25
BC070500-1|AAH70500.1|   67|Homo sapiens EEF1A1 protein protein.       93   1e-18
AL445190-4|CAI95162.1|  453|Homo sapiens HBS1-like (S. cerevisia...    88   3e-17
AL353596-1|CAI17913.1|  453|Homo sapiens HBS1-like (S. cerevisia...    88   3e-17
X84694-1|CAA59169.1|  452|Homo sapiens mitochondrial elongation ...    78   4e-14
S75463-1|AAC60647.1|  452|Homo sapiens P43 protein.                    78   4e-14
L38995-1|AAB00499.1|  452|Homo sapiens elongation factor Tu prot...    78   4e-14
BC010041-1|AAH10041.2|  455|Homo sapiens Tu translation elongati...    78   4e-14
BC001633-1|AAH01633.2|  455|Homo sapiens Tu translation elongati...    78   4e-14
AK023282-1|BAB14507.1|  669|Homo sapiens protein ( Homo sapiens ...    46   2e-04
BC036768-1|AAH36768.1|  669|Homo sapiens GUF1 GTPase homolog (S....    44   7e-04
BC065761-1|AAH65761.1|  251|Homo sapiens EEF1A1 protein protein.       42   0.002
BC022412-1|AAH22412.1|  250|Homo sapiens Unknown (protein for IM...    42   0.002
BC049210-1|AAH49210.1|  751|Homo sapiens G elongation factor, mi...    42   0.003
AF367998-1|AAK53402.1|  751|Homo sapiens elongation factor G1 pr...    42   0.003
AF309777-1|AAK58877.1|  751|Homo sapiens elongation factor G pro...    42   0.003
L19161-1|AAA19696.1|  472|Homo sapiens translation initiation fa...    38   0.027
BC019906-1|AAH19906.1|  472|Homo sapiens eukaryotic translation ...    38   0.027
AK222577-1|BAD96297.1|  472|Homo sapiens eukaryotic translation ...    38   0.027
DQ120619-1|ABB92405.1|  471|Homo sapiens eFI-2-gamma protein.          38   0.036
BC087847-1|AAH87847.1|  465|Homo sapiens Unknown (protein for IM...    38   0.036
AJ006932-1|CAA07331.1|  248|Homo sapiens eIF-2gA protein.              38   0.036
BC014892-1|AAH14892.1|  248|Homo sapiens Unknown (protein for IM...    35   0.25 
Z11692-1|CAA77750.1|  858|Homo sapiens human  elongation factor ...    33   0.77 
X51466-1|CAA35829.1|  858|Homo sapiens elongation factor 2 protein.    33   0.77 
BC126259-1|AAI26260.1|  858|Homo sapiens EEF2 protein protein.         33   0.77 
BC006547-1|AAH06547.1|  583|Homo sapiens EEF2 protein protein.         33   0.77 
AY942181-1|AAX34409.1|  858|Homo sapiens elongation factor 2 pro...    33   0.77 
BC030612-1|AAH30612.1|  777|Homo sapiens G elongation factor, mi...    33   1.0  
BC015712-1|AAH15712.1|  779|Homo sapiens GFM2 protein protein.         33   1.0  
AY453587-1|AAS49035.1|  531|Homo sapiens elongation factor G iso...    33   1.0  
AK025314-1|BAB15109.1|  513|Homo sapiens protein ( Homo sapiens ...    33   1.0  
AF367997-1|AAK53401.1|  779|Homo sapiens elongation factor G2 pr...    33   1.0  
AF111808-1|AAL39010.1|  732|Homo sapiens MSTP027 protein.              33   1.0  
L34600-1|AAA67038.1|  727|Homo sapiens initiation factor 2 protein.    33   1.3  
BC064977-1|AAH64977.1|  465|Homo sapiens MTIF2 protein protein.        33   1.3  
BC039848-1|AAH39848.1|  500|Homo sapiens Similar to mitochondria...    33   1.3  
AF495546-1|AAM70196.1|  727|Homo sapiens translation initiation ...    33   1.3  
AF494407-1|AAM14617.1|  727|Homo sapiens mitochondrial translati...    33   1.3  
BC127820-1|AAI27821.1|  230|Homo sapiens FLJ10081 protein protein.     31   5.4  
BC063792-1|AAH63792.1|  878|Homo sapiens FLJ10081 protein protein.     31   5.4  
BC051763-1|AAH51763.1|  830|Homo sapiens FLJ10081 protein protein.     31   5.4  
AY050169-1|AAL13159.1|  791|Homo sapiens serum inhibited-related...    31   5.4  
AC079754-1|AAX88890.1|  791|Homo sapiens unknown protein.              31   5.4  
AB037731-1|BAA92548.1|  794|Homo sapiens KIAA1310 protein protein.     31   5.4  

>X16869-1|CAA34756.1|  462|Homo sapiens protein ( Human mRNA for
           elongation factor 1-alpha (clone CEF4). ).
          Length = 462

 Score =  283 bits (693), Expect = 6e-76
 Identities = 150/234 (64%), Positives = 162/234 (69%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGI
Sbjct: 68  ERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEDPHTSRRLATTQLL 549
           SKNGQTREHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KE     +++      
Sbjct: 128 SKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDT 187

Query: 550 SLSCPFLDGTETTCWSLQPKCLGSRDGRWSVRKAKLTENASLKLSMPSCHLPPT 711
               P           L+P         W V +     + +  L    C LPPT
Sbjct: 188 VAFVPISGWNGDN--MLEPSANMPWFKGWKVTRKDGNASGTTLLEAVDCILPPT 239


>AK223046-1|BAD96766.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 462

 Score =  283 bits (693), Expect = 6e-76
 Identities = 139/166 (83%), Positives = 144/166 (86%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGI
Sbjct: 68  ERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KE
Sbjct: 128 SKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIAKE 173



 Score =  115 bits (276), Expect = 2e-25
 Identities = 49/64 (76%), Positives = 54/64 (84%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD 
Sbjct: 175 STYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDC 234

Query: 690 ILPP 701
           ILPP
Sbjct: 235 ILPP 238


>X03558-1|CAA27245.1|  462|Homo sapiens protein ( Human mRNA for
           elongation factor 1 alpha subunit (EF-1 alpha). ).
          Length = 462

 Score =  282 bits (692), Expect = 8e-76
 Identities = 139/166 (83%), Positives = 144/166 (86%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGI
Sbjct: 68  ERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KE
Sbjct: 128 SKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKE 173



 Score =  115 bits (276), Expect = 2e-25
 Identities = 49/64 (76%), Positives = 54/64 (84%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD 
Sbjct: 175 STYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDC 234

Query: 690 ILPP 701
           ILPP
Sbjct: 235 ILPP 238


>J04617-1|AAA52343.1|  462|Homo sapiens EEF1A protein.
          Length = 462

 Score =  282 bits (692), Expect = 8e-76
 Identities = 139/166 (83%), Positives = 144/166 (86%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGI
Sbjct: 68  ERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KE
Sbjct: 128 SKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKE 173



 Score =  115 bits (276), Expect = 2e-25
 Identities = 49/64 (76%), Positives = 54/64 (84%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD 
Sbjct: 175 STYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDC 234

Query: 690 ILPP 701
           ILPP
Sbjct: 235 ILPP 238


>EF362804-1|ABO30531.1|  462|Homo sapiens EF1a protein.
          Length = 462

 Score =  282 bits (692), Expect = 8e-76
 Identities = 139/166 (83%), Positives = 144/166 (86%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGI
Sbjct: 68  ERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KE
Sbjct: 128 SKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKE 173



 Score =  115 bits (276), Expect = 2e-25
 Identities = 49/64 (76%), Positives = 54/64 (84%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD 
Sbjct: 175 STYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDC 234

Query: 690 ILPP 701
           ILPP
Sbjct: 235 ILPP 238


>BC111051-1|AAI11052.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  282 bits (692), Expect = 8e-76
 Identities = 139/166 (83%), Positives = 144/166 (86%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGI
Sbjct: 68  ERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KE
Sbjct: 128 SKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKE 173



 Score =  115 bits (276), Expect = 2e-25
 Identities = 49/64 (76%), Positives = 54/64 (84%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD 
Sbjct: 175 STYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDC 234

Query: 690 ILPP 701
           ILPP
Sbjct: 235 ILPP 238


>BC082268-1|AAH82268.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  282 bits (692), Expect = 8e-76
 Identities = 139/166 (83%), Positives = 144/166 (86%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGI
Sbjct: 68  ERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KE
Sbjct: 128 SKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKE 173



 Score =  115 bits (276), Expect = 2e-25
 Identities = 49/64 (76%), Positives = 54/64 (84%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD 
Sbjct: 175 STYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDC 234

Query: 690 ILPP 701
           ILPP
Sbjct: 235 ILPP 238


>BC072385-1|AAH72385.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  282 bits (692), Expect = 8e-76
 Identities = 139/166 (83%), Positives = 144/166 (86%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGI
Sbjct: 68  ERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KE
Sbjct: 128 SKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKE 173



 Score =  115 bits (276), Expect = 2e-25
 Identities = 49/64 (76%), Positives = 54/64 (84%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD 
Sbjct: 175 STYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDC 234

Query: 690 ILPP 701
           ILPP
Sbjct: 235 ILPP 238


>BC071841-1|AAH71841.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  282 bits (692), Expect = 8e-76
 Identities = 139/166 (83%), Positives = 144/166 (86%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGI
Sbjct: 68  ERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KE
Sbjct: 128 SKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKE 173



 Score =  115 bits (276), Expect = 2e-25
 Identities = 49/64 (76%), Positives = 54/64 (84%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD 
Sbjct: 175 STYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDC 234

Query: 690 ILPP 701
           ILPP
Sbjct: 235 ILPP 238


>BC071741-1|AAH71741.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  282 bits (692), Expect = 8e-76
 Identities = 139/166 (83%), Positives = 144/166 (86%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGI
Sbjct: 68  ERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KE
Sbjct: 128 SKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKE 173



 Score =  115 bits (276), Expect = 2e-25
 Identities = 49/64 (76%), Positives = 54/64 (84%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD 
Sbjct: 175 STYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDC 234

Query: 690 ILPP 701
           ILPP
Sbjct: 235 ILPP 238


>BC066893-1|AAH66893.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  282 bits (692), Expect = 8e-76
 Identities = 139/166 (83%), Positives = 144/166 (86%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGI
Sbjct: 68  ERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KE
Sbjct: 128 SKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKE 173



 Score =  115 bits (276), Expect = 2e-25
 Identities = 49/64 (76%), Positives = 54/64 (84%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD 
Sbjct: 175 STYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDC 234

Query: 690 ILPP 701
           ILPP
Sbjct: 235 ILPP 238


>BC057391-1|AAH57391.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  282 bits (692), Expect = 8e-76
 Identities = 139/166 (83%), Positives = 144/166 (86%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGI
Sbjct: 68  ERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KE
Sbjct: 128 SKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKE 173



 Score =  115 bits (276), Expect = 2e-25
 Identities = 49/64 (76%), Positives = 54/64 (84%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD 
Sbjct: 175 STYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDC 234

Query: 690 ILPP 701
           ILPP
Sbjct: 235 ILPP 238


>BC038339-1|AAH38339.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  282 bits (692), Expect = 8e-76
 Identities = 139/166 (83%), Positives = 144/166 (86%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGI
Sbjct: 68  ERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KE
Sbjct: 128 SKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKE 173



 Score =  115 bits (276), Expect = 2e-25
 Identities = 49/64 (76%), Positives = 54/64 (84%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD 
Sbjct: 175 STYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDC 234

Query: 690 ILPP 701
           ILPP
Sbjct: 235 ILPP 238


>BC028674-1|AAH28674.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  282 bits (692), Expect = 8e-76
 Identities = 139/166 (83%), Positives = 144/166 (86%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGI
Sbjct: 68  ERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KE
Sbjct: 128 SKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKE 173



 Score =  115 bits (276), Expect = 2e-25
 Identities = 49/64 (76%), Positives = 54/64 (84%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD 
Sbjct: 175 STYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDC 234

Query: 690 ILPP 701
           ILPP
Sbjct: 235 ILPP 238


>BC021686-1|AAH21686.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  282 bits (692), Expect = 8e-76
 Identities = 139/166 (83%), Positives = 144/166 (86%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGI
Sbjct: 68  ERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KE
Sbjct: 128 SKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKE 173



 Score =  115 bits (276), Expect = 2e-25
 Identities = 49/64 (76%), Positives = 54/64 (84%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD 
Sbjct: 175 STYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDC 234

Query: 690 ILPP 701
           ILPP
Sbjct: 235 ILPP 238


>BC019669-1|AAH19669.1|  462|Homo sapiens EEF1A1 protein protein.
          Length = 462

 Score =  282 bits (692), Expect = 8e-76
 Identities = 139/166 (83%), Positives = 144/166 (86%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGI
Sbjct: 68  ERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KE
Sbjct: 128 SKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKE 173



 Score =  115 bits (276), Expect = 2e-25
 Identities = 49/64 (76%), Positives = 54/64 (84%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD 
Sbjct: 175 STYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDC 234

Query: 690 ILPP 701
           ILPP
Sbjct: 235 ILPP 238


>BC018641-1|AAH18641.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  282 bits (692), Expect = 8e-76
 Identities = 139/166 (83%), Positives = 144/166 (86%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGI
Sbjct: 68  ERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KE
Sbjct: 128 SKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKE 173



 Score =  115 bits (276), Expect = 2e-25
 Identities = 49/64 (76%), Positives = 54/64 (84%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD 
Sbjct: 175 STYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDC 234

Query: 690 ILPP 701
           ILPP
Sbjct: 235 ILPP 238


>BC018150-1|AAH18150.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  282 bits (692), Expect = 8e-76
 Identities = 139/166 (83%), Positives = 144/166 (86%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGI
Sbjct: 68  ERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KE
Sbjct: 128 SKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKE 173



 Score =  115 bits (276), Expect = 2e-25
 Identities = 49/64 (76%), Positives = 54/64 (84%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD 
Sbjct: 175 STYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDC 234

Query: 690 ILPP 701
           ILPP
Sbjct: 235 ILPP 238


>BC014224-1|AAH14224.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  282 bits (692), Expect = 8e-76
 Identities = 139/166 (83%), Positives = 144/166 (86%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGI
Sbjct: 68  ERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KE
Sbjct: 128 SKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKE 173



 Score =  115 bits (276), Expect = 2e-25
 Identities = 49/64 (76%), Positives = 54/64 (84%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD 
Sbjct: 175 STYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDC 234

Query: 690 ILPP 701
           ILPP
Sbjct: 235 ILPP 238


>BC012891-1|AAH12891.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  282 bits (692), Expect = 8e-76
 Identities = 139/166 (83%), Positives = 144/166 (86%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGI
Sbjct: 68  ERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KE
Sbjct: 128 SKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKE 173



 Score =  115 bits (276), Expect = 2e-25
 Identities = 49/64 (76%), Positives = 54/64 (84%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD 
Sbjct: 175 STYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDC 234

Query: 690 ILPP 701
           ILPP
Sbjct: 235 ILPP 238


>BC010735-1|AAH10735.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  282 bits (692), Expect = 8e-76
 Identities = 139/166 (83%), Positives = 144/166 (86%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGI
Sbjct: 68  ERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KE
Sbjct: 128 SKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKE 173



 Score =  115 bits (276), Expect = 2e-25
 Identities = 49/64 (76%), Positives = 54/64 (84%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD 
Sbjct: 175 STYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDC 234

Query: 690 ILPP 701
           ILPP
Sbjct: 235 ILPP 238


>BC009875-1|AAH09875.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  282 bits (692), Expect = 8e-76
 Identities = 139/166 (83%), Positives = 144/166 (86%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGI
Sbjct: 68  ERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KE
Sbjct: 128 SKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKE 173



 Score =  115 bits (276), Expect = 2e-25
 Identities = 49/64 (76%), Positives = 54/64 (84%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD 
Sbjct: 175 STYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDC 234

Query: 690 ILPP 701
           ILPP
Sbjct: 235 ILPP 238


>BC009733-1|AAH09733.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  282 bits (692), Expect = 8e-76
 Identities = 139/166 (83%), Positives = 144/166 (86%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGI
Sbjct: 68  ERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KE
Sbjct: 128 SKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKE 173



 Score =  115 bits (276), Expect = 2e-25
 Identities = 49/64 (76%), Positives = 54/64 (84%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD 
Sbjct: 175 STYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDC 234

Query: 690 ILPP 701
           ILPP
Sbjct: 235 ILPP 238


>BC008587-1|AAH08587.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  282 bits (692), Expect = 8e-76
 Identities = 139/166 (83%), Positives = 144/166 (86%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGI
Sbjct: 68  ERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KE
Sbjct: 128 SKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKE 173



 Score =  115 bits (276), Expect = 2e-25
 Identities = 49/64 (76%), Positives = 54/64 (84%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD 
Sbjct: 175 STYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDC 234

Query: 690 ILPP 701
           ILPP
Sbjct: 235 ILPP 238


>AY043301-1|AAK95378.1|  462|Homo sapiens elongation factor 1-alpha
           protein.
          Length = 462

 Score =  282 bits (692), Expect = 8e-76
 Identities = 139/166 (83%), Positives = 144/166 (86%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGI
Sbjct: 68  ERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KE
Sbjct: 128 SKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKE 173



 Score =  115 bits (276), Expect = 2e-25
 Identities = 49/64 (76%), Positives = 54/64 (84%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD 
Sbjct: 175 STYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDC 234

Query: 690 ILPP 701
           ILPP
Sbjct: 235 ILPP 238


>AL603910-8|CAI14883.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  282 bits (692), Expect = 8e-76
 Identities = 139/166 (83%), Positives = 144/166 (86%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGI
Sbjct: 68  ERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KE
Sbjct: 128 SKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKE 173



 Score =  115 bits (276), Expect = 2e-25
 Identities = 49/64 (76%), Positives = 54/64 (84%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD 
Sbjct: 175 STYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDC 234

Query: 690 ILPP 701
           ILPP
Sbjct: 235 ILPP 238


>AL593851-4|CAH73620.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha-like 3 protein.
          Length = 462

 Score =  282 bits (692), Expect = 8e-76
 Identities = 139/166 (83%), Positives = 144/166 (86%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGI
Sbjct: 68  ERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KE
Sbjct: 128 SKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKE 173



 Score =  115 bits (276), Expect = 2e-25
 Identities = 49/64 (76%), Positives = 54/64 (84%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD 
Sbjct: 175 STYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDC 234

Query: 690 ILPP 701
           ILPP
Sbjct: 235 ILPP 238


>AK223030-1|BAD96750.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 462

 Score =  282 bits (692), Expect = 8e-76
 Identities = 139/166 (83%), Positives = 144/166 (86%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGI
Sbjct: 68  ERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KE
Sbjct: 128 SKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKE 173



 Score =  115 bits (276), Expect = 2e-25
 Identities = 49/64 (76%), Positives = 54/64 (84%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD 
Sbjct: 175 STYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDC 234

Query: 690 ILPP 701
           ILPP
Sbjct: 235 ILPP 238


>AK222982-1|BAD96702.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 462

 Score =  282 bits (692), Expect = 8e-76
 Identities = 139/166 (83%), Positives = 144/166 (86%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGI
Sbjct: 68  ERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KE
Sbjct: 128 SKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKE 173



 Score =  115 bits (276), Expect = 2e-25
 Identities = 49/64 (76%), Positives = 54/64 (84%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD 
Sbjct: 175 SAYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDC 234

Query: 690 ILPP 701
           ILPP
Sbjct: 235 ILPP 238


>AK222551-1|BAD96271.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 462

 Score =  282 bits (692), Expect = 8e-76
 Identities = 139/166 (83%), Positives = 144/166 (86%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGI
Sbjct: 68  ERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KE
Sbjct: 128 SKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKE 173



 Score =  115 bits (277), Expect = 1e-25
 Identities = 49/64 (76%), Positives = 54/64 (84%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD 
Sbjct: 175 STYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWEVTRKDGNASGTTLLEALDC 234

Query: 690 ILPP 701
           ILPP
Sbjct: 235 ILPP 238


>AK222523-1|BAD96243.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 462

 Score =  282 bits (692), Expect = 8e-76
 Identities = 139/166 (83%), Positives = 144/166 (86%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGI
Sbjct: 68  ERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KE
Sbjct: 128 SKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKE 173



 Score =  115 bits (276), Expect = 2e-25
 Identities = 49/64 (76%), Positives = 54/64 (84%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD 
Sbjct: 175 STYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDC 234

Query: 690 ILPP 701
           ILPP
Sbjct: 235 ILPP 238


>AK222515-1|BAD96235.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 462

 Score =  282 bits (692), Expect = 8e-76
 Identities = 139/166 (83%), Positives = 144/166 (86%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGI
Sbjct: 68  ERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KE
Sbjct: 128 SKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKE 173



 Score =  115 bits (276), Expect = 2e-25
 Identities = 49/64 (76%), Positives = 54/64 (84%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD 
Sbjct: 175 STYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDC 234

Query: 690 ILPP 701
           ILPP
Sbjct: 235 ILPP 238


>AF267861-1|AAG44730.1|  427|Homo sapiens EF1a-like protein protein.
          Length = 427

 Score =  282 bits (692), Expect = 8e-76
 Identities = 139/166 (83%), Positives = 144/166 (86%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGI
Sbjct: 68  ERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KE
Sbjct: 128 SKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKE 173



 Score =  115 bits (276), Expect = 2e-25
 Identities = 49/64 (76%), Positives = 54/64 (84%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD 
Sbjct: 175 STYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDC 234

Query: 690 ILPP 701
           ILPP
Sbjct: 235 ILPP 238


>X70940-1|CAA50280.1|  463|Homo sapiens elongation factor 1 alpha-2
           protein.
          Length = 463

 Score =  279 bits (684), Expect = 7e-75
 Identities = 138/166 (83%), Positives = 143/166 (86%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGI
Sbjct: 68  ERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLA+TLGVKQLIVGVNKMDSTEP YSE R++EI KE
Sbjct: 128 SKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKE 173



 Score =  121 bits (291), Expect = 3e-27
 Identities = 52/64 (81%), Positives = 55/64 (85%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNPA V FVPISGWHGDNMLEPS  MPWFKGW+VERKEG A G  L+EALD 
Sbjct: 175 SAYIKKIGYNPATVPFVPISGWHGDNMLEPSPNMPWFKGWKVERKEGNASGVSLLEALDT 234

Query: 690 ILPP 701
           ILPP
Sbjct: 235 ILPP 238


>BC110409-1|AAI10410.1|  463|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 2 protein.
          Length = 463

 Score =  279 bits (684), Expect = 7e-75
 Identities = 138/166 (83%), Positives = 143/166 (86%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGI
Sbjct: 68  ERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLA+TLGVKQLIVGVNKMDSTEP YSE R++EI KE
Sbjct: 128 SKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKE 173



 Score =  121 bits (291), Expect = 3e-27
 Identities = 52/64 (81%), Positives = 55/64 (85%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNPA V FVPISGWHGDNMLEPS  MPWFKGW+VERKEG A G  L+EALD 
Sbjct: 175 SAYIKKIGYNPATVPFVPISGWHGDNMLEPSPNMPWFKGWKVERKEGNASGVSLLEALDT 234

Query: 690 ILPP 701
           ILPP
Sbjct: 235 ILPP 238


>BC000432-1|AAH00432.1|  463|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 2 protein.
          Length = 463

 Score =  279 bits (684), Expect = 7e-75
 Identities = 138/166 (83%), Positives = 143/166 (86%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGI
Sbjct: 68  ERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLA+TLGVKQLIVGVNKMDSTEP YSE R++EI KE
Sbjct: 128 SKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKE 173



 Score =  121 bits (291), Expect = 3e-27
 Identities = 52/64 (81%), Positives = 55/64 (85%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNPA V FVPISGWHGDNMLEPS  MPWFKGW+VERKEG A G  L+EALD 
Sbjct: 175 SAYIKKIGYNPATVPFVPISGWHGDNMLEPSPNMPWFKGWKVERKEGNASGVSLLEALDT 234

Query: 690 ILPP 701
           ILPP
Sbjct: 235 ILPP 238


>AL121829-9|CAC15522.1|  463|Homo sapiens EEF1A2 protein.
          Length = 463

 Score =  279 bits (684), Expect = 7e-75
 Identities = 138/166 (83%), Positives = 143/166 (86%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGI
Sbjct: 68  ERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLA+TLGVKQLIVGVNKMDSTEP YSE R++EI KE
Sbjct: 128 SKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKE 173



 Score =  121 bits (291), Expect = 3e-27
 Identities = 52/64 (81%), Positives = 55/64 (85%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNPA V FVPISGWHGDNMLEPS  MPWFKGW+VERKEG A G  L+EALD 
Sbjct: 175 SAYIKKIGYNPATVPFVPISGWHGDNMLEPSPNMPWFKGWKVERKEGNASGVSLLEALDT 234

Query: 690 ILPP 701
           ILPP
Sbjct: 235 ILPP 238


>AF163763-1|AAF80488.1|  463|Homo sapiens elongation factor 1 A-2
           protein.
          Length = 463

 Score =  279 bits (684), Expect = 7e-75
 Identities = 138/166 (83%), Positives = 143/166 (86%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGI
Sbjct: 68  ERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLA+TLGVKQLIVGVNKMDSTEP YSE R++EI KE
Sbjct: 128 SKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKE 173



 Score =  121 bits (291), Expect = 3e-27
 Identities = 52/64 (81%), Positives = 55/64 (85%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNPA V FVPISGWHGDNMLEPS  MPWFKGW+VERKEG A G  L+EALD 
Sbjct: 175 SAYIKKIGYNPATVPFVPISGWHGDNMLEPSPNMPWFKGWKVERKEGNASGVSLLEALDT 234

Query: 690 ILPP 701
           ILPP
Sbjct: 235 ILPP 238


>BC071727-1|AAH71727.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  278 bits (681), Expect = 2e-74
 Identities = 138/166 (83%), Positives = 143/166 (86%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYK GGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKFGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGI
Sbjct: 68  ERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           SKNGQTREHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KE
Sbjct: 128 SKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKE 173



 Score =  115 bits (276), Expect = 2e-25
 Identities = 49/64 (76%), Positives = 54/64 (84%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD 
Sbjct: 175 STYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDC 234

Query: 690 ILPP 701
           ILPP
Sbjct: 235 ILPP 238


>AK223042-1|BAD96762.1|  433|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 433

 Score =  237 bits (580), Expect = 3e-62
 Identities = 117/144 (81%), Positives = 122/144 (84%)
 Frame = +1

Query: 76  KCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERRYHNRYCSLEVRN*QVLCYH 255
           KCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAERER         +    +     
Sbjct: 1   KCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTT 60

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLI
Sbjct: 61  IDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLI 120

Query: 436 VGVNKMDSTEPPYSEPRFEEIKKE 507
           VGVNKMDSTEPPYS+ R+EEI KE
Sbjct: 121 VGVNKMDSTEPPYSQKRYEEIVKE 144



 Score =  115 bits (276), Expect = 2e-25
 Identities = 49/64 (76%), Positives = 54/64 (84%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD 
Sbjct: 146 STYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDC 205

Query: 690 ILPP 701
           ILPP
Sbjct: 206 ILPP 209


>L10340-1|AAA91835.1|  435|Homo sapiens elongation factor-1 alpha
           protein.
          Length = 435

 Score =  236 bits (578), Expect = 5e-62
 Identities = 117/145 (80%), Positives = 122/145 (84%)
 Frame = +1

Query: 73  YKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERRYHNRYCSLEVRN*QVLCY 252
           YKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAERER         +    +    
Sbjct: 1   YKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETTKYYIT 60

Query: 253 HIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 432
            IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQL
Sbjct: 61  IIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQL 120

Query: 433 IVGVNKMDSTEPPYSEPRFEEIKKE 507
           IVGVNKMDSTEP YSE R++EI KE
Sbjct: 121 IVGVNKMDSTEPAYSEKRYDEIVKE 145



 Score =  121 bits (291), Expect = 3e-27
 Identities = 52/64 (81%), Positives = 55/64 (85%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNPA V FVPISGWHGDNMLEPS  MPWFKGW+VERKEG A G  L+EALD 
Sbjct: 147 SAYIKKIGYNPATVPFVPISGWHGDNMLEPSPNMPWFKGWKVERKEGNASGVSLLEALDT 206

Query: 690 ILPP 701
           ILPP
Sbjct: 207 ILPP 210


>AL603910-9|CAI40951.1|  145|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 145

 Score =  232 bits (568), Expect = 8e-61
 Identities = 115/138 (83%), Positives = 118/138 (85%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGI
Sbjct: 68  ERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGI 127

Query: 370 SKNGQTREHALLAFTLGV 423
           SKNGQTREHALLA+TLGV
Sbjct: 128 SKNGQTREHALLAYTLGV 145


>BC071619-1|AAH71619.1|  441|Homo sapiens EEF1A1 protein protein.
          Length = 441

 Score =  225 bits (550), Expect = 1e-58
 Identities = 111/135 (82%), Positives = 115/135 (85%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +    +     IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGI
Sbjct: 68  ERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGI 127

Query: 370 SKNGQTREHALLAFT 414
           SKNGQTREHALLA++
Sbjct: 128 SKNGQTREHALLAYS 142



 Score =  115 bits (276), Expect = 2e-25
 Identities = 49/64 (76%), Positives = 54/64 (84%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD 
Sbjct: 154 STYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDC 213

Query: 690 ILPP 701
           ILPP
Sbjct: 214 ILPP 217


>AF174496-1|AAF36537.1|  426|Homo sapiens glucocorticoid receptor
           AF-1 specific elongation factor protein.
          Length = 426

 Score =  205 bits (500), Expect = 1e-52
 Identities = 103/133 (77%), Positives = 108/133 (81%)
 Frame = +1

Query: 109 KFEKEAQEMGKGSFKYAWVLDKLKAERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIK 288
           KFEKEA EMGKGSFKYAWV DKLKAERER         +    +     IDAPGHRDFIK
Sbjct: 5   KFEKEAAEMGKGSFKYAWVWDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIK 64

Query: 289 NMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEP 468
           NMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVGVNK  STEP
Sbjct: 65  NMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKSHSTEP 124

Query: 469 PYSEPRFEEIKKE 507
           PYS+ R+EEI KE
Sbjct: 125 PYSQKRYEEIVKE 137



 Score =  113 bits (272), Expect = 6e-25
 Identities = 48/63 (76%), Positives = 53/63 (84%)
 Frame = +3

Query: 513 SYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAI 692
           +YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD I
Sbjct: 140 TYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCI 199

Query: 693 LPP 701
           LPP
Sbjct: 200 LPP 202


>AB209064-1|BAD92301.1|  340|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 2 variant protein.
          Length = 340

 Score =  196 bits (479), Expect = 5e-50
 Identities = 98/126 (77%), Positives = 104/126 (82%)
 Frame = +1

Query: 130 EMGKGSFKYAWVLDKLKAERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTS 309
           +MGKGSFKYAWVLDKLKAERER         +    +     IDAPGHRDFIKNMITGTS
Sbjct: 24  QMGKGSFKYAWVLDKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTS 83

Query: 310 QADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRF 489
           QADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVGVNKMDSTEP YSE R+
Sbjct: 84  QADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRY 143

Query: 490 EEIKKE 507
           +EI KE
Sbjct: 144 DEIVKE 149



 Score =  121 bits (291), Expect = 3e-27
 Identities = 52/64 (81%), Positives = 55/64 (85%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNPA V FVPISGWHGDNMLEPS  MPWFKGW+VERKEG A G  L+EALD 
Sbjct: 151 SAYIKKIGYNPATVPFVPISGWHGDNMLEPSPNMPWFKGWKVERKEGNASGVSLLEALDT 210

Query: 690 ILPP 701
           ILPP
Sbjct: 211 ILPP 214


>U87791-1|AAD00645.1|  684|Homo sapiens eRFS protein.
          Length = 684

 Score =  175 bits (425), Expect = 2e-43
 Identities = 87/163 (53%), Positives = 110/163 (67%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++ GK SF YAWVLD+   ER
Sbjct: 261 LNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETGEER 320

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +      +   +DAPGH+DFI NMITG +QAD AVL+V A  GEFEAG 
Sbjct: 321 ERGVTMDVGMTKFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFEAGF 380

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEI 498
              GQTREH LL  +LGV QL V VNKMD     + + RF+EI
Sbjct: 381 ETGGQTREHGLLVRSLGVTQLAVAVNKMDQVN--WQQERFQEI 421



 Score = 35.5 bits (78), Expect = 0.19
 Identities = 18/62 (29%), Positives = 32/62 (51%)
 Frame = +3

Query: 516 YIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAIL 695
           ++K+ G+  + V F+P SG  G+N++  S      K ++         G CL+E +D+  
Sbjct: 428 FLKQAGFKESDVGFIPTSGLSGENLITRSQSSELTKWYK---------GLCLLEQIDSFK 478

Query: 696 PP 701
           PP
Sbjct: 479 PP 480


>BC040849-1|AAH40849.1|  684|Homo sapiens HBS1-like (S. cerevisiae)
           protein.
          Length = 684

 Score =  175 bits (425), Expect = 2e-43
 Identities = 87/163 (53%), Positives = 110/163 (67%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++ GK SF YAWVLD+   ER
Sbjct: 261 LNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETGEER 320

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +      +   +DAPGH+DFI NMITG +QAD AVL+V A  GEFEAG 
Sbjct: 321 ERGVTMDVGMTKFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFEAGF 380

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEI 498
              GQTREH LL  +LGV QL V VNKMD     + + RF+EI
Sbjct: 381 ETGGQTREHGLLVRSLGVTQLAVAVNKMDQVN--WQQERFQEI 421



 Score = 35.5 bits (78), Expect = 0.19
 Identities = 18/62 (29%), Positives = 32/62 (51%)
 Frame = +3

Query: 516 YIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAIL 695
           ++K+ G+  + V F+P SG  G+N++  S      K ++         G CL+E +D+  
Sbjct: 428 FLKQAGFKESDVGFIPTSGLSGENLITRSQSSELTKWYK---------GLCLLEQIDSFK 478

Query: 696 PP 701
           PP
Sbjct: 479 PP 480


>BC001465-1|AAH01465.1|  684|Homo sapiens HBS1-like (S. cerevisiae)
           protein.
          Length = 684

 Score =  175 bits (425), Expect = 2e-43
 Identities = 87/163 (53%), Positives = 110/163 (67%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++ GK SF YAWVLD+   ER
Sbjct: 261 LNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETGEER 320

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +      +   +DAPGH+DFI NMITG +QAD AVL+V A  GEFEAG 
Sbjct: 321 ERGVTMDVGMTKFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFEAGF 380

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEI 498
              GQTREH LL  +LGV QL V VNKMD     + + RF+EI
Sbjct: 381 ETGGQTREHGLLVRSLGVTQLAVAVNKMDQVN--WQQERFQEI 421



 Score = 35.5 bits (78), Expect = 0.19
 Identities = 18/62 (29%), Positives = 32/62 (51%)
 Frame = +3

Query: 516 YIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAIL 695
           ++K+ G+  + V F+P SG  G+N++  S      K ++         G CL+E +D+  
Sbjct: 428 FLKQAGFKESDVGFIPTSGLSGENLITRSQSSELTKWYK---------GLCLLEQIDSFK 478

Query: 696 PP 701
           PP
Sbjct: 479 PP 480


>AL445190-5|CAI95161.1|  684|Homo sapiens HBS1-like (S. cerevisiae)
           protein.
          Length = 684

 Score =  175 bits (425), Expect = 2e-43
 Identities = 87/163 (53%), Positives = 110/163 (67%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++ GK SF YAWVLD+   ER
Sbjct: 261 LNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETGEER 320

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +      +   +DAPGH+DFI NMITG +QAD AVL+V A  GEFEAG 
Sbjct: 321 ERGVTMDVGMTKFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFEAGF 380

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEI 498
              GQTREH LL  +LGV QL V VNKMD     + + RF+EI
Sbjct: 381 ETGGQTREHGLLVRSLGVTQLAVAVNKMDQVN--WQQERFQEI 421



 Score = 35.5 bits (78), Expect = 0.19
 Identities = 18/62 (29%), Positives = 32/62 (51%)
 Frame = +3

Query: 516 YIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAIL 695
           ++K+ G+  + V F+P SG  G+N++  S      K ++         G CL+E +D+  
Sbjct: 428 FLKQAGFKESDVGFIPTSGLSGENLITRSQSSELTKWYK---------GLCLLEQIDSFK 478

Query: 696 PP 701
           PP
Sbjct: 479 PP 480


>AL353596-2|CAI17912.1|  684|Homo sapiens HBS1-like (S. cerevisiae)
           protein.
          Length = 684

 Score =  175 bits (425), Expect = 2e-43
 Identities = 87/163 (53%), Positives = 110/163 (67%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++ GK SF YAWVLD+   ER
Sbjct: 261 LNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETGEER 320

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +      +   +DAPGH+DFI NMITG +QAD AVL+V A  GEFEAG 
Sbjct: 321 ERGVTMDVGMTKFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFEAGF 380

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEI 498
              GQTREH LL  +LGV QL V VNKMD     + + RF+EI
Sbjct: 381 ETGGQTREHGLLVRSLGVTQLAVAVNKMDQVN--WQQERFQEI 421



 Score = 35.5 bits (78), Expect = 0.19
 Identities = 18/62 (29%), Positives = 32/62 (51%)
 Frame = +3

Query: 516 YIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAIL 695
           ++K+ G+  + V F+P SG  G+N++  S      K ++         G CL+E +D+  
Sbjct: 428 FLKQAGFKESDVGFIPTSGLSGENLITRSQSSELTKWYK---------GLCLLEQIDSFK 478

Query: 696 PP 701
           PP
Sbjct: 479 PP 480


>AJ459826-1|CAD30873.1|  684|Homo sapiens HBS1-like protein protein.
          Length = 684

 Score =  175 bits (425), Expect = 2e-43
 Identities = 87/163 (53%), Positives = 110/163 (67%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++ GK SF YAWVLD+   ER
Sbjct: 261 LNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETGEER 320

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +      +   +DAPGH+DFI NMITG +QAD AVL+V A  GEFEAG 
Sbjct: 321 ERGVTMDVGMTKFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFEAGF 380

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEI 498
              GQTREH LL  +LGV QL V VNKMD     + + RF+EI
Sbjct: 381 ETGGQTREHGLLVRSLGVTQLAVAVNKMDQVN--WQQERFQEI 421



 Score = 35.5 bits (78), Expect = 0.19
 Identities = 18/62 (29%), Positives = 32/62 (51%)
 Frame = +3

Query: 516 YIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAIL 695
           ++K+ G+  + V F+P SG  G+N++  S      K ++         G CL+E +D+  
Sbjct: 428 FLKQAGFKESDVGFIPTSGLSGENLITRSQSSELTKWYK---------GLCLLEQIDSFK 478

Query: 696 PP 701
           PP
Sbjct: 479 PP 480


>AB028961-1|BAA82990.1|  496|Homo sapiens KIAA1038 protein protein.
          Length = 496

 Score =  175 bits (425), Expect = 2e-43
 Identities = 87/163 (53%), Positives = 110/163 (67%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++ GK SF YAWVLD+   ER
Sbjct: 73  LNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETGEER 132

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           ER         +      +   +DAPGH+DFI NMITG +QAD AVL+V A  GEFEAG 
Sbjct: 133 ERGVTMDVGMTKFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFEAGF 192

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEI 498
              GQTREH LL  +LGV QL V VNKMD     + + RF+EI
Sbjct: 193 ETGGQTREHGLLVRSLGVTQLAVAVNKMDQVN--WQQERFQEI 233



 Score = 35.5 bits (78), Expect = 0.19
 Identities = 18/62 (29%), Positives = 32/62 (51%)
 Frame = +3

Query: 516 YIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAIL 695
           ++K+ G+  + V F+P SG  G+N++  S      K ++         G CL+E +D+  
Sbjct: 240 FLKQAGFKESDVGFIPTSGLSGENLITRSQSSELTKWYK---------GLCLLEQIDSFK 290

Query: 696 PP 701
           PP
Sbjct: 291 PP 292


>AF397403-1|AAK93966.1|  398|Homo sapiens translation elongation
           factor 1 alpha 1-like 14 protein.
          Length = 398

 Score =  165 bits (401), Expect = 1e-40
 Identities = 78/84 (92%), Positives = 81/84 (96%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLI
Sbjct: 26  IDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLI 85

Query: 436 VGVNKMDSTEPPYSEPRFEEIKKE 507
           VGVNKMDSTEPPYS+ R+EEI KE
Sbjct: 86  VGVNKMDSTEPPYSQKRYEEIVKE 109



 Score =  115 bits (276), Expect = 2e-25
 Identities = 49/64 (76%), Positives = 54/64 (84%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD 
Sbjct: 111 STYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDC 170

Query: 690 ILPP 701
           ILPP
Sbjct: 171 ILPP 174



 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 18/21 (85%), Positives = 20/21 (95%)
 Frame = +2

Query: 197 GITIDIALWKFETSKYYVTTL 259
           GITIDI+LWKFETSKYYVT +
Sbjct: 6   GITIDISLWKFETSKYYVTII 26


>L41498-1|AAC09386.1|  398|Homo sapiens longation factor 1-alpha 1
           protein.
          Length = 398

 Score =  163 bits (397), Expect = 4e-40
 Identities = 77/84 (91%), Positives = 81/84 (96%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           IDAPGHRDFI+NMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLI
Sbjct: 26  IDAPGHRDFIQNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLI 85

Query: 436 VGVNKMDSTEPPYSEPRFEEIKKE 507
           VGVNKMDSTEPPYS+ R+EEI KE
Sbjct: 86  VGVNKMDSTEPPYSQKRYEEIVKE 109



 Score =  115 bits (276), Expect = 2e-25
 Identities = 49/64 (76%), Positives = 54/64 (84%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD 
Sbjct: 111 STYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDC 170

Query: 690 ILPP 701
           ILPP
Sbjct: 171 ILPP 174



 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 18/21 (85%), Positives = 20/21 (95%)
 Frame = +2

Query: 197 GITIDIALWKFETSKYYVTTL 259
           GITIDI+LWKFETSKYYVT +
Sbjct: 6   GITIDISLWKFETSKYYVTII 26


>L41490-1|AAC09385.1|  398|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1-like 14 protein.
          Length = 398

 Score =  163 bits (397), Expect = 4e-40
 Identities = 77/84 (91%), Positives = 81/84 (96%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           IDAPGHRDFI+NMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLI
Sbjct: 26  IDAPGHRDFIQNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLI 85

Query: 436 VGVNKMDSTEPPYSEPRFEEIKKE 507
           VGVNKMDSTEPPYS+ R+EEI KE
Sbjct: 86  VGVNKMDSTEPPYSQKRYEEIVKE 109



 Score =  115 bits (276), Expect = 2e-25
 Identities = 49/64 (76%), Positives = 54/64 (84%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD 
Sbjct: 111 STYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDC 170

Query: 690 ILPP 701
           ILPP
Sbjct: 171 ILPP 174



 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 18/21 (85%), Positives = 20/21 (95%)
 Frame = +2

Query: 197 GITIDIALWKFETSKYYVTTL 259
           GITIDI+LWKFETSKYYVT +
Sbjct: 6   GITIDISLWKFETSKYYVTII 26


>AY062434-1|AAL38981.1|  398|Homo sapiens elongation factor 1-alpha
           1 protein.
          Length = 398

 Score =  163 bits (397), Expect = 4e-40
 Identities = 77/84 (91%), Positives = 81/84 (96%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           IDAPGHRDFI+NMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLI
Sbjct: 26  IDAPGHRDFIQNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLI 85

Query: 436 VGVNKMDSTEPPYSEPRFEEIKKE 507
           VGVNKMDSTEPPYS+ R+EEI KE
Sbjct: 86  VGVNKMDSTEPPYSQKRYEEIVKE 109



 Score =  115 bits (276), Expect = 2e-25
 Identities = 49/64 (76%), Positives = 54/64 (84%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD 
Sbjct: 111 STYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDC 170

Query: 690 ILPP 701
           ILPP
Sbjct: 171 ILPP 174



 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 18/21 (85%), Positives = 20/21 (95%)
 Frame = +2

Query: 197 GITIDIALWKFETSKYYVTTL 259
           GITIDI+LWKFETSKYYVT +
Sbjct: 6   GITIDISLWKFETSKYYVTII 26


>X17644-1|CAA35635.1|  499|Homo sapiens protein ( Human GST1-Hs mRNA
           for GTP-binding protein. ).
          Length = 499

 Score =  163 bits (395), Expect = 7e-40
 Identities = 81/173 (46%), Positives = 113/173 (65%), Gaps = 4/173 (2%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           +  +N+V IGHVD+GKST  G ++Y  G +DKRT+EK+E+EA+E  + ++  +W LD  +
Sbjct: 72  KEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYEREAKEKNRETWYLSWALDTNQ 131

Query: 181 AERER----RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 348
            ER++         Y   E ++  +L    DAPGH+ F+ NMI G SQAD AVL+++A  
Sbjct: 132 EERDKGKTVEVGRAYFETEKKHFTIL----DAPGHKSFVPNMIGGASQADLAVLVISARK 187

Query: 349 GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           GEFE G  K GQTREHA+LA T GVK LIV +NKMD     +S  R+EE K++
Sbjct: 188 GEFETGFEKGGQTREHAMLAKTAGVKHLIVLINKMDDPTVNWSNERYEECKEK 240



 Score = 37.9 bits (84), Expect = 0.036
 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 1/38 (2%)
 Frame = +3

Query: 516 YIKKIGYNPAA-VAFVPISGWHGDNMLEPSTKMPWFKG 626
           ++KK+G+NP   + F+P SG  G N+ E S   PW+ G
Sbjct: 244 FLKKVGFNPKKDIHFMPCSGLTGANLKEQSDFCPWYIG 281


>U95742-2|AAB67250.1|  499|Homo sapiens G1 to S phase transition
           protein protein.
          Length = 499

 Score =  163 bits (395), Expect = 7e-40
 Identities = 81/173 (46%), Positives = 113/173 (65%), Gaps = 4/173 (2%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           +  +N+V IGHVD+GKST  G ++Y  G +DKRT+EK+E+EA+E  + ++  +W LD  +
Sbjct: 72  KEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYEREAKEKNRETWYLSWALDTNQ 131

Query: 181 AERER----RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 348
            ER++         Y   E ++  +L    DAPGH+ F+ NMI G SQAD AVL+++A  
Sbjct: 132 EERDKGKTVEVGRAYFETEKKHFTIL----DAPGHKSFVPNMIGGASQADLAVLVISARK 187

Query: 349 GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           GEFE G  K GQTREHA+LA T GVK LIV +NKMD     +S  R+EE K++
Sbjct: 188 GEFETGFEKGGQTREHAMLAKTAGVKHLIVLINKMDDPTVNWSNERYEECKEK 240



 Score = 37.9 bits (84), Expect = 0.036
 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 1/38 (2%)
 Frame = +3

Query: 516 YIKKIGYNPAA-VAFVPISGWHGDNMLEPSTKMPWFKG 626
           ++KK+G+NP   + F+P SG  G N+ E S   PW+ G
Sbjct: 244 FLKKVGFNPKKDIHFMPCSGLTGANLKEQSDFCPWYIG 281


>BT006722-1|AAP35368.1|  498|Homo sapiens G1 to S phase transition 1
           protein.
          Length = 498

 Score =  163 bits (395), Expect = 7e-40
 Identities = 81/173 (46%), Positives = 113/173 (65%), Gaps = 4/173 (2%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           +  +N+V IGHVD+GKST  G ++Y  G +DKRT+EK+E+EA+E  + ++  +W LD  +
Sbjct: 71  KEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYEREAKEKNRETWYLSWALDTNQ 130

Query: 181 AERER----RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 348
            ER++         Y   E ++  +L    DAPGH+ F+ NMI G SQAD AVL+++A  
Sbjct: 131 EERDKGKTVEVGRAYFETEKKHFTIL----DAPGHKSFVPNMIGGASQADLAVLVISARK 186

Query: 349 GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           GEFE G  K GQTREHA+LA T GVK LIV +NKMD     +S  R+EE K++
Sbjct: 187 GEFETGFEKGGQTREHAMLAKTAGVKHLIVLINKMDDPTVNWSNERYEECKEK 239



 Score = 37.9 bits (84), Expect = 0.036
 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 1/38 (2%)
 Frame = +3

Query: 516 YIKKIGYNPAA-VAFVPISGWHGDNMLEPSTKMPWFKG 626
           ++KK+G+NP   + F+P SG  G N+ E S   PW+ G
Sbjct: 243 FLKKVGFNPKKDIHFMPCSGLTGANLKEQSDFCPWYIG 280


>BC009503-1|AAH09503.2|  633|Homo sapiens GSPT1 protein protein.
          Length = 633

 Score =  163 bits (395), Expect = 7e-40
 Identities = 81/173 (46%), Positives = 113/173 (65%), Gaps = 4/173 (2%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           +  +N+V IGHVD+GKST  G ++Y  G +DKRT+EK+E+EA+E  + ++  +W LD  +
Sbjct: 206 KEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYEREAKEKNRETWYLSWALDTNQ 265

Query: 181 AERER----RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 348
            ER++         Y   E ++  +L    DAPGH+ F+ NMI G SQAD AVL+++A  
Sbjct: 266 EERDKGKTVEVGRAYFETEKKHFTIL----DAPGHKSFVPNMIGGASQADLAVLVISARK 321

Query: 349 GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           GEFE G  K GQTREHA+LA T GVK LIV +NKMD     +S  R+EE K++
Sbjct: 322 GEFETGFEKGGQTREHAMLAKTAGVKHLIVLINKMDDPTVNWSNERYEECKEK 374



 Score = 37.9 bits (84), Expect = 0.036
 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 1/38 (2%)
 Frame = +3

Query: 516 YIKKIGYNPAA-VAFVPISGWHGDNMLEPSTKMPWFKG 626
           ++KK+G+NP   + F+P SG  G N+ E S   PW+ G
Sbjct: 378 FLKKVGFNPKKDIHFMPCSGLTGANLKEQSDFCPWYIG 415


>AL929101-2|CAH71524.1|  628|Homo sapiens G1 to S phase transition 2
           protein.
          Length = 628

 Score =  159 bits (387), Expect = 7e-39
 Identities = 80/173 (46%), Positives = 113/173 (65%), Gaps = 4/173 (2%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           +  +N+V IGHVD+GKST  G +++  G +DKRT+EK+E+EA+E  + ++  +W LD  +
Sbjct: 201 KEHVNVVFIGHVDAGKSTIGGQIMFLTGMVDKRTLEKYEREAKEKNRETWYLSWALDTNQ 260

Query: 181 AERER----RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 348
            ER++         Y   E ++  +L    DAPGH+ F+ NMI G SQAD AVL+++A  
Sbjct: 261 EERDKGKTVEVGRAYFETERKHFTIL----DAPGHKSFVPNMIGGASQADLAVLVISARK 316

Query: 349 GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           GEFE G  K GQTREHA+LA T GVK LIV +NKMD     +S  R+EE K++
Sbjct: 317 GEFETGFEKGGQTREHAMLAKTAGVKHLIVLINKMDDPTVNWSIERYEECKEK 369



 Score = 36.3 bits (80), Expect = 0.11
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 1/38 (2%)
 Frame = +3

Query: 516 YIKKIGYNPAA-VAFVPISGWHGDNMLEPSTKMPWFKG 626
           ++KK+G++P   + F+P SG  G N+ E S   PW+ G
Sbjct: 373 FLKKVGFSPKKDIHFMPCSGLTGANIKEQSDFCPWYTG 410


>AL603910-10|CAO03613.1|  107|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 107

 Score =  159 bits (387), Expect = 7e-39
 Identities = 79/100 (79%), Positives = 81/100 (81%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAER 67

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTS 309
           ER         +    +     IDAPGHRDFIKNMITGTS
Sbjct: 68  ERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTS 107


>AK023155-1|BAB14435.1|  504|Homo sapiens protein ( Homo sapiens
           cDNA FLJ13093 fis, clone NT2RP3002151, highly similar to
           G1 TO S PHASE TRANSITION PROTEIN 1 HOMOLOG. ).
          Length = 504

 Score =  159 bits (387), Expect = 7e-39
 Identities = 80/173 (46%), Positives = 113/173 (65%), Gaps = 4/173 (2%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           +  +N+V IGHVD+GKST  G +++  G +DKRT+EK+E+EA+E  + ++  +W LD  +
Sbjct: 98  KEHVNVVFIGHVDAGKSTIGGQIMFLTGMVDKRTLEKYEREAKEKNRETWYLSWALDTNQ 157

Query: 181 AERER----RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 348
            ER++         Y   E ++  +L    DAPGH+ F+ NMI G SQAD AVL+++A  
Sbjct: 158 EERDKGKTVEVGRAYFETERKHFTIL----DAPGHKSFVPNMIGGASQADLAVLVISARK 213

Query: 349 GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           GEFE G  K GQTREHA+LA T GVK LIV +NKMD     +S  R+EE K++
Sbjct: 214 GEFETGFEKGGQTREHAMLAKTAGVKHLIVLINKMDDPTVNWSIERYEECKEK 266



 Score = 36.3 bits (80), Expect = 0.11
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 1/38 (2%)
 Frame = +3

Query: 516 YIKKIGYNPAA-VAFVPISGWHGDNMLEPSTKMPWFKG 626
           ++KK+G++P   + F+P SG  G N+ E S   PW+ G
Sbjct: 270 FLKKVGFSPKKDIHFMPCSGLTGANIKEQSDFCPWYTG 307


>AJ251548-1|CAB91089.1|  628|Homo sapiens polypeptide chain release
           factor 3b protein.
          Length = 628

 Score =  159 bits (387), Expect = 7e-39
 Identities = 80/173 (46%), Positives = 113/173 (65%), Gaps = 4/173 (2%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           +  +N+V IGHVD+GKST  G +++  G +DKRT+EK+E+EA+E  + ++  +W LD  +
Sbjct: 201 KEHVNVVFIGHVDAGKSTIGGQIMFLTGMVDKRTLEKYEREAKEKNRETWYLSWALDTNQ 260

Query: 181 AERER----RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 348
            ER++         Y   E ++  +L    DAPGH+ F+ NMI G SQAD AVL+++A  
Sbjct: 261 EERDKGKTVEVGRAYFETERKHFTIL----DAPGHKSFVPNMIGGASQADLAVLVISARK 316

Query: 349 GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           GEFE G  K GQTREHA+LA T GVK LIV +NKMD     +S  R+EE K++
Sbjct: 317 GEFETGFEKGGQTREHAMLAKTAGVKHLIVLINKMDDPTVNWSIERYEECKEK 369



 Score = 36.3 bits (80), Expect = 0.11
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 1/38 (2%)
 Frame = +3

Query: 516 YIKKIGYNPAA-VAFVPISGWHGDNMLEPSTKMPWFKG 626
           ++KK+G++P   + F+P SG  G N+ E S   PW+ G
Sbjct: 373 FLKKVGFSPKKDIHFMPCSGLTGANIKEQSDFCPWYTG 410


>BC036077-1|AAH36077.1|  628|Homo sapiens G1 to S phase transition 2
           protein.
          Length = 628

 Score =  159 bits (386), Expect = 9e-39
 Identities = 80/173 (46%), Positives = 113/173 (65%), Gaps = 4/173 (2%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           +  +N+V IGHVD+GKST  G +++  G +DKRT+EK+E+EA+E  + ++  +W LD  +
Sbjct: 201 KEHVNVVFIGHVDAGKSTIGGQIMFLTGMVDKRTLEKYEREAKEKNRETWYLSWALDTNQ 260

Query: 181 AERER----RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 348
            ER++         Y   E ++  +L    DAPGH+ F+ NMI G SQAD AVL+++A  
Sbjct: 261 EERDKGKTVEVGRAYFETERKHFTIL----DAPGHKSFVPNMIGGASQADLAVLVISARK 316

Query: 349 GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           GEFE G  K GQTREHA+LA T GVK LIV +NKMD     +S  R+EE K++
Sbjct: 317 GEFETGFEKGGQTREHAMLAKTAGVKHLIVLINKMDDHTVNWSIERYEECKEK 369



 Score = 36.3 bits (80), Expect = 0.11
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 1/38 (2%)
 Frame = +3

Query: 516 YIKKIGYNPAA-VAFVPISGWHGDNMLEPSTKMPWFKG 626
           ++KK+G++P   + F+P SG  G N+ E S   PW+ G
Sbjct: 373 FLKKVGFSPKKDIHFMPCSGLTGANIKEQSDFCPWYTG 410


>AK001303-1|BAA91612.1|  628|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10441 fis, clone NT2RP1000733, highly similar to
           Human mRNA for GSPT1-TK protein. ).
          Length = 628

 Score =  159 bits (386), Expect = 9e-39
 Identities = 80/173 (46%), Positives = 113/173 (65%), Gaps = 4/173 (2%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           +  +N+V IGHVD+GKST  G +++  G +DKRT+EK+E+EA+E  + ++  +W LD  +
Sbjct: 201 KEHVNVVFIGHVDAGKSTIGGQIMFLTGMVDKRTLEKYEREAKEKNRETWYLSWALDTNQ 260

Query: 181 AERER----RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 348
            ER++         Y   E ++  +L    DAPGH+ F+ NMI G SQAD AVL+++A  
Sbjct: 261 EERDKGKTVEVGRAYFETERKHFTIL----DAPGHKGFVPNMIGGASQADLAVLVISARK 316

Query: 349 GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           GEFE G  K GQTREHA+LA T GVK LIV +NKMD     +S  R+EE K++
Sbjct: 317 GEFETGFEKGGQTREHAMLAKTAGVKHLIVLINKMDDPTVNWSIERYEECKEK 369



 Score = 36.3 bits (80), Expect = 0.11
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 1/38 (2%)
 Frame = +3

Query: 516 YIKKIGYNPAA-VAFVPISGWHGDNMLEPSTKMPWFKG 626
           ++KK+G++P   + F+P SG  G N+ E S   PW+ G
Sbjct: 373 FLKKVGFSPKKDIHFMPCSGLTGANIKEQSDFCPWYTG 410


>AK222519-1|BAD96239.1|  366|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 366

 Score =  149 bits (361), Expect = 1e-35
 Identities = 71/77 (92%), Positives = 74/77 (96%)
 Frame = +1

Query: 277 DFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMD 456
           DFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVGVNKMD
Sbjct: 1   DFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMD 60

Query: 457 STEPPYSEPRFEEIKKE 507
           STEPPYS+ R+EEI KE
Sbjct: 61  STEPPYSQKRYEEIVKE 77



 Score =  115 bits (276), Expect = 2e-25
 Identities = 49/64 (76%), Positives = 54/64 (84%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD 
Sbjct: 79  STYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDC 138

Query: 690 ILPP 701
           ILPP
Sbjct: 139 ILPP 142


>AF328730-1|AAN09722.1|  361|Homo sapiens CTCL tumor antigen
           HD-CL-08 protein.
          Length = 361

 Score =  138 bits (334), Expect = 2e-32
 Identities = 66/72 (91%), Positives = 69/72 (95%)
 Frame = +1

Query: 292 MITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPP 471
           MITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVGVNKMDSTEPP
Sbjct: 1   MITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPP 60

Query: 472 YSEPRFEEIKKE 507
           YS+ R+EEI KE
Sbjct: 61  YSQKRYEEIVKE 72



 Score =  115 bits (276), Expect = 2e-25
 Identities = 49/64 (76%), Positives = 54/64 (84%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD 
Sbjct: 74  STYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDC 133

Query: 690 ILPP 701
           ILPP
Sbjct: 134 ILPP 137


>AF322220-1|AAN51932.1|  361|Homo sapiens cervical cancer suppressor
           3 protein.
          Length = 361

 Score =  138 bits (334), Expect = 2e-32
 Identities = 66/72 (91%), Positives = 69/72 (95%)
 Frame = +1

Query: 292 MITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPP 471
           MITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVGVNKMDSTEPP
Sbjct: 1   MITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPP 60

Query: 472 YSEPRFEEIKKE 507
           YS+ R+EEI KE
Sbjct: 61  YSQKRYEEIVKE 72



 Score =  115 bits (276), Expect = 2e-25
 Identities = 49/64 (76%), Positives = 54/64 (84%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD 
Sbjct: 74  STYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDC 133

Query: 690 ILPP 701
           ILPP
Sbjct: 134 ILPP 137


>X03689-1|CAA27325.1|   94|Homo sapiens protein ( Human mRNA
           fragment for elongation factor TU (N-terminus). ).
          Length = 94

 Score =  132 bits (318), Expect = 2e-30
 Identities = 61/62 (98%), Positives = 61/62 (98%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAER 67

Query: 190 ER 195
           ER
Sbjct: 68  ER 69



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 17/21 (80%), Positives = 20/21 (95%)
 Frame = +2

Query: 197 GITIDIALWKFETSKYYVTTL 259
           GITIDI+LWKFET+KYYVT +
Sbjct: 70  GITIDISLWKFETAKYYVTII 90


>BC070131-1|AAH70131.1|  111|Homo sapiens EEF1A1 protein protein.
          Length = 111

 Score =  132 bits (318), Expect = 2e-30
 Identities = 61/62 (98%), Positives = 61/62 (98%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAER
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAER 67

Query: 190 ER 195
           ER
Sbjct: 68  ER 69



 Score = 36.7 bits (81), Expect = 0.082
 Identities = 16/24 (66%), Positives = 19/24 (79%)
 Frame = +2

Query: 197 GITIDIALWKFETSKYYVTTLMLL 268
           GITIDI+LWKFETSK +   L+ L
Sbjct: 70  GITIDISLWKFETSKQWTRRLLEL 93


>M29548-1|AAA52367.1|  327|Homo sapiens EEF1A protein.
          Length = 327

 Score =  115 bits (276), Expect = 2e-25
 Identities = 49/64 (76%), Positives = 54/64 (84%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD 
Sbjct: 40  STYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDC 99

Query: 690 ILPP 701
           ILPP
Sbjct: 100 ILPP 103



 Score = 67.7 bits (158), Expect = 4e-11
 Identities = 31/36 (86%), Positives = 34/36 (94%)
 Frame = +1

Query: 400 LLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           LLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KE
Sbjct: 3   LLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKE 38


>BC094687-1|AAH94687.1|  308|Homo sapiens EEF1A1 protein protein.
          Length = 308

 Score =  115 bits (276), Expect = 2e-25
 Identities = 49/64 (76%), Positives = 54/64 (84%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD 
Sbjct: 21  STYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDC 80

Query: 690 ILPP 701
           ILPP
Sbjct: 81  ILPP 84



 Score = 36.7 bits (81), Expect = 0.082
 Identities = 15/19 (78%), Positives = 17/19 (89%)
 Frame = +1

Query: 451 MDSTEPPYSEPRFEEIKKE 507
           MDSTEPPYS+ R+EEI KE
Sbjct: 1   MDSTEPPYSQKRYEEIVKE 19


>BC063511-1|AAH63511.1|  290|Homo sapiens EEF1A1 protein protein.
          Length = 290

 Score =  115 bits (276), Expect = 2e-25
 Identities = 49/64 (76%), Positives = 54/64 (84%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           S+YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD 
Sbjct: 3   STYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDC 62

Query: 690 ILPP 701
           ILPP
Sbjct: 63  ILPP 66


>BC014377-1|AAH14377.1|  287|Homo sapiens Unknown (protein for
           IMAGE:4041545) protein.
          Length = 287

 Score =  113 bits (271), Expect = 8e-25
 Identities = 48/62 (77%), Positives = 52/62 (83%)
 Frame = +3

Query: 516 YIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAIL 695
           YIKKIGYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD IL
Sbjct: 2   YIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCIL 61

Query: 696 PP 701
           PP
Sbjct: 62  PP 63


>BC070500-1|AAH70500.1|   67|Homo sapiens EEF1A1 protein protein.
          Length = 67

 Score = 92.7 bits (220), Expect = 1e-18
 Identities = 42/44 (95%), Positives = 43/44 (97%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGK 141
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMG+
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGR 51


>AL445190-4|CAI95162.1|  453|Homo sapiens HBS1-like (S. cerevisiae)
           protein.
          Length = 453

 Score = 87.8 bits (208), Expect = 3e-17
 Identities = 37/62 (59%), Positives = 50/62 (80%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++ GK SF YAWVLD+   ER
Sbjct: 261 LNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETGEER 320

Query: 190 ER 195
           ER
Sbjct: 321 ER 322


>AL353596-1|CAI17913.1|  453|Homo sapiens HBS1-like (S. cerevisiae)
           protein.
          Length = 453

 Score = 87.8 bits (208), Expect = 3e-17
 Identities = 37/62 (59%), Positives = 50/62 (80%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++ GK SF YAWVLD+   ER
Sbjct: 261 LNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETGEER 320

Query: 190 ER 195
           ER
Sbjct: 321 ER 322


>X84694-1|CAA59169.1|  452|Homo sapiens mitochondrial elongation
           factor Tu protein.
          Length = 452

 Score = 77.8 bits (183), Expect = 4e-14
 Identities = 54/152 (35%), Positives = 71/152 (46%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           +N+  IGHVD GK+T T  +                K   E G   FK    +D    ER
Sbjct: 58  VNVGTIGHVDHGKTTLTAAIT---------------KILAEGGGAKFKKYEEIDNAPEER 102

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
            R        +E         H D PGH D++KNMITGT+  D  +L+VAA  G      
Sbjct: 103 ARGITINAAHVEYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMP--- 159

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTE 465
               QTREH LLA  +GV+ ++V VNK D+ +
Sbjct: 160 ----QTREHLLLARQIGVEHVVVYVNKADAVQ 187


>S75463-1|AAC60647.1|  452|Homo sapiens P43 protein.
          Length = 452

 Score = 77.8 bits (183), Expect = 4e-14
 Identities = 54/152 (35%), Positives = 71/152 (46%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           +N+  IGHVD GK+T T  +                K   E G   FK    +D    ER
Sbjct: 61  VNVGTIGHVDHGKTTLTAAIT---------------KILAEGGGAKFKKYEEIDNAPEER 105

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
            R        +E         H D PGH D++KNMITGT+  D  +L+VAA  G      
Sbjct: 106 ARGITINAAHVEYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMP--- 162

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTE 465
               QTREH LLA  +GV+ ++V VNK D+ +
Sbjct: 163 ----QTREHLLLARQIGVEHVVVYVNKADAVQ 190


>L38995-1|AAB00499.1|  452|Homo sapiens elongation factor Tu
           protein.
          Length = 452

 Score = 77.8 bits (183), Expect = 4e-14
 Identities = 54/152 (35%), Positives = 71/152 (46%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           +N+  IGHVD GK+T T  +                K   E G   FK    +D    ER
Sbjct: 58  VNVGTIGHVDHGKTTLTAAIT---------------KILAEGGGAKFKKYEEIDNAPEER 102

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
            R        +E         H D PGH D++KNMITGT+  D  +L+VAA  G      
Sbjct: 103 ARGITINAAHVEYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMP--- 159

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTE 465
               QTREH LLA  +GV+ ++V VNK D+ +
Sbjct: 160 ----QTREHLLLARQIGVEHVVVYVNKADAVQ 187


>BC010041-1|AAH10041.2|  455|Homo sapiens Tu translation elongation
           factor, mitochondrial protein.
          Length = 455

 Score = 77.8 bits (183), Expect = 4e-14
 Identities = 54/152 (35%), Positives = 71/152 (46%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           +N+  IGHVD GK+T T  +                K   E G   FK    +D    ER
Sbjct: 61  VNVGTIGHVDHGKTTLTAAIT---------------KILAEGGGAKFKKYEEIDNAPEER 105

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
            R        +E         H D PGH D++KNMITGT+  D  +L+VAA  G      
Sbjct: 106 ARGITINAAHVEYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMP--- 162

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTE 465
               QTREH LLA  +GV+ ++V VNK D+ +
Sbjct: 163 ----QTREHLLLARQIGVEHVVVYVNKADAVQ 190


>BC001633-1|AAH01633.2|  455|Homo sapiens Tu translation elongation
           factor, mitochondrial protein.
          Length = 455

 Score = 77.8 bits (183), Expect = 4e-14
 Identities = 54/152 (35%), Positives = 71/152 (46%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           +N+  IGHVD GK+T T  +                K   E G   FK    +D    ER
Sbjct: 61  VNVGTIGHVDHGKTTLTAAIT---------------KILAEGGGAKFKKYEEIDNAPEER 105

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
            R        +E         H D PGH D++KNMITGT+  D  +L+VAA  G      
Sbjct: 106 ARGITINAAHVEYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMP--- 162

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTE 465
               QTREH LLA  +GV+ ++V VNK D+ +
Sbjct: 163 ----QTREHLLLARQIGVEHVVVYVNKADAVQ 190


>AK023282-1|BAB14507.1|  669|Homo sapiens protein ( Homo sapiens
           cDNA FLJ13220 fis, clone NT2RP4002047, moderately
           similar to GTP-BINDING PROTEIN LEPA. ).
          Length = 669

 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 51/168 (30%), Positives = 70/168 (41%), Gaps = 6/168 (3%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           N  ++ HVD GKST T  L+   G IDK    K  K+             VLDKL+ ERE
Sbjct: 70  NFSIVAHVDHGKSTLTDRLLELTGTIDK---TKNNKQ-------------VLDKLQVERE 113

Query: 193 R----RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
           R    +             Q L   ID PGH DF   +    S     +L+V A  G   
Sbjct: 114 RGITVKAQTASLFYNCEGKQYLLNLIDTPGHVDFSYEVSRSLSACQGVLLVVDANEG--- 170

Query: 361 AGISKNGQTREHALLAFTLGVKQLIVGVNKMD--STEPPYSEPRFEEI 498
                  QT  +  LAF   +  + V +NK+D  + +P   E + E++
Sbjct: 171 ----IQAQTVANFFLAFEAQLSVIPV-INKIDLKNADPERVENQIEKV 213


>BC036768-1|AAH36768.1|  669|Homo sapiens GUF1 GTPase homolog (S.
           cerevisiae) protein.
          Length = 669

 Score = 43.6 bits (98), Expect = 7e-04
 Identities = 50/168 (29%), Positives = 69/168 (41%), Gaps = 6/168 (3%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           N  ++ HVD GKST    L+   G IDK    K  K+             VLDKL+ ERE
Sbjct: 70  NFSIVAHVDHGKSTLADRLLELTGTIDK---TKNNKQ-------------VLDKLQVERE 113

Query: 193 R----RYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
           R    +             Q L   ID PGH DF   +    S     +L+V A  G   
Sbjct: 114 RGITVKAQTASLFYNCEGKQYLLNLIDTPGHVDFSYEVSRSLSACQGVLLVVDANEG--- 170

Query: 361 AGISKNGQTREHALLAFTLGVKQLIVGVNKMD--STEPPYSEPRFEEI 498
                  QT  +  LAF   +  + V +NK+D  + +P   E + E++
Sbjct: 171 ----IQAQTVANFFLAFEAQLSVIPV-INKIDLKNADPERVENQIEKV 213


>BC065761-1|AAH65761.1|  251|Homo sapiens EEF1A1 protein protein.
          Length = 251

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 17/26 (65%), Positives = 20/26 (76%)
 Frame = +3

Query: 624 GWQVERKEGKADGKCLIEALDAILPP 701
           GW+V RK+G A G  L+EALD ILPP
Sbjct: 2   GWKVTRKDGNASGTTLLEALDCILPP 27


>BC022412-1|AAH22412.1|  250|Homo sapiens Unknown (protein for
           IMAGE:4134193) protein.
          Length = 250

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 17/26 (65%), Positives = 20/26 (76%)
 Frame = +3

Query: 624 GWQVERKEGKADGKCLIEALDAILPP 701
           GW+V RK+G A G  L+EALD ILPP
Sbjct: 1   GWKVTRKDGNASGTTLLEALDCILPP 26


>BC049210-1|AAH49210.1|  751|Homo sapiens G elongation factor,
           mitochondrial 1 protein.
          Length = 751

 Score = 41.5 bits (93), Expect = 0.003
 Identities = 35/113 (30%), Positives = 50/113 (44%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           NI +  H+DSGK+T T  ++Y  G I K           E+ KG      V+D ++ ER+
Sbjct: 48  NIGISAHIDSGKTTLTERVLYYTGRIAK---------MHEV-KGKDGVGAVMDSMELERQ 97

Query: 193 RRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
           R    +  +       V    ID PGH DF   +       D AVL++ A  G
Sbjct: 98  RGITIQSAATYTMWKDVNINIIDTPGHVDFTIEVERALRVLDGAVLVLCAVGG 150


>AF367998-1|AAK53402.1|  751|Homo sapiens elongation factor G1
           protein.
          Length = 751

 Score = 41.5 bits (93), Expect = 0.003
 Identities = 35/113 (30%), Positives = 50/113 (44%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           NI +  H+DSGK+T T  ++Y  G I K           E+ KG      V+D ++ ER+
Sbjct: 48  NIGISAHIDSGKTTLTERVLYYTGRIAK---------MHEV-KGKDGVGAVMDSMELERQ 97

Query: 193 RRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
           R    +  +       V    ID PGH DF   +       D AVL++ A  G
Sbjct: 98  RGITIQSAATYTMWKDVNINIIDTPGHVDFTIEVERALRVLDGAVLVLCAVGG 150


>AF309777-1|AAK58877.1|  751|Homo sapiens elongation factor G
           protein.
          Length = 751

 Score = 41.5 bits (93), Expect = 0.003
 Identities = 35/113 (30%), Positives = 50/113 (44%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           NI +  H+DSGK+T T  ++Y  G I K           E+ KG      V+D ++ ER+
Sbjct: 48  NIGISAHIDSGKTTLTERVLYYTGRIAK---------MHEV-KGKDGVGAVMDSMELERQ 97

Query: 193 RRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
           R    +  +       V    ID PGH DF   +       D AVL++ A  G
Sbjct: 98  RGITIQSAATYTMWKDVNINIIDTPGHVDFTIEVERALRVLDGAVLVLCAVGG 150


>L19161-1|AAA19696.1|  472|Homo sapiens translation initiation
           factor eIF-2 gamma subunit protein.
          Length = 472

 Score = 38.3 bits (85), Expect = 0.027
 Identities = 20/81 (24%), Positives = 39/81 (48%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH   +  M+ G +  D A+L++A              QT EH      + +K ++
Sbjct: 133 VDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKLKHIL 186

Query: 436 VGVNKMDSTEPPYSEPRFEEI 498
           +  NK+D  +   ++ ++E+I
Sbjct: 187 ILQNKIDLVKESQAKEQYEQI 207


>BC019906-1|AAH19906.1|  472|Homo sapiens eukaryotic translation
           initiation factor 2, subunit 3 gamma, 52kDa protein.
          Length = 472

 Score = 38.3 bits (85), Expect = 0.027
 Identities = 20/81 (24%), Positives = 39/81 (48%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH   +  M+ G +  D A+L++A              QT EH      + +K ++
Sbjct: 133 VDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKLKHIL 186

Query: 436 VGVNKMDSTEPPYSEPRFEEI 498
           +  NK+D  +   ++ ++E+I
Sbjct: 187 ILQNKIDLVKESQAKEQYEQI 207


>AK222577-1|BAD96297.1|  472|Homo sapiens eukaryotic translation
           initiation factor 2, subunit 3 gamma, 52kDa variant
           protein.
          Length = 472

 Score = 38.3 bits (85), Expect = 0.027
 Identities = 20/81 (24%), Positives = 39/81 (48%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH   +  M+ G +  D A+L++A              QT EH      + +K ++
Sbjct: 133 VDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKLKHIL 186

Query: 436 VGVNKMDSTEPPYSEPRFEEI 498
           +  NK+D  +   ++ ++E+I
Sbjct: 187 ILQNKIDLVKESQAKEQYEQI 207


>DQ120619-1|ABB92405.1|  471|Homo sapiens eFI-2-gamma protein.
          Length = 471

 Score = 37.9 bits (84), Expect = 0.036
 Identities = 20/81 (24%), Positives = 39/81 (48%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH   +  M+ G +  D A+L++A              QT EH      + +K ++
Sbjct: 133 VDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKLKHIL 186

Query: 436 VGVNKMDSTEPPYSEPRFEEI 498
           +  NK+D  +   ++ ++E+I
Sbjct: 187 ILQNKIDLVKERQAKEQYEQI 207


>BC087847-1|AAH87847.1|  465|Homo sapiens Unknown (protein for
           IMAGE:30389268) protein.
          Length = 465

 Score = 37.9 bits (84), Expect = 0.036
 Identities = 20/81 (24%), Positives = 39/81 (48%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH   +  M+ G +  D A+L++A              QT EH      + +K ++
Sbjct: 132 VDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKLKHIL 185

Query: 436 VGVNKMDSTEPPYSEPRFEEI 498
           +  NK+D  +   ++ ++E+I
Sbjct: 186 ILQNKIDLVKERQAKEQYEQI 206


>AJ006932-1|CAA07331.1|  248|Homo sapiens eIF-2gA protein.
          Length = 248

 Score = 37.9 bits (84), Expect = 0.036
 Identities = 20/81 (24%), Positives = 39/81 (48%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH   +  M+ G +  D A+L++A              QT EH      + +K ++
Sbjct: 73  VDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKLKHIL 126

Query: 436 VGVNKMDSTEPPYSEPRFEEI 498
           +  NK+D  +   ++ ++E+I
Sbjct: 127 ILQNKIDLVKERQAKEQYEQI 147


>BC014892-1|AAH14892.1|  248|Homo sapiens Unknown (protein for
           IMAGE:3909122) protein.
          Length = 248

 Score = 35.1 bits (77), Expect = 0.25
 Identities = 15/24 (62%), Positives = 18/24 (75%)
 Frame = +3

Query: 630 QVERKEGKADGKCLIEALDAILPP 701
           +V RK+G A G  L+EALD ILPP
Sbjct: 1   KVTRKDGNASGTTLLEALDCILPP 24


>Z11692-1|CAA77750.1|  858|Homo sapiens human  elongation factor 2
           protein.
          Length = 858

 Score = 33.5 bits (73), Expect = 0.77
 Identities = 33/115 (28%), Positives = 46/115 (40%), Gaps = 2/115 (1%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGI-DKRTIE-KFEKEAQEMGKGSFKYAWVLDKLKAE 186
           N+ VI HVD GKST T  L+ K G I   R  E +F    ++  +           L  E
Sbjct: 21  NMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLFYE 80

Query: 187 RERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
                 N +          L   ID+PGH DF   +       D A+++V   +G
Sbjct: 81  LSENDLN-FIKQSKDGAGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSG 134


>X51466-1|CAA35829.1|  858|Homo sapiens elongation factor 2 protein.
          Length = 858

 Score = 33.5 bits (73), Expect = 0.77
 Identities = 33/115 (28%), Positives = 46/115 (40%), Gaps = 2/115 (1%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGI-DKRTIE-KFEKEAQEMGKGSFKYAWVLDKLKAE 186
           N+ VI HVD GKST T  L+ K G I   R  E +F    ++  +           L  E
Sbjct: 21  NMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLFYE 80

Query: 187 RERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
                 N +          L   ID+PGH DF   +       D A+++V   +G
Sbjct: 81  LSENDLN-FIKQSKDGAGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSG 134


>BC126259-1|AAI26260.1|  858|Homo sapiens EEF2 protein protein.
          Length = 858

 Score = 33.5 bits (73), Expect = 0.77
 Identities = 33/115 (28%), Positives = 46/115 (40%), Gaps = 2/115 (1%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGI-DKRTIE-KFEKEAQEMGKGSFKYAWVLDKLKAE 186
           N+ VI HVD GKST T  L+ K G I   R  E +F    ++  +           L  E
Sbjct: 21  NMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLFYE 80

Query: 187 RERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
                 N +          L   ID+PGH DF   +       D A+++V   +G
Sbjct: 81  LSENDLN-FIKQSKDGAGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSG 134


>BC006547-1|AAH06547.1|  583|Homo sapiens EEF2 protein protein.
          Length = 583

 Score = 33.5 bits (73), Expect = 0.77
 Identities = 33/115 (28%), Positives = 46/115 (40%), Gaps = 2/115 (1%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGI-DKRTIE-KFEKEAQEMGKGSFKYAWVLDKLKAE 186
           N+ VI HVD GKST T  L+ K G I   R  E +F    ++  +           L  E
Sbjct: 21  NMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLFYE 80

Query: 187 RERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
                 N +          L   ID+PGH DF   +       D A+++V   +G
Sbjct: 81  LSENDLN-FIKQSKDGAGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSG 134


>AY942181-1|AAX34409.1|  858|Homo sapiens elongation factor 2
           protein.
          Length = 858

 Score = 33.5 bits (73), Expect = 0.77
 Identities = 33/115 (28%), Positives = 46/115 (40%), Gaps = 2/115 (1%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGI-DKRTIE-KFEKEAQEMGKGSFKYAWVLDKLKAE 186
           N+ VI HVD GKST T  L+ K G I   R  E +F    ++  +           L  E
Sbjct: 21  NMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLFYE 80

Query: 187 RERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
                 N +          L   ID+PGH DF   +       D A+++V   +G
Sbjct: 81  LSENDLN-FIKQSKDGAGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSG 134


>BC030612-1|AAH30612.1|  777|Homo sapiens G elongation factor,
           mitochondrial 2 protein.
          Length = 777

 Score = 33.1 bits (72), Expect = 1.0
 Identities = 30/113 (26%), Positives = 47/113 (41%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           NI ++ H+D+GK+TTT  ++Y  G         + +   ++  G      V D +  ERE
Sbjct: 72  NIGIMAHIDAGKTTTTERILYYSG---------YTRSLGDVDDGD----TVTDFMAQERE 118

Query: 193 RRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
           R    +  ++           ID PGH DF   +       D AV +  A  G
Sbjct: 119 RGITIQSAAVTFDWKGYRVNLIDTPGHVDFTLEVERCLRVLDGAVAVFDASAG 171


>BC015712-1|AAH15712.1|  779|Homo sapiens GFM2 protein protein.
          Length = 779

 Score = 33.1 bits (72), Expect = 1.0
 Identities = 30/113 (26%), Positives = 47/113 (41%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           NI ++ H+D+GK+TTT  ++Y  G         + +   ++  G      V D +  ERE
Sbjct: 72  NIGIMAHIDAGKTTTTERILYYSG---------YTRSLGDVDDGD----TVTDFMAQERE 118

Query: 193 RRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
           R    +  ++           ID PGH DF   +       D AV +  A  G
Sbjct: 119 RGITIQSAAVTFDWKGYRVNLIDTPGHVDFTLEVERCLRVLDGAVAVFDASAG 171


>AY453587-1|AAS49035.1|  531|Homo sapiens elongation factor G
           isoform protein.
          Length = 531

 Score = 33.1 bits (72), Expect = 1.0
 Identities = 30/113 (26%), Positives = 47/113 (41%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           NI ++ H+D+GK+TTT  ++Y  G         + +   ++  G      V D +  ERE
Sbjct: 72  NIGIMAHIDAGKTTTTERILYYSG---------YTRSLGDVDDGD----TVTDFMAQERE 118

Query: 193 RRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
           R    +  ++           ID PGH DF   +       D AV +  A  G
Sbjct: 119 RGITIQSAAVTFDWKGYRVNLIDTPGHVDFTLEVERCLRVLDGAVAVFDASAG 171


>AK025314-1|BAB15109.1|  513|Homo sapiens protein ( Homo sapiens
           cDNA: FLJ21661 fis, clone COL08837. ).
          Length = 513

 Score = 33.1 bits (72), Expect = 1.0
 Identities = 30/113 (26%), Positives = 47/113 (41%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           NI ++ H+D+GK+TTT  ++Y  G         + +   ++  G      V D +  ERE
Sbjct: 72  NIGIMAHIDAGKTTTTERILYYSG---------YTRSLGDVDDGD----TVTDFMAQERE 118

Query: 193 RRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
           R    +  ++           ID PGH DF   +       D AV +  A  G
Sbjct: 119 RGITIQSAAVTFDWKGYRVNLIDTPGHVDFTLEVERCLRVLDGAVAVFDASAG 171


>AF367997-1|AAK53401.1|  779|Homo sapiens elongation factor G2
           protein.
          Length = 779

 Score = 33.1 bits (72), Expect = 1.0
 Identities = 30/113 (26%), Positives = 47/113 (41%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           NI ++ H+D+GK+TTT  ++Y  G         + +   ++  G      V D +  ERE
Sbjct: 72  NIGIMAHIDAGKTTTTERILYYSG---------YTRSLGDVDDGD----TVTDFMAQERE 118

Query: 193 RRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
           R    +  ++           ID PGH DF   +       D AV +  A  G
Sbjct: 119 RGITIQSAAVTFDWKGYRVNLIDTPGHVDFTLEVERCLRVLDGAVAVFDASAG 171


>AF111808-1|AAL39010.1|  732|Homo sapiens MSTP027 protein.
          Length = 732

 Score = 33.1 bits (72), Expect = 1.0
 Identities = 30/113 (26%), Positives = 47/113 (41%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           NI ++ H+D+GK+TTT  ++Y  G         + +   ++  G      V D +  ERE
Sbjct: 72  NIGIMAHIDAGKTTTTERILYYSG---------YTRSLGDVDDGD----TVTDFMAQERE 118

Query: 193 RRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
           R    +  ++           ID PGH DF   +       D AV +  A  G
Sbjct: 119 RGITIQSAAVTFDWKGYRVNLIDTPGHVDFTLEVERCLRVLDGAVAVFDASAG 171


>L34600-1|AAA67038.1|  727|Homo sapiens initiation factor 2 protein.
          Length = 727

 Score = 32.7 bits (71), Expect = 1.3
 Identities = 27/84 (32%), Positives = 40/84 (47%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH  F      G    D  VL+VAA  G  +  +    ++ +HA  A       +I
Sbjct: 233 LDTPGHAAFSAMRARGAQVTDIVVLVVAADDGVMKQTV----ESIQHAKDAQV----PII 284

Query: 436 VGVNKMDSTEPPYSEPRFEEIKKE 507
           + VNK D  E   ++P  E++KKE
Sbjct: 285 LAVNKCDKAE---ADP--EKVKKE 303


>BC064977-1|AAH64977.1|  465|Homo sapiens MTIF2 protein protein.
          Length = 465

 Score = 32.7 bits (71), Expect = 1.3
 Identities = 27/84 (32%), Positives = 40/84 (47%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH  F      G    D  VL+VAA  G  +  +    ++ +HA  A       +I
Sbjct: 233 LDTPGHAAFSAMRARGAQVTDIVVLVVAADDGVMKQTV----ESIQHAKDAQV----PII 284

Query: 436 VGVNKMDSTEPPYSEPRFEEIKKE 507
           + VNK D  E   ++P  E++KKE
Sbjct: 285 LAVNKCDKAE---ADP--EKVKKE 303


>BC039848-1|AAH39848.1|  500|Homo sapiens Similar to mitochondrial
           translational initiation factor 2 protein.
          Length = 500

 Score = 32.7 bits (71), Expect = 1.3
 Identities = 27/84 (32%), Positives = 40/84 (47%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH  F      G    D  VL+VAA  G  +  +    ++ +HA  A       +I
Sbjct: 233 LDTPGHAAFSAMRARGAQVTDIVVLVVAADDGVMKQTV----ESIQHAKDAQV----PII 284

Query: 436 VGVNKMDSTEPPYSEPRFEEIKKE 507
           + VNK D  E   ++P  E++KKE
Sbjct: 285 LAVNKCDKAE---ADP--EKVKKE 303


>AF495546-1|AAM70196.1|  727|Homo sapiens translation initiation
           factor 2 protein.
          Length = 727

 Score = 32.7 bits (71), Expect = 1.3
 Identities = 27/84 (32%), Positives = 40/84 (47%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH  F      G    D  VL+VAA  G  +  +    ++ +HA  A       +I
Sbjct: 233 LDTPGHAAFSAMRARGAQVTDIVVLVVAADDGVMKQTV----ESIQHAKDAQV----PII 284

Query: 436 VGVNKMDSTEPPYSEPRFEEIKKE 507
           + VNK D  E   ++P  E++KKE
Sbjct: 285 LAVNKCDKAE---ADP--EKVKKE 303


>AF494407-1|AAM14617.1|  727|Homo sapiens mitochondrial
           translation-initiation factor 2 protein.
          Length = 727

 Score = 32.7 bits (71), Expect = 1.3
 Identities = 27/84 (32%), Positives = 40/84 (47%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH  F      G    D  VL+VAA  G  +  +    ++ +HA  A       +I
Sbjct: 233 LDTPGHAAFSAMRARGAQVTDIVVLVVAADDGVMKQTV----ESIQHAKDAQV----PII 284

Query: 436 VGVNKMDSTEPPYSEPRFEEIKKE 507
           + VNK D  E   ++P  E++KKE
Sbjct: 285 LAVNKCDKAE---ADP--EKVKKE 303


>BC127820-1|AAI27821.1|  230|Homo sapiens FLJ10081 protein protein.
          Length = 230

 Score = 30.7 bits (66), Expect = 5.4
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 2/50 (4%)
 Frame = -2

Query: 670 RHFPSA-LPSLRSTCHP-LNQGILVEGSNMLSPCHPEMGTKATAAGL*PI 527
           RH PS+ LP  +++  P +   ++ +G     PC P  G+   AAG  PI
Sbjct: 110 RHHPSSPLPGSKTSKRPKIKVSLISQGDTAGGPCAPSQGSAPEAAGGKPI 159


>BC063792-1|AAH63792.1|  878|Homo sapiens FLJ10081 protein protein.
          Length = 878

 Score = 30.7 bits (66), Expect = 5.4
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 2/50 (4%)
 Frame = -2

Query: 670 RHFPSA-LPSLRSTCHP-LNQGILVEGSNMLSPCHPEMGTKATAAGL*PI 527
           RH PS+ LP  +++  P +   ++ +G     PC P  G+   AAG  PI
Sbjct: 602 RHHPSSPLPGSKTSKRPKIKVSLISQGDTAGGPCAPSQGSAPEAAGGKPI 651


>BC051763-1|AAH51763.1|  830|Homo sapiens FLJ10081 protein protein.
          Length = 830

 Score = 30.7 bits (66), Expect = 5.4
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 2/50 (4%)
 Frame = -2

Query: 670 RHFPSA-LPSLRSTCHP-LNQGILVEGSNMLSPCHPEMGTKATAAGL*PI 527
           RH PS+ LP  +++  P +   ++ +G     PC P  G+   AAG  PI
Sbjct: 554 RHHPSSPLPGSKTSKRPKIKVSLISQGDTAGGPCAPSQGSAPEAAGGKPI 603


>AY050169-1|AAL13159.1|  791|Homo sapiens serum inhibited-related
           protein protein.
          Length = 791

 Score = 30.7 bits (66), Expect = 5.4
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 2/50 (4%)
 Frame = -2

Query: 670 RHFPSA-LPSLRSTCHP-LNQGILVEGSNMLSPCHPEMGTKATAAGL*PI 527
           RH PS+ LP  +++  P +   ++ +G     PC P  G+   AAG  PI
Sbjct: 515 RHHPSSPLPGSKTSKRPKIKVSLISQGDTAGGPCAPSQGSAPEAAGGKPI 564


>AC079754-1|AAX88890.1|  791|Homo sapiens unknown protein.
          Length = 791

 Score = 30.7 bits (66), Expect = 5.4
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 2/50 (4%)
 Frame = -2

Query: 670 RHFPSA-LPSLRSTCHP-LNQGILVEGSNMLSPCHPEMGTKATAAGL*PI 527
           RH PS+ LP  +++  P +   ++ +G     PC P  G+   AAG  PI
Sbjct: 515 RHHPSSPLPGSKTSKRPKIKVSLISQGDTAGGPCAPSQGSAPEAAGGKPI 564


>AB037731-1|BAA92548.1|  794|Homo sapiens KIAA1310 protein protein.
          Length = 794

 Score = 30.7 bits (66), Expect = 5.4
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 2/50 (4%)
 Frame = -2

Query: 670 RHFPSA-LPSLRSTCHP-LNQGILVEGSNMLSPCHPEMGTKATAAGL*PI 527
           RH PS+ LP  +++  P +   ++ +G     PC P  G+   AAG  PI
Sbjct: 642 RHHPSSPLPGSKTSKRPKIKVSLISQGDTAGGPCAPSQGSAPEAAGGKPI 691


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 115,193,236
Number of Sequences: 237096
Number of extensions: 2579992
Number of successful extensions: 6343
Number of sequences better than 10.0: 119
Number of HSP's better than 10.0 without gapping: 5810
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6204
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8343197486
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -