SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20029
         (715 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

D13748-1|BAA02897.1|  406|Homo sapiens eukaryotic initiation fac...   149   7e-36
BT019881-1|AAV38684.1|  406|Homo sapiens eukaryotic translation ...   149   7e-36
BT019880-1|AAV38683.1|  406|Homo sapiens eukaryotic translation ...   149   7e-36
BC073752-1|AAH73752.1|  406|Homo sapiens eukaryotic translation ...   149   7e-36
BC009585-1|AAH09585.1|  406|Homo sapiens eukaryotic translation ...   149   7e-36
BC006380-1|AAH06380.1|  473|Homo sapiens Unknown (protein for IM...   149   7e-36
D30655-1|BAA06336.1|  407|Homo sapiens eukaryotic initiation fac...   148   2e-35
BT009860-1|AAP88862.1|  407|Homo sapiens eukaryotic translation ...   148   2e-35
BC048105-1|AAH48105.1|  408|Homo sapiens eukaryotic translation ...   148   2e-35
BC016295-1|AAH16295.1|  179|Homo sapiens EIF4A2 protein protein.      148   2e-35
BC015842-1|AAH15842.1|  407|Homo sapiens eukaryotic translation ...   148   2e-35
BC013708-1|AAH13708.1|  407|Homo sapiens eukaryotic translation ...   148   2e-35
BC012547-1|AAH12547.1|  408|Homo sapiens eukaryotic translation ...   148   2e-35
X79538-1|CAA56074.1|  411|Homo sapiens translation initiation fa...   138   2e-32
D21853-1|BAA04879.2|  412|Homo sapiens KIAA0111 protein.              138   2e-32
CR456750-1|CAG33031.1|  411|Homo sapiens DDX48 protein.               138   2e-32
BC011151-1|AAH11151.1|  411|Homo sapiens eukaryotic translation ...   138   2e-32
BC004386-1|AAH04386.1|  411|Homo sapiens eukaryotic translation ...   138   2e-32
BC003662-1|AAH03662.1|  411|Homo sapiens eukaryotic translation ...   138   2e-32
AB209593-1|BAD92830.1|  375|Homo sapiens CD68 antigen variant pr...   100   9e-31
BC050360-1|AAH50360.2|  369|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    73   1e-12
BC035388-1|AAH35388.2|  369|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    73   1e-12
AY735312-1|AAU84667.1|  483|Homo sapiens gonadotropin-regulated ...    72   2e-12
AF155140-1|AAF21371.2|  483|Homo sapiens gonadotropin-regulated ...    72   2e-12
BC110805-1|AAI10806.1|  449|Homo sapiens DDX19B protein protein.       71   5e-12
BC010008-1|AAH10008.1|  370|Homo sapiens DEAD (Asp-Glu-Ala-As) b...    71   5e-12
BC006544-1|AAH06544.1|  478|Homo sapiens DEAD (Asp-Glu-Ala-As) b...    71   5e-12
BC005162-1|AAH05162.1|  478|Homo sapiens DEAD (Asp-Glu-Ala-As) b...    71   5e-12
BC003626-1|AAH03626.1|  479|Homo sapiens DEAD (Asp-Glu-Ala-As) b...    71   5e-12
AK223262-1|BAD96982.1|  478|Homo sapiens DDX19-like protein vari...    71   5e-12
AK223115-1|BAD96835.1|  479|Homo sapiens DEAD (Asp-Glu-Ala-As) b...    71   5e-12
AK001988-1|BAA92022.1|  478|Homo sapiens protein ( Homo sapiens ...    71   5e-12
AJ237946-1|CAB52189.1|  479|Homo sapiens DEAD Box Protein 5 prot...    71   5e-12
AF353720-1|AAK40102.1|  370|Homo sapiens testicular DEAD-box hel...    71   5e-12
AB209401-1|BAD92638.1|  313|Homo sapiens DDX19-like protein vari...    71   5e-12
CR457215-1|CAG33496.1|  479|Homo sapiens DDX19 protein.                69   1e-11
AF183422-1|AAG09691.1|  478|Homo sapiens RNA helicase protein.         69   1e-11
AF136175-1|AAP97265.1|  479|Homo sapiens RNA helicase protein.         69   1e-11
CR533509-1|CAG38540.1|  448|Homo sapiens DDX19 protein.                69   2e-11
BC066938-1|AAH66938.1|  648|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    51   4e-06
AJ278110-1|CAB92442.1|  648|Homo sapiens DEAD-box protein protein.     51   4e-06
D17532-1|BAA04482.1|  472|Homo sapiens RCK protein.                    51   5e-06
BC065007-1|AAH65007.1|  483|Homo sapiens DDX6 protein protein.         51   5e-06
BC018637-1|AAH18637.2|  423|Homo sapiens DDX50 protein protein.        50   8e-06
BC000272-1|AAH00272.1|  737|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    50   8e-06
BC000210-1|AAH00210.1|  467|Homo sapiens DDX50 protein protein.        50   8e-06
AL359844-2|CAH72376.1|  737|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    50   8e-06
AL137423-1|CAB70733.1|  399|Homo sapiens hypothetical protein pr...    50   8e-06
AF334103-1|AAK29402.1|  737|Homo sapiens nucleolar protein GU2 p...    50   8e-06
BC088362-1|AAH88362.1|  724|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    48   3e-05
BC047455-1|AAH47455.1|  690|Homo sapiens DDX4 protein protein.         48   3e-05
AL137462-1|CAB70750.1|  635|Homo sapiens hypothetical protein pr...    48   3e-05
AF262962-1|AAF72705.1|  724|Homo sapiens VASA protein protein.         48   3e-05
BC001009-1|AAH01009.1|  427|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    48   3e-05
AK026614-1|BAB15509.1|  461|Homo sapiens protein ( Homo sapiens ...    48   3e-05
U50553-1|AAB95637.1|  662|Homo sapiens helicase like protein 2 p...    48   4e-05
BC034942-1|AAH34942.1|  660|Homo sapiens DDX3Y protein protein.        48   4e-05
BC011819-1|AAH11819.1|  662|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    48   4e-05
AY776161-1|AAV52794.1|  362|Homo sapiens unknown protein.              48   4e-05
AL391647-2|CAI41416.1|  662|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    48   4e-05
AF061337-1|AAC34298.1|  662|Homo sapiens DEAD box RNA helicase D...    48   4e-05
AF000985-1|AAC51832.1|  660|Homo sapiens dead box, Y isoform pro...    48   4e-05
AF000984-1|AAC51831.1|  660|Homo sapiens dead box, Y isoform pro...    48   4e-05
AF000983-1|AAC51830.1|  662|Homo sapiens dead box, X isoform pro...    48   4e-05
AF000982-1|AAC51829.1|  662|Homo sapiens dead box, X isoform pro...    48   4e-05
AB208983-1|BAD92220.1|  674|Homo sapiens DEAD/H (Asp-Glu-Ala-Asp...    48   4e-05
Z97056-3|CAB09792.1|  650|Homo sapiens DEAD (Asp-Glu-Ala-Asp) bo...    47   6e-05
U59321-1|AAC50787.1|  650|Homo sapiens DEAD-box protein p72 prot...    47   6e-05
CR456432-1|CAG30318.1|  652|Homo sapiens DDX17 protein.                47   6e-05
BC000595-1|AAH00595.2|  729|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    47   6e-05
AY004154-1|AAF86585.1|  724|Homo sapiens DEAD box RNA helicase p...    47   6e-05
AB209595-1|BAD92832.1|  737|Homo sapiens DEAD box polypeptide 17...    47   6e-05
U41387-1|AAB02546.1|  801|Homo sapiens Gu protein protein.             47   8e-05
BC008071-1|AAH08071.2|  783|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    47   8e-05
AL359844-3|CAH72377.1|  783|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    47   8e-05
AF261917-1|AAF78930.2|  715|Homo sapiens RNA helicase II/Gu prot...    47   8e-05
X52104-1|CAA36324.1|  614|Homo sapiens protein ( Human mRNA for ...    46   1e-04
X15729-1|CAA33751.1|  614|Homo sapiens protein ( Human mRNA for ...    46   1e-04
BX571764-1|CAE11890.1|  406|Homo sapiens hypothetical protein pr...    46   1e-04
BT006943-1|AAP35589.1|  614|Homo sapiens DEAD/H (Asp-Glu-Ala-Asp...    46   1e-04
BC016027-1|AAH16027.1|  614|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    46   1e-04
AF015812-1|AAB84094.1|  614|Homo sapiens RNA helicase p68 protein.     46   1e-04
AB209919-1|BAD93156.1|  457|Homo sapiens Hypothetical protein DK...    46   1e-04
Z37166-1|CAA85523.1|  428|Homo sapiens nuclear RNA helicase (DEA...    46   1e-04
BX248516-3|CAI41922.1|  428|Homo sapiens HLA-B associated transc...    46   1e-04
BX248516-2|CAM25875.1|  186|Homo sapiens HLA-B associated transc...    46   1e-04
BX001040-6|CAI18634.1|  428|Homo sapiens HLA-B associated transc...    46   1e-04
BX001040-5|CAI18633.1|  161|Homo sapiens HLA-B associated transc...    46   1e-04
BT009909-1|AAP88911.1|  428|Homo sapiens HLA-B associated transc...    46   1e-04
BC013006-1|AAH13006.1|  428|Homo sapiens HLA-B associated transc...    46   1e-04
BC000361-1|AAH00361.1|  428|Homo sapiens HLA-B associated transc...    46   1e-04
BA000025-40|BAB63306.1|  428|Homo sapiens putative ATP-dependent...    46   1e-04
AL662847-20|CAI17664.2|  428|Homo sapiens HLA-B associated trans...    46   1e-04
AL662847-19|CAO72084.1|  186|Homo sapiens HLA-B associated trans...    46   1e-04
AL662801-3|CAI18280.1|  428|Homo sapiens HLA-B associated transc...    46   1e-04
AL662801-2|CAM25575.1|  186|Homo sapiens HLA-B associated transc...    46   1e-04
AK222912-1|BAD96632.1|  428|Homo sapiens HLA-B associated transc...    46   1e-04
AF029062-1|AAC63046.1|  284|Homo sapiens DEAD-box protein protein.     46   1e-04
AF029061-1|AAB94615.1|  284|Homo sapiens BAT1 protein.                 46   1e-04
AB202112-3|BAE78637.1|  428|Homo sapiens HLA-B associated transc...    46   1e-04
AB103621-3|BAF31287.1|  443|Homo sapiens BAT1 protein protein.         46   1e-04
AB088115-3|BAC54953.1|  428|Homo sapiens HLA-B associated transc...    46   1e-04
U90426-1|AAB50231.1|  427|Homo sapiens nuclear RNA helicase prot...    43   0.001
BX248516-4|CAI41924.2|  425|Homo sapiens HLA-B associated transc...    41   0.004
AL662847-21|CAI17672.2|  425|Homo sapiens HLA-B associated trans...    41   0.004
AL662801-4|CAI18284.2|  425|Homo sapiens HLA-B associated transc...    41   0.004
BC041785-1|AAH41785.1|  599|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    40   0.012
BC034953-1|AAH34953.1|  824|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    40   0.012
BC031062-1|AAH31062.1|  824|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    40   0.012
BC012304-1|AAH12304.1| 1031|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    40   0.012
BC011556-1|AAH11556.1|  824|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    40   0.012
BC002366-1|AAH02366.1|  820|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    40   0.012
AL049557-7|CAB55686.2|  824|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    40   0.012
AK001652-1|BAA91812.1|  491|Homo sapiens protein ( Homo sapiens ...    40   0.012
AK001506-1|BAA91727.1|  824|Homo sapiens protein ( Homo sapiens ...    40   0.012
AJ010840-1|CAA09374.1|  420|Homo sapiens ATP-dependent RNA helic...    40   0.012
AF171063-1|AAF14544.1|  824|Homo sapiens DEAD box RNA helicase G...    40   0.012
AF106680-1|AAD43033.1| 1031|Homo sapiens RNA helicase protein.         40   0.012
AF106019-1|AAD42744.1|  824|Homo sapiens DEAD-box protein protein.     40   0.012
AF026402-1|AAB87902.1|  820|Homo sapiens U5 snRNP 100 kD protein...    40   0.012
AB018344-1|BAA34521.2| 1058|Homo sapiens KIAA0801 protein protein.     40   0.012
AF155803-1|AAK56799.1|  824|Homo sapiens DEAD-box corepressor DP...    39   0.020
BC067878-1|AAH67878.1|  631|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    38   0.027
BC051703-1|AAH51703.1|  631|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    38   0.027
AY039237-1|AAK72102.1|  630|Homo sapiens DEAD-box protein CAGE p...    38   0.027
BX538033-1|CAD97978.1|  822|Homo sapiens hypothetical protein pr...    36   0.11 
BC093081-1|AAH93081.1|  938|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    36   0.19 
BC078667-1|AAH78667.1|  919|Homo sapiens DDX42 protein protein.        36   0.19 
BC031004-1|AAH31004.1|  348|Homo sapiens HELLS protein protein.        36   0.19 
BC030963-1|AAH30963.1|  348|Homo sapiens HELLS protein protein.        36   0.19 
BC029381-1|AAH29381.1|  348|Homo sapiens HELLS protein protein.        36   0.19 
BC015505-1|AAH15505.1|  819|Homo sapiens DDX42 protein protein.        36   0.19 
BC015477-1|AAH15477.1|  317|Homo sapiens HELLS protein protein.        36   0.19 
AY007108-1|AAG01987.1|  348|Homo sapiens protein ( Homo sapiens ...    36   0.19 
AL138759-4|CAH70224.1|  310|Homo sapiens helicase, lymphoid-spec...    36   0.19 
AL138759-1|CAD13191.1|  838|Homo sapiens helicase, lymphoid-spec...    36   0.19 
AK001201-1|BAA91550.1|  310|Homo sapiens protein ( Homo sapiens ...    36   0.19 
AF155827-1|AAF82262.1|  838|Homo sapiens proliferation-associate...    36   0.19 
AF083255-1|AAC32396.1|  709|Homo sapiens RNA helicase-related pr...    36   0.19 
AB208938-1|BAD92175.1|  512|Homo sapiens ATP-dependent RNA helic...    36   0.19 
AB113249-1|BAD24805.1|  782|Homo sapiens lymphoid specific helic...    36   0.19 
AB113248-1|BAD24804.1|  809|Homo sapiens lymphoid specific helic...    36   0.19 
AB102723-1|BAD10851.1|  884|Homo sapiens lymphoid specific helic...    36   0.19 
AB102721-1|BAD10849.1|  740|Homo sapiens lymphoid specific helic...    36   0.19 
AB102719-1|BAD10847.1|  708|Homo sapiens lymphoid specific helic...    36   0.19 
AB102718-1|BAD10846.1|  806|Homo sapiens lymphoid specific helic...    36   0.19 
AB074174-1|BAE45737.1|  372|Homo sapiens putative protein produc...    36   0.19 
AB036090-1|BAC66466.1|  938|Homo sapiens RNA helicase-related pr...    36   0.19 
AK223116-1|BAD96836.1|  408|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    35   0.33 
AK000603-1|BAA91284.1|  406|Homo sapiens protein ( Homo sapiens ...    35   0.33 
BC068009-1|AAH68009.1|  455|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    34   0.44 
BC009379-1|AAH09379.2|  450|Homo sapiens DDX47 protein protein.        34   0.44 
AL136666-1|CAB66601.1|  455|Homo sapiens hypothetical protein pr...    34   0.44 
AK222940-1|BAD96660.1|  448|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    34   0.44 
AK054574-1|BAB70762.1|  455|Homo sapiens protein ( Homo sapiens ...    34   0.44 
AJ276704-1|CAC14786.1|  455|Homo sapiens DEAD box protein protein.     34   0.44 
AF078843-1|AAF23354.1|  274|Homo sapiens hqp0256 protein protein.      34   0.44 
AK222662-1|BAD96382.1|  547|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    34   0.58 
CR457213-1|CAG33494.1|  547|Homo sapiens DDX56 protein.                33   0.77 
BC130275-1|AAI30276.1|  796|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    33   0.77 
BC126287-1|AAI26288.1|  796|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    33   0.77 
BC016060-1|AAH16060.2|  767|Homo sapiens DDX27 protein protein.        33   0.77 
BC011927-1|AAH11927.2|  767|Homo sapiens DDX27 protein protein.        33   0.77 
BC009304-1|AAH09304.2|  769|Homo sapiens DDX27 protein protein.        33   0.77 
BC002674-1|AAH02674.1|  483|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    33   0.77 
BC001235-1|AAH01235.1|  547|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    33   0.77 
BC000979-1|AAH00979.2|  254|Homo sapiens DDX49 protein protein.        33   0.77 
AY044431-1|AAK95821.1|  796|Homo sapiens RNA helicase-like prote...    33   0.77 
AL357560-1|CAH70236.1|  796|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    33   0.77 
AL049766-1|CAI22427.1|  796|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    33   0.77 
AK223294-1|BAD97014.1|  483|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    33   0.77 
AK022979-1|BAB14343.1|  765|Homo sapiens protein ( Homo sapiens ...    33   0.77 
AK022774-1|BAB14238.1|  547|Homo sapiens protein ( Homo sapiens ...    33   0.77 
AJ131712-1|CAB87992.1|  547|Homo sapiens nucleolar RNA-helicase ...    33   0.77 
AF336851-1|AAK21271.1|  561|Homo sapiens RNA helicase-like prote...    33   0.77 
AF247666-1|AAG36876.1|  547|Homo sapiens DEAD-box RNA helicase p...    33   0.77 
AC002985-2|AAB81544.1|  483|Homo sapiens R27090_2 protein.             33   0.77 
BC041801-1|AAH41801.1|  619|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    33   1.3  
AL445483-6|CAI17056.1|  619|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    33   1.3  
AL445483-4|CAI17054.1|  196|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    33   1.3  
BC040185-1|AAH40185.1|  666|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    32   1.8  
BC012461-1|AAH12461.2|  186|Homo sapiens DDX51 protein protein.        32   1.8  
AK097078-1|BAC04942.1|  666|Homo sapiens protein ( Homo sapiens ...    32   1.8  
BX641072-1|CAE46035.1|  496|Homo sapiens hypothetical protein pr...    31   3.1  
BC030020-1|AAH30020.1|  600|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    31   3.1  
BC015476-1|AAH15476.1|  622|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    31   3.1  
BC005848-1|AAH05848.2|  864|Homo sapiens DDX54 protein protein.        31   3.1  
AY148094-1|AAN59978.1|  865|Homo sapiens DEAD box RNA helicase D...    31   3.1  
AL445483-5|CAI17055.1|  580|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    31   3.1  
AL445483-3|CAI17051.1|  205|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    31   3.1  
AL445483-2|CAI17050.1|   93|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    31   3.1  
AL137455-1|CAB70746.1|  240|Homo sapiens hypothetical protein pr...    31   3.1  
AK222598-1|BAD96318.1|  622|Homo sapiens DEAD-box protein abstra...    31   3.1  
AK131442-1|BAD18588.1|  267|Homo sapiens protein ( Homo sapiens ...    31   3.1  
AK074219-1|BAB85021.1|  353|Homo sapiens protein ( Homo sapiens ...    31   3.1  
AK027768-1|BAB55355.1|  622|Homo sapiens protein ( Homo sapiens ...    31   3.1  
AK001255-1|BAA91585.1|  622|Homo sapiens protein ( Homo sapiens ...    31   3.1  
AF478457-1|AAL85336.1|  882|Homo sapiens ATP-dependent RNA helic...    31   3.1  
AF195417-1|AAF04150.1|  621|Homo sapiens DEAD-box protein abstra...    31   3.1  
AB046815-1|BAB13421.1|  471|Homo sapiens KIAA1595 protein protein.     31   3.1  
X70649-1|CAA49992.1|  740|Homo sapiens member of DEAD box protei...    31   4.1  
EF418571-1|ABN70941.1|  740|Homo sapiens DEAD box polypeptide 1 ...    31   4.1  
EF418570-1|ABN70940.1|  740|Homo sapiens DEAD box polypeptide 1 ...    31   4.1  
BC053673-1|AAH53673.1|  740|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    31   4.1  
BC012132-1|AAH12132.1|  740|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    31   4.1  
BC101491-1|AAI01492.1|  327|Homo sapiens olfactory receptor, fam...    30   9.5  
BC101489-1|AAI01490.1|  327|Homo sapiens olfactory receptor, fam...    30   9.5  
AF321237-5|AAG45208.1|  327|Homo sapiens hI7 olfactory receptor ...    30   9.5  
AB065822-1|BAC06041.1|  327|Homo sapiens seven transmembrane hel...    30   9.5  

>D13748-1|BAA02897.1|  406|Homo sapiens eukaryotic initiation factor
           4AI protein.
          Length = 406

 Score =  149 bits (362), Expect = 7e-36
 Identities = 67/82 (81%), Positives = 76/82 (92%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FYI +E EEWKL+TLCDLY+TL+I QAVIF NTRRKVDWLTE MH RDFTVSAMHGDMD
Sbjct: 248 QFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSAMHGDMD 307

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q+ER+VIMR+FR+GSSRVLITT
Sbjct: 308 QKERDVIMREFRSGSSRVLITT 329



 Score = 90.6 bits (215), Expect = 5e-18
 Identities = 46/76 (60%), Positives = 52/76 (68%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           LLARGIDVQQVS VINYDLP+NRENY                 N VTE D+R L+DIE F
Sbjct: 331 LLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEEDKRTLRDIETF 390

Query: 436 YHTSIVEMPSDVANLI 483
           Y+TSI EMP +VA+LI
Sbjct: 391 YNTSIEEMPLNVADLI 406


>BT019881-1|AAV38684.1|  406|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 1 protein.
          Length = 406

 Score =  149 bits (362), Expect = 7e-36
 Identities = 67/82 (81%), Positives = 76/82 (92%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FYI +E EEWKL+TLCDLY+TL+I QAVIF NTRRKVDWLTE MH RDFTVSAMHGDMD
Sbjct: 248 QFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSAMHGDMD 307

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q+ER+VIMR+FR+GSSRVLITT
Sbjct: 308 QKERDVIMREFRSGSSRVLITT 329



 Score = 90.6 bits (215), Expect = 5e-18
 Identities = 46/76 (60%), Positives = 52/76 (68%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           LLARGIDVQQVS VINYDLP+NRENY                 N VTE D+R L+DIE F
Sbjct: 331 LLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEEDKRTLRDIETF 390

Query: 436 YHTSIVEMPSDVANLI 483
           Y+TSI EMP +VA+LI
Sbjct: 391 YNTSIEEMPLNVADLI 406


>BT019880-1|AAV38683.1|  406|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 1 protein.
          Length = 406

 Score =  149 bits (362), Expect = 7e-36
 Identities = 67/82 (81%), Positives = 76/82 (92%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FYI +E EEWKL+TLCDLY+TL+I QAVIF NTRRKVDWLTE MH RDFTVSAMHGDMD
Sbjct: 248 QFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSAMHGDMD 307

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q+ER+VIMR+FR+GSSRVLITT
Sbjct: 308 QKERDVIMREFRSGSSRVLITT 329



 Score = 90.6 bits (215), Expect = 5e-18
 Identities = 46/76 (60%), Positives = 52/76 (68%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           LLARGIDVQQVS VINYDLP+NRENY                 N VTE D+R L+DIE F
Sbjct: 331 LLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEEDKRTLRDIETF 390

Query: 436 YHTSIVEMPSDVANLI 483
           Y+TSI EMP +VA+LI
Sbjct: 391 YNTSIEEMPLNVADLI 406


>BC073752-1|AAH73752.1|  406|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 1 protein.
          Length = 406

 Score =  149 bits (362), Expect = 7e-36
 Identities = 67/82 (81%), Positives = 76/82 (92%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FYI +E EEWKL+TLCDLY+TL+I QAVIF NTRRKVDWLTE MH RDFTVSAMHGDMD
Sbjct: 248 QFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSAMHGDMD 307

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q+ER+VIMR+FR+GSSRVLITT
Sbjct: 308 QKERDVIMREFRSGSSRVLITT 329



 Score = 90.6 bits (215), Expect = 5e-18
 Identities = 46/76 (60%), Positives = 52/76 (68%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           LLARGIDVQQVS VINYDLP+NRENY                 N VTE D+R L+DIE F
Sbjct: 331 LLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEEDKRTLRDIETF 390

Query: 436 YHTSIVEMPSDVANLI 483
           Y+TSI EMP +VA+LI
Sbjct: 391 YNTSIEEMPLNVADLI 406


>BC009585-1|AAH09585.1|  406|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 1 protein.
          Length = 406

 Score =  149 bits (362), Expect = 7e-36
 Identities = 67/82 (81%), Positives = 76/82 (92%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FYI +E EEWKL+TLCDLY+TL+I QAVIF NTRRKVDWLTE MH RDFTVSAMHGDMD
Sbjct: 248 QFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSAMHGDMD 307

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q+ER+VIMR+FR+GSSRVLITT
Sbjct: 308 QKERDVIMREFRSGSSRVLITT 329



 Score = 90.6 bits (215), Expect = 5e-18
 Identities = 46/76 (60%), Positives = 52/76 (68%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           LLARGIDVQQVS VINYDLP+NRENY                 N VTE D+R L+DIE F
Sbjct: 331 LLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEEDKRTLRDIETF 390

Query: 436 YHTSIVEMPSDVANLI 483
           Y+TSI EMP +VA+LI
Sbjct: 391 YNTSIEEMPLNVADLI 406


>BC006380-1|AAH06380.1|  473|Homo sapiens Unknown (protein for
           IMAGE:4099962) protein.
          Length = 473

 Score =  149 bits (362), Expect = 7e-36
 Identities = 67/82 (81%), Positives = 76/82 (92%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FYI +E EEWKL+TLCDLY+TL+I QAVIF NTRRKVDWLTE MH RDFTVSAMHGDMD
Sbjct: 315 QFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSAMHGDMD 374

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q+ER+VIMR+FR+GSSRVLITT
Sbjct: 375 QKERDVIMREFRSGSSRVLITT 396



 Score = 90.6 bits (215), Expect = 5e-18
 Identities = 46/76 (60%), Positives = 52/76 (68%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           LLARGIDVQQVS VINYDLP+NRENY                 N VTE D+R L+DIE F
Sbjct: 398 LLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEEDKRTLRDIETF 457

Query: 436 YHTSIVEMPSDVANLI 483
           Y+TSI EMP +VA+LI
Sbjct: 458 YNTSIEEMPLNVADLI 473


>D30655-1|BAA06336.1|  407|Homo sapiens eukaryotic initiation factor
           4AII protein.
          Length = 407

 Score =  148 bits (359), Expect = 2e-35
 Identities = 66/82 (80%), Positives = 76/82 (92%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FYI +E EEWKL+TLCDLY+TL+I QAVIF NTRRKVDWLTE MH RDFTVSA+HGDMD
Sbjct: 249 QFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSALHGDMD 308

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q+ER+VIMR+FR+GSSRVLITT
Sbjct: 309 QKERDVIMREFRSGSSRVLITT 330



 Score = 91.5 bits (217), Expect = 3e-18
 Identities = 45/76 (59%), Positives = 53/76 (69%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           LLARGIDVQQVS VINYDLP+NRENY                 NFVTE D+R L+DIE F
Sbjct: 332 LLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINFVTEEDKRILRDIETF 391

Query: 436 YHTSIVEMPSDVANLI 483
           Y+T++ EMP +VA+LI
Sbjct: 392 YNTTVEEMPMNVADLI 407


>BT009860-1|AAP88862.1|  407|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 2 protein.
          Length = 407

 Score =  148 bits (359), Expect = 2e-35
 Identities = 66/82 (80%), Positives = 76/82 (92%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FYI +E EEWKL+TLCDLY+TL+I QAVIF NTRRKVDWLTE MH RDFTVSA+HGDMD
Sbjct: 249 QFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSALHGDMD 308

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q+ER+VIMR+FR+GSSRVLITT
Sbjct: 309 QKERDVIMREFRSGSSRVLITT 330



 Score = 91.5 bits (217), Expect = 3e-18
 Identities = 45/76 (59%), Positives = 53/76 (69%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           LLARGIDVQQVS VINYDLP+NRENY                 NFVTE D+R L+DIE F
Sbjct: 332 LLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINFVTEEDKRILRDIETF 391

Query: 436 YHTSIVEMPSDVANLI 483
           Y+T++ EMP +VA+LI
Sbjct: 392 YNTTVEEMPMNVADLI 407


>BC048105-1|AAH48105.1|  408|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 2 protein.
          Length = 408

 Score =  148 bits (359), Expect = 2e-35
 Identities = 66/82 (80%), Positives = 76/82 (92%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FYI +E EEWKL+TLCDLY+TL+I QAVIF NTRRKVDWLTE MH RDFTVSA+HGDMD
Sbjct: 250 QFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSALHGDMD 309

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q+ER+VIMR+FR+GSSRVLITT
Sbjct: 310 QKERDVIMREFRSGSSRVLITT 331



 Score = 91.5 bits (217), Expect = 3e-18
 Identities = 45/76 (59%), Positives = 53/76 (69%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           LLARGIDVQQVS VINYDLP+NRENY                 NFVTE D+R L+DIE F
Sbjct: 333 LLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINFVTEEDKRILRDIETF 392

Query: 436 YHTSIVEMPSDVANLI 483
           Y+T++ EMP +VA+LI
Sbjct: 393 YNTTVEEMPMNVADLI 408


>BC016295-1|AAH16295.1|  179|Homo sapiens EIF4A2 protein protein.
          Length = 179

 Score =  148 bits (359), Expect = 2e-35
 Identities = 66/82 (80%), Positives = 76/82 (92%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FYI +E EEWKL+TLCDLY+TL+I QAVIF NTRRKVDWLTE MH RDFTVSA+HGDMD
Sbjct: 21  QFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSALHGDMD 80

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q+ER+VIMR+FR+GSSRVLITT
Sbjct: 81  QKERDVIMREFRSGSSRVLITT 102



 Score = 91.5 bits (217), Expect = 3e-18
 Identities = 45/76 (59%), Positives = 53/76 (69%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           LLARGIDVQQVS VINYDLP+NRENY                 NFVTE D+R L+DIE F
Sbjct: 104 LLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINFVTEEDKRILRDIETF 163

Query: 436 YHTSIVEMPSDVANLI 483
           Y+T++ EMP +VA+LI
Sbjct: 164 YNTTVEEMPMNVADLI 179


>BC015842-1|AAH15842.1|  407|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 2 protein.
          Length = 407

 Score =  148 bits (359), Expect = 2e-35
 Identities = 66/82 (80%), Positives = 76/82 (92%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FYI +E EEWKL+TLCDLY+TL+I QAVIF NTRRKVDWLTE MH RDFTVSA+HGDMD
Sbjct: 249 QFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSALHGDMD 308

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q+ER+VIMR+FR+GSSRVLITT
Sbjct: 309 QKERDVIMREFRSGSSRVLITT 330



 Score = 91.5 bits (217), Expect = 3e-18
 Identities = 45/76 (59%), Positives = 53/76 (69%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           LLARGIDVQQVS VINYDLP+NRENY                 NFVTE D+R L+DIE F
Sbjct: 332 LLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINFVTEEDKRILRDIETF 391

Query: 436 YHTSIVEMPSDVANLI 483
           Y+T++ EMP +VA+LI
Sbjct: 392 YNTTVEEMPMNVADLI 407


>BC013708-1|AAH13708.1|  407|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 2 protein.
          Length = 407

 Score =  148 bits (359), Expect = 2e-35
 Identities = 66/82 (80%), Positives = 76/82 (92%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FYI +E EEWKL+TLCDLY+TL+I QAVIF NTRRKVDWLTE MH RDFTVSA+HGDMD
Sbjct: 249 QFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSALHGDMD 308

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q+ER+VIMR+FR+GSSRVLITT
Sbjct: 309 QKERDVIMREFRSGSSRVLITT 330



 Score = 91.5 bits (217), Expect = 3e-18
 Identities = 45/76 (59%), Positives = 53/76 (69%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           LLARGIDVQQVS VINYDLP+NRENY                 NFVTE D+R L+DIE F
Sbjct: 332 LLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINFVTEEDKRILRDIETF 391

Query: 436 YHTSIVEMPSDVANLI 483
           Y+T++ EMP +VA+LI
Sbjct: 392 YNTTVEEMPMNVADLI 407


>BC012547-1|AAH12547.1|  408|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 2 protein.
          Length = 408

 Score =  148 bits (359), Expect = 2e-35
 Identities = 66/82 (80%), Positives = 76/82 (92%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FYI +E EEWKL+TLCDLY+TL+I QAVIF NTRRKVDWLTE MH RDFTVSA+HGDMD
Sbjct: 250 QFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTVSALHGDMD 309

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q+ER+VIMR+FR+GSSRVLITT
Sbjct: 310 QKERDVIMREFRSGSSRVLITT 331



 Score = 91.5 bits (217), Expect = 3e-18
 Identities = 45/76 (59%), Positives = 53/76 (69%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           LLARGIDVQQVS VINYDLP+NRENY                 NFVTE D+R L+DIE F
Sbjct: 333 LLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINFVTEEDKRILRDIETF 392

Query: 436 YHTSIVEMPSDVANLI 483
           Y+T++ EMP +VA+LI
Sbjct: 393 YNTTVEEMPMNVADLI 408


>X79538-1|CAA56074.1|  411|Homo sapiens translation initiation
           factor protein.
          Length = 411

 Score =  138 bits (333), Expect = 2e-32
 Identities = 59/85 (69%), Positives = 74/85 (87%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +F++A+E EEWK +TLCDLYDTL+I QAVIFCNT+RKVDWLTE M   +FTVS+MHGDM 
Sbjct: 253 QFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMP 312

Query: 188 QREREVIMRQFRTGSSRVLITTVYW 262
           Q+ERE IM++FR+G+SRVLI+T  W
Sbjct: 313 QKERESIMKEFRSGASRVLISTDVW 337



 Score = 72.1 bits (169), Expect = 2e-12
 Identities = 37/74 (50%), Positives = 44/74 (59%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+DV QVS +INYDLP+NRE Y                 NFV   D R L+DIE +Y 
Sbjct: 338 ARGLDVPQVSLIINYDLPNNRELYIHRIGRSGQYGRKGVAINFVKNDDIRILRDIEQYYS 397

Query: 442 TSIVEMPSDVANLI 483
           T I EMP +VA+LI
Sbjct: 398 TQIDEMPMNVADLI 411


>D21853-1|BAA04879.2|  412|Homo sapiens KIAA0111 protein.
          Length = 412

 Score =  138 bits (333), Expect = 2e-32
 Identities = 59/85 (69%), Positives = 74/85 (87%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +F++A+E EEWK +TLCDLYDTL+I QAVIFCNT+RKVDWLTE M   +FTVS+MHGDM 
Sbjct: 254 QFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMP 313

Query: 188 QREREVIMRQFRTGSSRVLITTVYW 262
           Q+ERE IM++FR+G+SRVLI+T  W
Sbjct: 314 QKERESIMKEFRSGASRVLISTDVW 338



 Score = 72.1 bits (169), Expect = 2e-12
 Identities = 37/74 (50%), Positives = 44/74 (59%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+DV QVS +INYDLP+NRE Y                 NFV   D R L+DIE +Y 
Sbjct: 339 ARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYS 398

Query: 442 TSIVEMPSDVANLI 483
           T I EMP +VA+LI
Sbjct: 399 TQIDEMPMNVADLI 412


>CR456750-1|CAG33031.1|  411|Homo sapiens DDX48 protein.
          Length = 411

 Score =  138 bits (333), Expect = 2e-32
 Identities = 59/85 (69%), Positives = 74/85 (87%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +F++A+E EEWK +TLCDLYDTL+I QAVIFCNT+RKVDWLTE M   +FTVS+MHGDM 
Sbjct: 253 QFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMP 312

Query: 188 QREREVIMRQFRTGSSRVLITTVYW 262
           Q+ERE IM++FR+G+SRVLI+T  W
Sbjct: 313 QKERESIMKEFRSGASRVLISTDVW 337



 Score = 72.1 bits (169), Expect = 2e-12
 Identities = 37/74 (50%), Positives = 44/74 (59%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+DV QVS +INYDLP+NRE Y                 NFV   D R L+DIE +Y 
Sbjct: 338 ARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYS 397

Query: 442 TSIVEMPSDVANLI 483
           T I EMP +VA+LI
Sbjct: 398 TQIDEMPMNVADLI 411


>BC011151-1|AAH11151.1|  411|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 3 protein.
          Length = 411

 Score =  138 bits (333), Expect = 2e-32
 Identities = 59/85 (69%), Positives = 74/85 (87%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +F++A+E EEWK +TLCDLYDTL+I QAVIFCNT+RKVDWLTE M   +FTVS+MHGDM 
Sbjct: 253 QFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMP 312

Query: 188 QREREVIMRQFRTGSSRVLITTVYW 262
           Q+ERE IM++FR+G+SRVLI+T  W
Sbjct: 313 QKERESIMKEFRSGASRVLISTDVW 337



 Score = 72.1 bits (169), Expect = 2e-12
 Identities = 37/74 (50%), Positives = 44/74 (59%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+DV QVS +INYDLP+NRE Y                 NFV   D R L+DIE +Y 
Sbjct: 338 ARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYS 397

Query: 442 TSIVEMPSDVANLI 483
           T I EMP +VA+LI
Sbjct: 398 TQIDEMPMNVADLI 411


>BC004386-1|AAH04386.1|  411|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 3 protein.
          Length = 411

 Score =  138 bits (333), Expect = 2e-32
 Identities = 59/85 (69%), Positives = 74/85 (87%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +F++A+E EEWK +TLCDLYDTL+I QAVIFCNT+RKVDWLTE M   +FTVS+MHGDM 
Sbjct: 253 QFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMP 312

Query: 188 QREREVIMRQFRTGSSRVLITTVYW 262
           Q+ERE IM++FR+G+SRVLI+T  W
Sbjct: 313 QKERESIMKEFRSGASRVLISTDVW 337



 Score = 72.1 bits (169), Expect = 2e-12
 Identities = 37/74 (50%), Positives = 44/74 (59%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+DV QVS +INYDLP+NRE Y                 NFV   D R L+DIE +Y 
Sbjct: 338 ARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYS 397

Query: 442 TSIVEMPSDVANLI 483
           T I EMP +VA+LI
Sbjct: 398 TQIDEMPMNVADLI 411


>BC003662-1|AAH03662.1|  411|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 3 protein.
          Length = 411

 Score =  138 bits (333), Expect = 2e-32
 Identities = 59/85 (69%), Positives = 74/85 (87%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +F++A+E EEWK +TLCDLYDTL+I QAVIFCNT+RKVDWLTE M   +FTVS+MHGDM 
Sbjct: 253 QFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMP 312

Query: 188 QREREVIMRQFRTGSSRVLITTVYW 262
           Q+ERE IM++FR+G+SRVLI+T  W
Sbjct: 313 QKERESIMKEFRSGASRVLISTDVW 337



 Score = 72.1 bits (169), Expect = 2e-12
 Identities = 37/74 (50%), Positives = 44/74 (59%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+DV QVS +INYDLP+NRE Y                 NFV   D R L+DIE +Y 
Sbjct: 338 ARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYS 397

Query: 442 TSIVEMPSDVANLI 483
           T I EMP +VA+LI
Sbjct: 398 TQIDEMPMNVADLI 411


>AB209593-1|BAD92830.1|  375|Homo sapiens CD68 antigen variant
           protein.
          Length = 375

 Score =  100 bits (239), Expect(2) = 9e-31
 Identities = 44/55 (80%), Positives = 49/55 (89%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAM 172
           +FYI +E EEWKL+TLCDLY+TL+I QAVIF NTRRKVDWLTE MH RDFTVSAM
Sbjct: 246 QFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSAM 300



 Score = 53.6 bits (123), Expect(2) = 9e-31
 Identities = 23/27 (85%), Positives = 27/27 (100%)
 Frame = +2

Query: 173 HGDMDQREREVIMRQFRTGSSRVLITT 253
           HGDMDQ+ER+VIMR+FR+GSSRVLITT
Sbjct: 341 HGDMDQKERDVIMREFRSGSSRVLITT 367


>BC050360-1|AAH50360.2|  369|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 25 protein.
          Length = 369

 Score = 72.9 bits (171), Expect = 1e-12
 Identities = 32/82 (39%), Positives = 51/82 (62%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+  E  + K + LC++Y +++I QA+IFC TRR   WLT  M      VS + G++ 
Sbjct: 200 QYYVLCEHRKDKYQALCNIYGSITIGQAIIFCQTRRNAKWLTVEMIQDGHQVSLLSGELT 259

Query: 188 QREREVIMRQFRTGSSRVLITT 253
             +R  I+++FR G  +VLITT
Sbjct: 260 VEQRASIIQRFRDGKEKVLITT 281



 Score = 35.1 bits (77), Expect = 0.25
 Identities = 21/75 (28%), Positives = 37/75 (49%), Gaps = 6/75 (8%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNR------ENYXXXXXXXXXXXXXXXXXNFVTEADRRALKD 423
           ARGIDV+QV+ V+N+DLP  +      E Y                 N +   +  +L  
Sbjct: 285 ARGIDVKQVTIVVNFDLPVKQGEEPDYETYLHRIGRTGRFGKKGLAFNMIEVDELPSLMK 344

Query: 424 IEDFYHTSIVEMPSD 468
           I+D +++SI ++ ++
Sbjct: 345 IQDHFNSSIKQLNAE 359


>BC035388-1|AAH35388.2|  369|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 25 protein.
          Length = 369

 Score = 72.9 bits (171), Expect = 1e-12
 Identities = 32/82 (39%), Positives = 51/82 (62%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+  E  + K + LC++Y +++I QA+IFC TRR   WLT  M      VS + G++ 
Sbjct: 200 QYYVLCEHRKDKYQALCNIYGSITIGQAIIFCQTRRNAKWLTVEMIQDGHQVSLLSGELT 259

Query: 188 QREREVIMRQFRTGSSRVLITT 253
             +R  I+++FR G  +VLITT
Sbjct: 260 VEQRASIIQRFRDGKEKVLITT 281



 Score = 35.1 bits (77), Expect = 0.25
 Identities = 21/75 (28%), Positives = 37/75 (49%), Gaps = 6/75 (8%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNR------ENYXXXXXXXXXXXXXXXXXNFVTEADRRALKD 423
           ARGIDV+QV+ V+N+DLP  +      E Y                 N +   +  +L  
Sbjct: 285 ARGIDVKQVTIVVNFDLPVKQGEEPDYETYLHRIGRTGRFGKKGLAFNMIEVDELPSLMK 344

Query: 424 IEDFYHTSIVEMPSD 468
           I+D +++SI ++ ++
Sbjct: 345 IQDHFNSSIKQLNAE 359


>AY735312-1|AAU84667.1|  483|Homo sapiens gonadotropin-regulated
           testicular RNA helicase-GRTH/DDX25 protein.
          Length = 483

 Score = 72.1 bits (169), Expect = 2e-12
 Identities = 32/82 (39%), Positives = 50/82 (60%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+  E  + K + LC++Y +++I QA+IFC TRR   WLT  M      VS + G++ 
Sbjct: 314 QYYVLCEHRKDKYQALCNIYGSITIGQAIIFCQTRRNAKWLTVEMIQDGHQVSLLSGELT 373

Query: 188 QREREVIMRQFRTGSSRVLITT 253
             +R  I ++FR G  +VLITT
Sbjct: 374 VEQRASITQRFRDGKEKVLITT 395



 Score = 35.1 bits (77), Expect = 0.25
 Identities = 21/75 (28%), Positives = 37/75 (49%), Gaps = 6/75 (8%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNR------ENYXXXXXXXXXXXXXXXXXNFVTEADRRALKD 423
           ARGIDV+QV+ V+N+DLP  +      E Y                 N +   +  +L  
Sbjct: 399 ARGIDVKQVTIVVNFDLPVKQGEEPDYETYLHRIGRTGRFGKKGLAFNMIEVDELPSLMK 458

Query: 424 IEDFYHTSIVEMPSD 468
           I+D +++SI ++ ++
Sbjct: 459 IQDHFNSSIKQLNAE 473


>AF155140-1|AAF21371.2|  483|Homo sapiens gonadotropin-regulated
           testicular RNA helicase protein.
          Length = 483

 Score = 72.1 bits (169), Expect = 2e-12
 Identities = 32/82 (39%), Positives = 50/82 (60%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+  E  + K + LC++Y +++I QA+IFC TRR   WLT  M      VS + G++ 
Sbjct: 314 QYYVLCEHRKDKYQALCNIYGSITIGQAIIFCQTRRNAKWLTVEMIQDGHQVSLLSGELT 373

Query: 188 QREREVIMRQFRTGSSRVLITT 253
             +R  I ++FR G  +VLITT
Sbjct: 374 VEQRASITQRFRDGKEKVLITT 395



 Score = 35.1 bits (77), Expect = 0.25
 Identities = 21/75 (28%), Positives = 37/75 (49%), Gaps = 6/75 (8%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNR------ENYXXXXXXXXXXXXXXXXXNFVTEADRRALKD 423
           ARGIDV+QV+ V+N+DLP  +      E Y                 N +   +  +L  
Sbjct: 399 ARGIDVKQVTIVVNFDLPVKQGEEPDYETYLHRIGRTGRFGKKGLAFNMIEVDELPSLMK 458

Query: 424 IEDFYHTSIVEMPSD 468
           I+D +++SI ++ ++
Sbjct: 459 IQDHFNSSIKQLNAE 473


>BC110805-1|AAI10806.1|  449|Homo sapiens DDX19B protein protein.
          Length = 449

 Score = 70.5 bits (165), Expect = 5e-12
 Identities = 28/82 (34%), Positives = 49/82 (59%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+     + K + LC+LY  ++IAQA+IFC+TR+   WL   +      V+ + G+M 
Sbjct: 279 QYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMM 338

Query: 188 QREREVIMRQFRTGSSRVLITT 253
             +R  ++ +FR G  +VL+TT
Sbjct: 339 VEQRAAVIERFREGKEKVLVTT 360



 Score = 36.3 bits (80), Expect = 0.11
 Identities = 15/22 (68%), Positives = 20/22 (90%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRE 327
           ARGIDV+QVS VIN+DLP +++
Sbjct: 364 ARGIDVEQVSVVINFDLPVDKD 385


>BC010008-1|AAH10008.1|  370|Homo sapiens DEAD (Asp-Glu-Ala-As) box
           polypeptide 19B protein.
          Length = 370

 Score = 70.5 bits (165), Expect = 5e-12
 Identities = 28/82 (34%), Positives = 49/82 (59%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+     + K + LC+LY  ++IAQA+IFC+TR+   WL   +      V+ + G+M 
Sbjct: 200 QYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMM 259

Query: 188 QREREVIMRQFRTGSSRVLITT 253
             +R  ++ +FR G  +VL+TT
Sbjct: 260 VEQRAAVIERFREGKEKVLVTT 281



 Score = 36.3 bits (80), Expect = 0.11
 Identities = 15/22 (68%), Positives = 20/22 (90%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRE 327
           ARGIDV+QVS VIN+DLP +++
Sbjct: 285 ARGIDVEQVSVVINFDLPVDKD 306


>BC006544-1|AAH06544.1|  478|Homo sapiens DEAD (Asp-Glu-Ala-As) box
           polypeptide 19A protein.
          Length = 478

 Score = 70.5 bits (165), Expect = 5e-12
 Identities = 28/82 (34%), Positives = 49/82 (59%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+     + K + LC+LY  ++IAQA+IFC+TR+   WL   +      V+ + G+M 
Sbjct: 308 QYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMM 367

Query: 188 QREREVIMRQFRTGSSRVLITT 253
             +R  ++ +FR G  +VL+TT
Sbjct: 368 VEQRAAVIERFREGKEKVLVTT 389



 Score = 36.3 bits (80), Expect = 0.11
 Identities = 15/22 (68%), Positives = 20/22 (90%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRE 327
           ARGIDV+QVS VIN+DLP +++
Sbjct: 393 ARGIDVEQVSVVINFDLPVDKD 414


>BC005162-1|AAH05162.1|  478|Homo sapiens DEAD (Asp-Glu-Ala-As) box
           polypeptide 19A protein.
          Length = 478

 Score = 70.5 bits (165), Expect = 5e-12
 Identities = 28/82 (34%), Positives = 49/82 (59%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+     + K + LC+LY  ++IAQA+IFC+TR+   WL   +      V+ + G+M 
Sbjct: 308 QYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMM 367

Query: 188 QREREVIMRQFRTGSSRVLITT 253
             +R  ++ +FR G  +VL+TT
Sbjct: 368 VEQRAAVIERFREGKEKVLVTT 389



 Score = 36.3 bits (80), Expect = 0.11
 Identities = 15/22 (68%), Positives = 20/22 (90%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRE 327
           ARGIDV+QVS VIN+DLP +++
Sbjct: 393 ARGIDVEQVSVVINFDLPVDKD 414


>BC003626-1|AAH03626.1|  479|Homo sapiens DEAD (Asp-Glu-Ala-As) box
           polypeptide 19B protein.
          Length = 479

 Score = 70.5 bits (165), Expect = 5e-12
 Identities = 28/82 (34%), Positives = 49/82 (59%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+     + K + LC+LY  ++IAQA+IFC+TR+   WL   +      V+ + G+M 
Sbjct: 309 QYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMM 368

Query: 188 QREREVIMRQFRTGSSRVLITT 253
             +R  ++ +FR G  +VL+TT
Sbjct: 369 VEQRAAVIERFREGKEKVLVTT 390



 Score = 36.3 bits (80), Expect = 0.11
 Identities = 15/22 (68%), Positives = 20/22 (90%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRE 327
           ARGIDV+QVS VIN+DLP +++
Sbjct: 394 ARGIDVEQVSVVINFDLPVDKD 415


>AK223262-1|BAD96982.1|  478|Homo sapiens DDX19-like protein variant
           protein.
          Length = 478

 Score = 70.5 bits (165), Expect = 5e-12
 Identities = 28/82 (34%), Positives = 49/82 (59%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+     + K + LC+LY  ++IAQA+IFC+TR+   WL   +      V+ + G+M 
Sbjct: 308 QYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMM 367

Query: 188 QREREVIMRQFRTGSSRVLITT 253
             +R  ++ +FR G  +VL+TT
Sbjct: 368 VEQRAAVIERFREGKEKVLVTT 389



 Score = 36.3 bits (80), Expect = 0.11
 Identities = 15/22 (68%), Positives = 20/22 (90%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRE 327
           ARGIDV+QVS VIN+DLP +++
Sbjct: 393 ARGIDVEQVSVVINFDLPVDKD 414


>AK223115-1|BAD96835.1|  479|Homo sapiens DEAD (Asp-Glu-Ala-As) box
           polypeptide 19 variant protein.
          Length = 479

 Score = 70.5 bits (165), Expect = 5e-12
 Identities = 28/82 (34%), Positives = 49/82 (59%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+     + K + LC+LY  ++IAQA+IFC+TR+   WL   +      V+ + G+M 
Sbjct: 309 QYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMM 368

Query: 188 QREREVIMRQFRTGSSRVLITT 253
             +R  ++ +FR G  +VL+TT
Sbjct: 369 VEQRAAVIERFREGKEKVLVTT 390



 Score = 36.3 bits (80), Expect = 0.11
 Identities = 15/22 (68%), Positives = 19/22 (86%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRE 327
           ARGIDV+QVS V N+DLP N++
Sbjct: 394 ARGIDVEQVSVVTNFDLPVNKD 415


>AK001988-1|BAA92022.1|  478|Homo sapiens protein ( Homo sapiens
           cDNA FLJ11126 fis, clone PLACE1006196, weakly similar to
           PUTATIVE ATP-DEPENDENT RNA HELICASE C12C2.06. ).
          Length = 478

 Score = 70.5 bits (165), Expect = 5e-12
 Identities = 28/82 (34%), Positives = 49/82 (59%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+     + K + LC+LY  ++IAQA+IFC+TR+   WL   +      V+ + G+M 
Sbjct: 308 QYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMM 367

Query: 188 QREREVIMRQFRTGSSRVLITT 253
             +R  ++ +FR G  +VL+TT
Sbjct: 368 VEQRAAVIERFREGKEKVLVTT 389



 Score = 36.3 bits (80), Expect = 0.11
 Identities = 15/22 (68%), Positives = 20/22 (90%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRE 327
           ARGIDV+QVS VIN+DLP +++
Sbjct: 393 ARGIDVEQVSVVINFDLPVDKD 414


>AJ237946-1|CAB52189.1|  479|Homo sapiens DEAD Box Protein 5
           protein.
          Length = 479

 Score = 70.5 bits (165), Expect = 5e-12
 Identities = 28/82 (34%), Positives = 49/82 (59%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+     + K + LC+LY  ++IAQA+IFC+TR+   WL   +      V+ + G+M 
Sbjct: 309 QYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMM 368

Query: 188 QREREVIMRQFRTGSSRVLITT 253
             +R  ++ +FR G  +VL+TT
Sbjct: 369 VEQRAAVIERFREGKEKVLVTT 390



 Score = 36.3 bits (80), Expect = 0.11
 Identities = 15/22 (68%), Positives = 20/22 (90%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRE 327
           ARGIDV+QVS VIN+DLP +++
Sbjct: 394 ARGIDVEQVSVVINFDLPVDKD 415


>AF353720-1|AAK40102.1|  370|Homo sapiens testicular DEAD-box
           helicase protein protein.
          Length = 370

 Score = 70.5 bits (165), Expect = 5e-12
 Identities = 28/82 (34%), Positives = 49/82 (59%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+     + K + LC+LY  ++IAQA+IFC+TR+   WL   +      V+ + G+M 
Sbjct: 200 QYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMM 259

Query: 188 QREREVIMRQFRTGSSRVLITT 253
             +R  ++ +FR G  +VL+TT
Sbjct: 260 VEQRAAVIERFREGKEKVLVTT 281



 Score = 36.3 bits (80), Expect = 0.11
 Identities = 15/22 (68%), Positives = 20/22 (90%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRE 327
           ARGIDV+QVS VIN+DLP +++
Sbjct: 285 ARGIDVEQVSVVINFDLPVDKD 306


>AB209401-1|BAD92638.1|  313|Homo sapiens DDX19-like protein variant
           protein.
          Length = 313

 Score = 70.5 bits (165), Expect = 5e-12
 Identities = 28/82 (34%), Positives = 49/82 (59%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+     + K + LC+LY  ++IAQA+IFC+TR+   WL   +      V+ + G+M 
Sbjct: 143 QYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMM 202

Query: 188 QREREVIMRQFRTGSSRVLITT 253
             +R  ++ +FR G  +VL+TT
Sbjct: 203 VEQRAAVIERFREGKEKVLVTT 224



 Score = 36.3 bits (80), Expect = 0.11
 Identities = 15/22 (68%), Positives = 20/22 (90%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRE 327
           ARGIDV+QVS VIN+DLP +++
Sbjct: 228 ARGIDVEQVSVVINFDLPVDKD 249


>CR457215-1|CAG33496.1|  479|Homo sapiens DDX19 protein.
          Length = 479

 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 28/82 (34%), Positives = 48/82 (58%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+     + K + LC+LY   +IAQA+IFC+TR+   WL   +      V+ + G+M 
Sbjct: 309 QYYVLCSSRDEKFQALCNLYGATTIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMM 368

Query: 188 QREREVIMRQFRTGSSRVLITT 253
             +R  ++ +FR G  +VL+TT
Sbjct: 369 VEQRAAVIERFREGKEKVLVTT 390



 Score = 36.3 bits (80), Expect = 0.11
 Identities = 15/22 (68%), Positives = 20/22 (90%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRE 327
           ARGIDV+QVS VIN+DLP +++
Sbjct: 394 ARGIDVEQVSVVINFDLPVDKD 415


>AF183422-1|AAG09691.1|  478|Homo sapiens RNA helicase protein.
          Length = 478

 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 28/82 (34%), Positives = 48/82 (58%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+     + K + LC+LY  ++IAQA+IFC+TR+   WL   +      V  + G+M 
Sbjct: 308 QYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVLMLSGEMM 367

Query: 188 QREREVIMRQFRTGSSRVLITT 253
             +R  ++ +FR G  +VL+TT
Sbjct: 368 VEQRAAVIERFREGKEKVLVTT 389



 Score = 36.3 bits (80), Expect = 0.11
 Identities = 15/22 (68%), Positives = 20/22 (90%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRE 327
           ARGIDV+QVS VIN+DLP +++
Sbjct: 393 ARGIDVEQVSVVINFDLPVDKD 414


>AF136175-1|AAP97265.1|  479|Homo sapiens RNA helicase protein.
          Length = 479

 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 28/82 (34%), Positives = 48/82 (58%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+     + K + LC+LY  ++IAQA+IFC+TR+   WL   +      V  + G+M 
Sbjct: 309 QYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVVLLSGEMM 368

Query: 188 QREREVIMRQFRTGSSRVLITT 253
             +R  ++ +FR G  +VL+TT
Sbjct: 369 VEQRAAVIERFREGKEKVLVTT 390



 Score = 36.3 bits (80), Expect = 0.11
 Identities = 15/22 (68%), Positives = 20/22 (90%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRE 327
           ARGIDV+QVS VIN+DLP +++
Sbjct: 394 ARGIDVEQVSVVINFDLPVDKD 415


>CR533509-1|CAG38540.1|  448|Homo sapiens DDX19 protein.
          Length = 448

 Score = 68.9 bits (161), Expect = 2e-11
 Identities = 27/82 (32%), Positives = 49/82 (59%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+     + K + LC+LY  ++IAQA+IFC+TR+   WL   +      V+ + G++ 
Sbjct: 278 QYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEVM 337

Query: 188 QREREVIMRQFRTGSSRVLITT 253
             +R  ++ +FR G  +VL+TT
Sbjct: 338 VEQRAAVIERFREGKEKVLVTT 359



 Score = 36.3 bits (80), Expect = 0.11
 Identities = 15/22 (68%), Positives = 20/22 (90%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRE 327
           ARGIDV+QVS VIN+DLP +++
Sbjct: 363 ARGIDVEQVSVVINFDLPVDKD 384


>BC066938-1|AAH66938.1|  648|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 43 protein.
          Length = 648

 Score = 51.2 bits (117), Expect = 4e-06
 Identities = 25/80 (31%), Positives = 45/80 (56%), Gaps = 1/80 (1%)
 Frame = +2

Query: 17  IAIELEEWK-LETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQR 193
           +  E E+W  ++T   L    S  + ++F + +   D L+  + L + +V ++HGD +QR
Sbjct: 467 VTTEEEKWSHMQTF--LQSMSSTDKVIVFVSRKAVADHLSSDLILGNISVESLHGDREQR 524

Query: 194 EREVIMRQFRTGSSRVLITT 253
           +RE  +  F+TG  R+LI T
Sbjct: 525 DREKALENFKTGKVRILIAT 544



 Score = 32.3 bits (70), Expect = 1.8
 Identities = 17/75 (22%), Positives = 31/75 (41%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           L +RG+DV  V+ V N+D P N E Y                   +T  D R   ++ + 
Sbjct: 546 LASRGLDVHDVTHVYNFDFPRNIEEYVHRIGRTGRAGRTGVSITTLTRNDWRVASELINI 605

Query: 436 YHTSIVEMPSDVANL 480
              +   +P ++ ++
Sbjct: 606 LERANQSIPEELVSM 620


>AJ278110-1|CAB92442.1|  648|Homo sapiens DEAD-box protein protein.
          Length = 648

 Score = 51.2 bits (117), Expect = 4e-06
 Identities = 25/80 (31%), Positives = 45/80 (56%), Gaps = 1/80 (1%)
 Frame = +2

Query: 17  IAIELEEWK-LETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQR 193
           +  E E+W  ++T   L    S  + ++F + +   D L+  + L + +V ++HGD +QR
Sbjct: 467 VTTEEEKWSHMQTF--LQSMSSTDKVIVFVSRKAVADHLSSDLILGNISVESLHGDREQR 524

Query: 194 EREVIMRQFRTGSSRVLITT 253
           +RE  +  F+TG  R+LI T
Sbjct: 525 DREKALENFKTGKVRILIAT 544



 Score = 32.3 bits (70), Expect = 1.8
 Identities = 17/75 (22%), Positives = 31/75 (41%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           L +RG+DV  V+ V N+D P N E Y                   +T  D R   ++ + 
Sbjct: 546 LASRGLDVHDVTHVYNFDFPRNIEEYVHRIGRTGRAGRTGVSITTLTRNDWRVASELINI 605

Query: 436 YHTSIVEMPSDVANL 480
              +   +P ++ ++
Sbjct: 606 LERANQSIPEELVSM 620


>D17532-1|BAA04482.1|  472|Homo sapiens RCK protein.
          Length = 472

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/84 (30%), Positives = 41/84 (48%)
 Frame = +2

Query: 2   GTRFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGD 181
           G   Y A   E  K+  L  L+  L I Q++IFCN+ ++V+ L + +    ++   +H  
Sbjct: 297 GVTQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYSCFYIHAK 356

Query: 182 MDQREREVIMRQFRTGSSRVLITT 253
           M Q  R  +   FR G  R L+ T
Sbjct: 357 MRQEHRNRVFHDFRNGLCRNLVCT 380



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 26/72 (36%), Positives = 34/72 (47%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           L  RGID+Q V+ VIN+D P   E Y                 N +T  DR  LK IE+ 
Sbjct: 382 LFTRGIDIQAVNVVINFDFPKLAETYLHRIGRSGRFGHLGLAINLITYDDRFNLKSIEEQ 441

Query: 436 YHTSIVEMPSDV 471
             T I  +PS++
Sbjct: 442 LGTEIKPIPSNI 453


>BC065007-1|AAH65007.1|  483|Homo sapiens DDX6 protein protein.
          Length = 483

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/84 (30%), Positives = 41/84 (48%)
 Frame = +2

Query: 2   GTRFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGD 181
           G   Y A   E  K+  L  L+  L I Q++IFCN+ ++V+ L + +    ++   +H  
Sbjct: 308 GVTQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYSCFYIHAK 367

Query: 182 MDQREREVIMRQFRTGSSRVLITT 253
           M Q  R  +   FR G  R L+ T
Sbjct: 368 MRQEHRNRVFHDFRNGLCRNLVCT 391



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 26/72 (36%), Positives = 34/72 (47%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           L  RGID+Q V+ VIN+D P   E Y                 N +T  DR  LK IE+ 
Sbjct: 393 LFTRGIDIQAVNVVINFDFPKLAETYLHRIGRSGRFGHLGLAINLITYDDRFNLKSIEEQ 452

Query: 436 YHTSIVEMPSDV 471
             T I  +PS++
Sbjct: 453 LGTEIKPIPSNI 464


>BC018637-1|AAH18637.2|  423|Homo sapiens DDX50 protein protein.
          Length = 423

 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 21/59 (35%), Positives = 37/59 (62%)
 Frame = +2

Query: 77  SIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           S  +A+IFC T++ V  +  + H++      +HGD+ Q +RE+ ++ FR GS +VL+ T
Sbjct: 74  SEGRAIIFCETKKNVTEMAMNPHIKQ-NAQCLHGDIAQSQREITLKGFREGSFKVLVAT 131


>BC000272-1|AAH00272.1|  737|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 50 protein.
          Length = 737

 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 21/59 (35%), Positives = 37/59 (62%)
 Frame = +2

Query: 77  SIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           S  +A+IFC T++ V  +  + H++      +HGD+ Q +RE+ ++ FR GS +VL+ T
Sbjct: 388 SEGRAIIFCETKKNVTEMAMNPHIKQ-NAQCLHGDIAQSQREITLKGFREGSFKVLVAT 445


>BC000210-1|AAH00210.1|  467|Homo sapiens DDX50 protein protein.
          Length = 467

 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 21/59 (35%), Positives = 37/59 (62%)
 Frame = +2

Query: 77  SIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           S  +A+IFC T++ V  +  + H++      +HGD+ Q +RE+ ++ FR GS +VL+ T
Sbjct: 118 SEGRAIIFCETKKNVTEMAMNPHIKQ-NAQCLHGDIAQSQREITLKGFREGSFKVLVAT 175


>AL359844-2|CAH72376.1|  737|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 50 protein.
          Length = 737

 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 21/59 (35%), Positives = 37/59 (62%)
 Frame = +2

Query: 77  SIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           S  +A+IFC T++ V  +  + H++      +HGD+ Q +RE+ ++ FR GS +VL+ T
Sbjct: 388 SEGRAIIFCETKKNVTEMAMNPHIKQ-NAQCLHGDIAQSQREITLKGFREGSFKVLVAT 445


>AL137423-1|CAB70733.1|  399|Homo sapiens hypothetical protein
           protein.
          Length = 399

 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 21/59 (35%), Positives = 37/59 (62%)
 Frame = +2

Query: 77  SIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           S  +A+IFC T++ V  +  + H++      +HGD+ Q +RE+ ++ FR GS +VL+ T
Sbjct: 50  SEGRAIIFCETKKNVTEMAMNPHIKQ-NAQCLHGDIAQSQREITLKGFREGSFKVLVAT 107


>AF334103-1|AAK29402.1|  737|Homo sapiens nucleolar protein GU2
           protein.
          Length = 737

 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 21/59 (35%), Positives = 37/59 (62%)
 Frame = +2

Query: 77  SIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           S  +A+IFC T++ V  +  + H++      +HGD+ Q +RE+ ++ FR GS +VL+ T
Sbjct: 388 SEGRAIIFCETKKNVTEMAMNPHIKQ-NAQCLHGDIAQSQREITLKGFREGSFKVLVAT 445


>BC088362-1|AAH88362.1|  724|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 4 protein.
          Length = 724

 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 21/71 (29%), Positives = 39/71 (54%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           K E L ++   +   + ++F  T++K D++   +     + +++HGD +QRERE  +  F
Sbjct: 527 KREKLVEILRNIGDERTMVFVETKKKADFIATFLCQEKISTTSIHGDREQREREQALGDF 586

Query: 221 RTGSSRVLITT 253
           R G   VL+ T
Sbjct: 587 RFGKCPVLVAT 597



 Score = 33.5 bits (73), Expect = 0.77
 Identities = 13/24 (54%), Positives = 18/24 (75%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+D++ V  VIN+DLPS  + Y
Sbjct: 601 ARGLDIENVQHVINFDLPSTIDEY 624


>BC047455-1|AAH47455.1|  690|Homo sapiens DDX4 protein protein.
          Length = 690

 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 21/71 (29%), Positives = 39/71 (54%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           K E L ++   +   + ++F  T++K D++   +     + +++HGD +QRERE  +  F
Sbjct: 493 KREKLVEILRNIGDERTMVFVETKKKADFIATFLCQEKISTTSIHGDREQREREQALGDF 552

Query: 221 RTGSSRVLITT 253
           R G   VL+ T
Sbjct: 553 RFGKCPVLVAT 563



 Score = 33.5 bits (73), Expect = 0.77
 Identities = 13/24 (54%), Positives = 18/24 (75%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+D++ V  VIN+DLPS  + Y
Sbjct: 567 ARGLDIENVQHVINFDLPSTIDEY 590


>AL137462-1|CAB70750.1|  635|Homo sapiens hypothetical protein
           protein.
          Length = 635

 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 21/71 (29%), Positives = 39/71 (54%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           K E L ++   +   + ++F  T++K D++   +     + +++HGD +QRERE  +  F
Sbjct: 438 KREKLVEILRNIGDERTMVFVETKKKADFIATFLCQEKISTTSIHGDREQREREQALGDF 497

Query: 221 RTGSSRVLITT 253
           R G   VL+ T
Sbjct: 498 RFGKCPVLVAT 508



 Score = 33.5 bits (73), Expect = 0.77
 Identities = 13/24 (54%), Positives = 18/24 (75%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+D++ V  VIN+DLPS  + Y
Sbjct: 512 ARGLDIENVQHVINFDLPSTIDEY 535


>AF262962-1|AAF72705.1|  724|Homo sapiens VASA protein protein.
          Length = 724

 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 21/71 (29%), Positives = 39/71 (54%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           K E L ++   +   + ++F  T++K D++   +     + +++HGD +QRERE  +  F
Sbjct: 527 KREKLVEILRNIGDERTMVFVETKKKADFIATFLCQEKISTTSIHGDREQREREQALGDF 586

Query: 221 RTGSSRVLITT 253
           R G   VL+ T
Sbjct: 587 RFGKCPVLVAT 597



 Score = 33.5 bits (73), Expect = 0.77
 Identities = 13/24 (54%), Positives = 18/24 (75%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+D++ V  VIN+DLPS  + Y
Sbjct: 601 ARGLDIENVQHVINFDLPSTIDEY 624


>BC001009-1|AAH01009.1|  427|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 39 protein.
          Length = 427

 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 20/73 (27%), Positives = 38/73 (52%), Gaps = 1/73 (1%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVT-EADRRALKDIED 432
           L  RG+D+++V+ V NYD+P + + Y                  FV+ E D + L D++D
Sbjct: 345 LFGRGMDIERVNIVFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQD 404

Query: 433 FYHTSIVEMPSDV 471
            +  ++ E+P ++
Sbjct: 405 RFEVNVAELPEEI 417



 Score = 40.3 bits (90), Expect = 0.007
 Identities = 24/82 (29%), Positives = 42/82 (51%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+ ++  E K   L DL D L   Q +IF  + ++   L + +  ++F   A+H  M 
Sbjct: 263 QYYVKLKDSE-KNRKLFDLLDVLEFNQVIIFVKSVQRCMALAQLLVEQNFPAIAIHRGMA 321

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q ER    +QF+    R+L+ T
Sbjct: 322 QEERLSRYQQFKDFQRRILVAT 343


>AK026614-1|BAB15509.1|  461|Homo sapiens protein ( Homo sapiens
           cDNA: FLJ22961 fis, clone KAT10214. ).
          Length = 461

 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 20/73 (27%), Positives = 38/73 (52%), Gaps = 1/73 (1%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVT-EADRRALKDIED 432
           L  RG+D+++V+ V NYD+P + + Y                  FV+ E D + L D++D
Sbjct: 379 LFGRGMDIERVNIVFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQD 438

Query: 433 FYHTSIVEMPSDV 471
            +  ++ E+P ++
Sbjct: 439 RFEVNVAELPEEI 451



 Score = 40.3 bits (90), Expect = 0.007
 Identities = 24/82 (29%), Positives = 42/82 (51%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+ ++  E K   L DL D L   Q +IF  + ++   L + +  ++F   A+H  M 
Sbjct: 297 QYYVKLKDSE-KNRKLFDLLDVLEFNQVIIFVKSVQRCMALAQLLVEQNFPAIAIHRGMA 355

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q ER    +QF+    R+L+ T
Sbjct: 356 QEERLSRYQQFKDFQRRILVAT 377


>U50553-1|AAB95637.1|  662|Homo sapiens helicase like protein 2
           protein.
          Length = 662

 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 24/75 (32%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = +2

Query: 32  EEWKLETLCDLYD-TLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVI 208
           E  K   L DL + T   +  ++F  T++  D L + ++   +  +++HGD  QR+RE  
Sbjct: 424 ESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEA 483

Query: 209 MRQFRTGSSRVLITT 253
           + QFR+G S +L+ T
Sbjct: 484 LHQFRSGKSPILVAT 498



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 23/73 (31%), Positives = 34/73 (46%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+D+  V  VIN+DLPS+ E Y                 +F  E +    KD+ D   
Sbjct: 502 ARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLV 561

Query: 442 TSIVEMPSDVANL 480
            +  E+PS + N+
Sbjct: 562 EAKQEVPSWLENM 574


>BC034942-1|AAH34942.1|  660|Homo sapiens DDX3Y protein protein.
          Length = 660

 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 20/61 (32%), Positives = 37/61 (60%)
 Frame = +2

Query: 71  TLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLIT 250
           T S +  ++F  T++  D L + ++   +  +++HGD  QR+RE  + QFR+G S +L+ 
Sbjct: 436 TGSDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVA 495

Query: 251 T 253
           T
Sbjct: 496 T 496



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 23/73 (31%), Positives = 34/73 (46%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+D+  V  VIN+DLPS+ E Y                 +F  E +    KD+ D   
Sbjct: 500 ARGLDISNVRHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNEKNMNITKDLLDLLV 559

Query: 442 TSIVEMPSDVANL 480
            +  E+PS + N+
Sbjct: 560 EAKQEVPSWLENM 572


>BC011819-1|AAH11819.1|  662|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 3, X-linked protein.
          Length = 662

 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 24/75 (32%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = +2

Query: 32  EEWKLETLCDLYD-TLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVI 208
           E  K   L DL + T   +  ++F  T++  D L + ++   +  +++HGD  QR+RE  
Sbjct: 424 ESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEA 483

Query: 209 MRQFRTGSSRVLITT 253
           + QFR+G S +L+ T
Sbjct: 484 LHQFRSGKSPILVAT 498



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 23/73 (31%), Positives = 34/73 (46%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+D+  V  VIN+DLPS+ E Y                 +F  E +    KD+ D   
Sbjct: 502 ARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLV 561

Query: 442 TSIVEMPSDVANL 480
            +  E+PS + N+
Sbjct: 562 EAKQEVPSWLENM 574


>AY776161-1|AAV52794.1|  362|Homo sapiens unknown protein.
          Length = 362

 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 24/75 (32%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = +2

Query: 32  EEWKLETLCDLYD-TLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVI 208
           E  K   L DL + T   +  ++F  T++  D L + ++   +  +++HGD  QR+RE  
Sbjct: 141 ESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEA 200

Query: 209 MRQFRTGSSRVLITT 253
           + QFR+G S +L+ T
Sbjct: 201 LHQFRSGKSPILVAT 215



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 23/73 (31%), Positives = 34/73 (46%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+D+  V  VIN+DLPS+ E Y                 +F  E +    KD+ D   
Sbjct: 219 ARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLV 278

Query: 442 TSIVEMPSDVANL 480
            +  E+PS + N+
Sbjct: 279 EAKQEVPSWLENM 291


>AL391647-2|CAI41416.1|  662|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 3, X-linked protein.
          Length = 662

 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 24/75 (32%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = +2

Query: 32  EEWKLETLCDLYD-TLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVI 208
           E  K   L DL + T   +  ++F  T++  D L + ++   +  +++HGD  QR+RE  
Sbjct: 424 ESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEA 483

Query: 209 MRQFRTGSSRVLITT 253
           + QFR+G S +L+ T
Sbjct: 484 LHQFRSGKSPILVAT 498



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 23/73 (31%), Positives = 34/73 (46%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+D+  V  VIN+DLPS+ E Y                 +F  E +    KD+ D   
Sbjct: 502 ARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLV 561

Query: 442 TSIVEMPSDVANL 480
            +  E+PS + N+
Sbjct: 562 EAKQEVPSWLENM 574


>AF061337-1|AAC34298.1|  662|Homo sapiens DEAD box RNA helicase DDX3
           protein.
          Length = 662

 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 24/75 (32%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = +2

Query: 32  EEWKLETLCDLYD-TLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVI 208
           E  K   L DL + T   +  ++F  T++  D L + ++   +  +++HGD  QR+RE  
Sbjct: 424 ESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEA 483

Query: 209 MRQFRTGSSRVLITT 253
           + QFR+G S +L+ T
Sbjct: 484 LHQFRSGKSPILVAT 498



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 23/73 (31%), Positives = 34/73 (46%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+D+  V  VIN+DLPS+ E Y                 +F  E +    KD+ D   
Sbjct: 502 ARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLV 561

Query: 442 TSIVEMPSDVANL 480
            +  E+PS + N+
Sbjct: 562 EAKQEVPSWLENM 574


>AF000985-1|AAC51832.1|  660|Homo sapiens dead box, Y isoform
           protein.
          Length = 660

 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 20/61 (32%), Positives = 37/61 (60%)
 Frame = +2

Query: 71  TLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLIT 250
           T S +  ++F  T++  D L + ++   +  +++HGD  QR+RE  + QFR+G S +L+ 
Sbjct: 436 TGSDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVA 495

Query: 251 T 253
           T
Sbjct: 496 T 496



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 23/73 (31%), Positives = 34/73 (46%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+D+  V  VIN+DLPS+ E Y                 +F  E +    KD+ D   
Sbjct: 500 ARGLDISNVRHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNEKNMNITKDLLDLLV 559

Query: 442 TSIVEMPSDVANL 480
            +  E+PS + N+
Sbjct: 560 EAKQEVPSWLENM 572


>AF000984-1|AAC51831.1|  660|Homo sapiens dead box, Y isoform
           protein.
          Length = 660

 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 20/61 (32%), Positives = 37/61 (60%)
 Frame = +2

Query: 71  TLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLIT 250
           T S +  ++F  T++  D L + ++   +  +++HGD  QR+RE  + QFR+G S +L+ 
Sbjct: 436 TGSDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVA 495

Query: 251 T 253
           T
Sbjct: 496 T 496



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 23/73 (31%), Positives = 34/73 (46%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+D+  V  VIN+DLPS+ E Y                 +F  E +    KD+ D   
Sbjct: 500 ARGLDISNVRHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNEKNMNITKDLLDLLV 559

Query: 442 TSIVEMPSDVANL 480
            +  E+PS + N+
Sbjct: 560 EAKQEVPSWLENM 572


>AF000983-1|AAC51830.1|  662|Homo sapiens dead box, X isoform
           protein.
          Length = 662

 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 24/75 (32%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = +2

Query: 32  EEWKLETLCDLYD-TLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVI 208
           E  K   L DL + T   +  ++F  T++  D L + ++   +  +++HGD  QR+RE  
Sbjct: 424 ESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEA 483

Query: 209 MRQFRTGSSRVLITT 253
           + QFR+G S +L+ T
Sbjct: 484 LHQFRSGKSPILVAT 498



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 23/73 (31%), Positives = 34/73 (46%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+D+  V  VIN+DLPS+ E Y                 +F  E +    KD+ D   
Sbjct: 502 ARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLV 561

Query: 442 TSIVEMPSDVANL 480
            +  E+PS + N+
Sbjct: 562 EAKQEVPSWLENM 574


>AF000982-1|AAC51829.1|  662|Homo sapiens dead box, X isoform
           protein.
          Length = 662

 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 24/75 (32%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = +2

Query: 32  EEWKLETLCDLYD-TLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVI 208
           E  K   L DL + T   +  ++F  T++  D L + ++   +  +++HGD  QR+RE  
Sbjct: 424 ESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEA 483

Query: 209 MRQFRTGSSRVLITT 253
           + QFR+G S +L+ T
Sbjct: 484 LHQFRSGKSPILVAT 498



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 23/73 (31%), Positives = 34/73 (46%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+D+  V  VIN+DLPS+ E Y                 +F  E +    KD+ D   
Sbjct: 502 ARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLV 561

Query: 442 TSIVEMPSDVANL 480
            +  E+PS + N+
Sbjct: 562 EAKQEVPSWLENM 574


>AB208983-1|BAD92220.1|  674|Homo sapiens DEAD/H
           (Asp-Glu-Ala-Asp/His) box polypeptide 3 variant protein.
          Length = 674

 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 24/75 (32%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = +2

Query: 32  EEWKLETLCDLYD-TLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVI 208
           E  K   L DL + T   +  ++F  T++  D L + ++   +  +++HGD  QR+RE  
Sbjct: 436 ESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEA 495

Query: 209 MRQFRTGSSRVLITT 253
           + QFR+G S +L+ T
Sbjct: 496 LHQFRSGKSPILVAT 510



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 23/73 (31%), Positives = 34/73 (46%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+D+  V  VIN+DLPS+ E Y                 +F  E +    KD+ D   
Sbjct: 514 ARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLV 573

Query: 442 TSIVEMPSDVANL 480
            +  E+PS + N+
Sbjct: 574 EAKQEVPSWLENM 586


>Z97056-3|CAB09792.1|  650|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 17 protein.
          Length = 650

 Score = 47.2 bits (107), Expect = 6e-05
 Identities = 20/56 (35%), Positives = 33/56 (58%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           + +IF  T+R+ D LT  M    +    +HGD  Q ER+ ++ +FR+G + +LI T
Sbjct: 341 KTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIAT 396



 Score = 34.3 bits (75), Expect = 0.44
 Identities = 13/24 (54%), Positives = 19/24 (79%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           +RG+DV+ V  VINYD P++ E+Y
Sbjct: 400 SRGLDVEDVKFVINYDYPNSSEDY 423


>U59321-1|AAC50787.1|  650|Homo sapiens DEAD-box protein p72
           protein.
          Length = 650

 Score = 47.2 bits (107), Expect = 6e-05
 Identities = 20/56 (35%), Positives = 33/56 (58%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           + +IF  T+R+ D LT  M    +    +HGD  Q ER+ ++ +FR+G + +LI T
Sbjct: 341 KTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIAT 396



 Score = 34.3 bits (75), Expect = 0.44
 Identities = 13/24 (54%), Positives = 19/24 (79%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           +RG+DV+ V  VINYD P++ E+Y
Sbjct: 400 SRGLDVEDVKFVINYDYPNSSEDY 423


>CR456432-1|CAG30318.1|  652|Homo sapiens DDX17 protein.
          Length = 652

 Score = 47.2 bits (107), Expect = 6e-05
 Identities = 20/56 (35%), Positives = 33/56 (58%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           + +IF  T+R+ D LT  M    +    +HGD  Q ER+ ++ +FR+G + +LI T
Sbjct: 341 KTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIAT 396



 Score = 34.3 bits (75), Expect = 0.44
 Identities = 13/24 (54%), Positives = 19/24 (79%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           +RG+DV+ V  VINYD P++ E+Y
Sbjct: 400 SRGLDVEDVKFVINYDYPNSSEDY 423


>BC000595-1|AAH00595.2|  729|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 17 protein.
          Length = 729

 Score = 47.2 bits (107), Expect = 6e-05
 Identities = 20/56 (35%), Positives = 33/56 (58%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           + +IF  T+R+ D LT  M    +    +HGD  Q ER+ ++ +FR+G + +LI T
Sbjct: 420 KTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIAT 475



 Score = 34.3 bits (75), Expect = 0.44
 Identities = 13/24 (54%), Positives = 19/24 (79%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           +RG+DV+ V  VINYD P++ E+Y
Sbjct: 479 SRGLDVEDVKFVINYDYPNSSEDY 502


>AY004154-1|AAF86585.1|  724|Homo sapiens DEAD box RNA helicase
           protein.
          Length = 724

 Score = 47.2 bits (107), Expect = 6e-05
 Identities = 21/71 (29%), Positives = 38/71 (53%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           K E L ++   +   + ++F  T++K D+    +     + +++HGD +QRERE  +  F
Sbjct: 527 KREKLVEILRNIGDERTMVFVETKKKADFTATFLCQEKISTTSIHGDREQREREQALGDF 586

Query: 221 RTGSSRVLITT 253
           R G   VL+ T
Sbjct: 587 RFGKCPVLVAT 597



 Score = 33.5 bits (73), Expect = 0.77
 Identities = 13/24 (54%), Positives = 18/24 (75%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+D++ V  VIN+DLPS  + Y
Sbjct: 601 ARGLDIENVQHVINFDLPSTIDEY 624


>AB209595-1|BAD92832.1|  737|Homo sapiens DEAD box polypeptide 17
           isoform p82 variant protein.
          Length = 737

 Score = 47.2 bits (107), Expect = 6e-05
 Identities = 20/56 (35%), Positives = 33/56 (58%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           + +IF  T+R+ D LT  M    +    +HGD  Q ER+ ++ +FR+G + +LI T
Sbjct: 422 KTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIAT 477



 Score = 34.3 bits (75), Expect = 0.44
 Identities = 13/24 (54%), Positives = 19/24 (79%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           +RG+DV+ V  VINYD P++ E+Y
Sbjct: 481 SRGLDVEDVKFVINYDYPNSSEDY 504


>U41387-1|AAB02546.1|  801|Homo sapiens Gu protein protein.
          Length = 801

 Score = 46.8 bits (106), Expect = 8e-05
 Identities = 18/56 (32%), Positives = 37/56 (66%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           + +IFC T+++   L+++  ++     ++HGD+ Q++RE+ ++ FR GS  VL+ T
Sbjct: 458 RTIIFCETKKEAQELSQNSAIKQ-DAQSLHGDIPQKQREITLKGFRNGSFGVLVAT 512


>BC008071-1|AAH08071.2|  783|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 21 protein.
          Length = 783

 Score = 46.8 bits (106), Expect = 8e-05
 Identities = 18/56 (32%), Positives = 37/56 (66%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           + +IFC T+++   L+++  ++     ++HGD+ Q++RE+ ++ FR GS  VL+ T
Sbjct: 440 RTIIFCETKKEAQELSQNSAIKQ-DAQSLHGDIPQKQREITLKGFRNGSFGVLVAT 494


>AL359844-3|CAH72377.1|  783|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 21 protein.
          Length = 783

 Score = 46.8 bits (106), Expect = 8e-05
 Identities = 18/56 (32%), Positives = 37/56 (66%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           + +IFC T+++   L+++  ++     ++HGD+ Q++RE+ ++ FR GS  VL+ T
Sbjct: 440 RTIIFCETKKEAQELSQNSAIKQ-DAQSLHGDIPQKQREITLKGFRNGSFGVLVAT 494


>AF261917-1|AAF78930.2|  715|Homo sapiens RNA helicase II/Gu protein
           protein.
          Length = 715

 Score = 46.8 bits (106), Expect = 8e-05
 Identities = 18/56 (32%), Positives = 37/56 (66%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           + +IFC T+++   L+++  ++     ++HGD+ Q++RE+ ++ FR GS  VL+ T
Sbjct: 372 RTIIFCETKKEAQELSQNSAIKQ-DAQSLHGDIPQKQREITLKGFRNGSFGVLVAT 426


>X52104-1|CAA36324.1|  614|Homo sapiens protein ( Human mRNA for p68
           protein. ).
          Length = 614

 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 18/56 (32%), Positives = 33/56 (58%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           + ++F  T+R+ D LT  M    +    +HGD  Q+ER+ ++ +F+ G + +LI T
Sbjct: 343 KTIVFVETKRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIAT 398



 Score = 34.3 bits (75), Expect = 0.44
 Identities = 13/24 (54%), Positives = 19/24 (79%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           +RG+DV+ V  VINYD P++ E+Y
Sbjct: 402 SRGLDVEDVKFVINYDYPNSSEDY 425


>X15729-1|CAA33751.1|  614|Homo sapiens protein ( Human mRNA for
           nuclear p68 protein. ).
          Length = 614

 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 18/56 (32%), Positives = 33/56 (58%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           + ++F  T+R+ D LT  M    +    +HGD  Q+ER+ ++ +F+ G + +LI T
Sbjct: 343 KTIVFVETKRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIAT 398



 Score = 34.3 bits (75), Expect = 0.44
 Identities = 13/24 (54%), Positives = 19/24 (79%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           +RG+DV+ V  VINYD P++ E+Y
Sbjct: 402 SRGLDVEDVKFVINYDYPNSSEDY 425


>BX571764-1|CAE11890.1|  406|Homo sapiens hypothetical protein
           protein.
          Length = 406

 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 18/56 (32%), Positives = 33/56 (58%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           + ++F  T+R+ D LT  M    +    +HGD  Q+ER+ ++ +F+ G + +LI T
Sbjct: 343 KTIVFVETKRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIAT 398


>BT006943-1|AAP35589.1|  614|Homo sapiens DEAD/H
           (Asp-Glu-Ala-Asp/His) box polypeptide 5 (RNA helicase,
           68kDa) protein.
          Length = 614

 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 18/56 (32%), Positives = 33/56 (58%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           + ++F  T+R+ D LT  M    +    +HGD  Q+ER+ ++ +F+ G + +LI T
Sbjct: 343 KTIVFVETKRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIAT 398



 Score = 34.3 bits (75), Expect = 0.44
 Identities = 13/24 (54%), Positives = 19/24 (79%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           +RG+DV+ V  VINYD P++ E+Y
Sbjct: 402 SRGLDVEDVKFVINYDYPNSSEDY 425


>BC016027-1|AAH16027.1|  614|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 5 protein.
          Length = 614

 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 18/56 (32%), Positives = 33/56 (58%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           + ++F  T+R+ D LT  M    +    +HGD  Q+ER+ ++ +F+ G + +LI T
Sbjct: 343 KTIVFVETKRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIAT 398



 Score = 34.3 bits (75), Expect = 0.44
 Identities = 13/24 (54%), Positives = 19/24 (79%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           +RG+DV+ V  VINYD P++ E+Y
Sbjct: 402 SRGLDVEDVKFVINYDYPNSSEDY 425


>AF015812-1|AAB84094.1|  614|Homo sapiens RNA helicase p68 protein.
          Length = 614

 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 18/56 (32%), Positives = 33/56 (58%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           + ++F  T+R+ D LT  M    +    +HGD  Q+ER+ ++ +F+ G + +LI T
Sbjct: 343 KTIVFVETKRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIAT 398



 Score = 34.3 bits (75), Expect = 0.44
 Identities = 13/24 (54%), Positives = 19/24 (79%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           +RG+DV+ V  VINYD P++ E+Y
Sbjct: 402 SRGLDVEDVKFVINYDYPNSSEDY 425


>AB209919-1|BAD93156.1|  457|Homo sapiens Hypothetical protein
           DKFZp686J01190 variant protein.
          Length = 457

 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 18/56 (32%), Positives = 33/56 (58%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           + ++F  T+R+ D LT  M    +    +HGD  Q+ER+ ++ +F+ G + +LI T
Sbjct: 394 KTIVFVETKRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIAT 449


>Z37166-1|CAA85523.1|  428|Homo sapiens nuclear RNA helicase (DEAD
           family) protein.
          Length = 428

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVT-EADRRALKDIED 432
           L  RG+D+++V+   NYD+P + + Y                  FV+ E D + L D++D
Sbjct: 346 LFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQD 405

Query: 433 FYHTSIVEMPSDV 471
            +  +I E+P ++
Sbjct: 406 RFEVNISELPDEI 418



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 25/82 (30%), Positives = 42/82 (51%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+ ++  E K   L DL D L   Q VIF  + ++   L + +  ++F   A+H  M 
Sbjct: 264 QYYVKLKDNE-KNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMP 322

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q ER    +QF+    R+L+ T
Sbjct: 323 QEERLSRYQQFKDFQRRILVAT 344


>BX248516-3|CAI41922.1|  428|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 428

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVT-EADRRALKDIED 432
           L  RG+D+++V+   NYD+P + + Y                  FV+ E D + L D++D
Sbjct: 346 LFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQD 405

Query: 433 FYHTSIVEMPSDV 471
            +  +I E+P ++
Sbjct: 406 RFEVNISELPDEI 418



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 25/82 (30%), Positives = 42/82 (51%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+ ++  E K   L DL D L   Q VIF  + ++   L + +  ++F   A+H  M 
Sbjct: 264 QYYVKLKDNE-KNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMP 322

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q ER    +QF+    R+L+ T
Sbjct: 323 QEERLSRYQQFKDFQRRILVAT 344


>BX248516-2|CAM25875.1|  186|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 186

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVT-EADRRALKDIED 432
           L  RG+D+++V+   NYD+P + + Y                  FV+ E D + L D++D
Sbjct: 109 LFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQD 168

Query: 433 FYHTSIVEMPSDV 471
            +  +I E+P ++
Sbjct: 169 RFEVNISELPDEI 181



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 25/82 (30%), Positives = 42/82 (51%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+ ++  E K   L DL D L   Q VIF  + ++   L + +  ++F   A+H  M 
Sbjct: 27  QYYVKLKDNE-KNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMP 85

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q ER    +QF+    R+L+ T
Sbjct: 86  QEERLSRYQQFKDFQRRILVAT 107


>BX001040-6|CAI18634.1|  428|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 428

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVT-EADRRALKDIED 432
           L  RG+D+++V+   NYD+P + + Y                  FV+ E D + L D++D
Sbjct: 346 LFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQD 405

Query: 433 FYHTSIVEMPSDV 471
            +  +I E+P ++
Sbjct: 406 RFEVNISELPDEI 418



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 25/82 (30%), Positives = 42/82 (51%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+ ++  E K   L DL D L   Q VIF  + ++   L + +  ++F   A+H  M 
Sbjct: 264 QYYVKLKDNE-KNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMP 322

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q ER    +QF+    R+L+ T
Sbjct: 323 QEERLSRYQQFKDFQRRILVAT 344


>BX001040-5|CAI18633.1|  161|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 161

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVT-EADRRALKDIED 432
           L  RG+D+++V+   NYD+P + + Y                  FV+ E D + L D++D
Sbjct: 79  LFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQD 138

Query: 433 FYHTSIVEMPSDV 471
            +  +I E+P ++
Sbjct: 139 RFEVNISELPDEI 151



 Score = 30.7 bits (66), Expect = 5.4
 Identities = 17/56 (30%), Positives = 29/56 (51%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           Q VIF  + ++   L + +  ++F   A+H  M Q ER    +QF+    R+L+ T
Sbjct: 22  QVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVAT 77


>BT009909-1|AAP88911.1|  428|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 428

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVT-EADRRALKDIED 432
           L  RG+D+++V+   NYD+P + + Y                  FV+ E D + L D++D
Sbjct: 346 LFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQD 405

Query: 433 FYHTSIVEMPSDV 471
            +  +I E+P ++
Sbjct: 406 RFEVNISELPDEI 418



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 25/82 (30%), Positives = 42/82 (51%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+ ++  E K   L DL D L   Q VIF  + ++   L + +  ++F   A+H  M 
Sbjct: 264 QYYVKLKDNE-KNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMP 322

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q ER    +QF+    R+L+ T
Sbjct: 323 QEERLSRYQQFKDFQRRILVAT 344


>BC013006-1|AAH13006.1|  428|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 428

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVT-EADRRALKDIED 432
           L  RG+D+++V+   NYD+P + + Y                  FV+ E D + L D++D
Sbjct: 346 LFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQD 405

Query: 433 FYHTSIVEMPSDV 471
            +  +I E+P ++
Sbjct: 406 RFEVNISELPDEI 418



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 25/82 (30%), Positives = 42/82 (51%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+ ++  E K   L DL D L   Q VIF  + ++   L + +  ++F   A+H  M 
Sbjct: 264 QYYVKLKDNE-KNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMP 322

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q ER    +QF+    R+L+ T
Sbjct: 323 QEERLSRYQQFKDFQRRILVAT 344


>BC000361-1|AAH00361.1|  428|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 428

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVT-EADRRALKDIED 432
           L  RG+D+++V+   NYD+P + + Y                  FV+ E D + L D++D
Sbjct: 346 LFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQD 405

Query: 433 FYHTSIVEMPSDV 471
            +  +I E+P ++
Sbjct: 406 RFEVNISELPDEI 418



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 25/82 (30%), Positives = 42/82 (51%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+ ++  E K   L DL D L   Q VIF  + ++   L + +  ++F   A+H  M 
Sbjct: 264 QYYVKLKDNE-KNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMP 322

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q ER    +QF+    R+L+ T
Sbjct: 323 QEERLSRYQQFKDFQRRILVAT 344


>BA000025-40|BAB63306.1|  428|Homo sapiens putative ATP-dependent
           RNA helicase protein.
          Length = 428

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVT-EADRRALKDIED 432
           L  RG+D+++V+   NYD+P + + Y                  FV+ E D + L D++D
Sbjct: 346 LFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQD 405

Query: 433 FYHTSIVEMPSDV 471
            +  +I E+P ++
Sbjct: 406 RFEVNISELPDEI 418



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 25/82 (30%), Positives = 42/82 (51%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+ ++  E K   L DL D L   Q VIF  + ++   L + +  ++F   A+H  M 
Sbjct: 264 QYYVKLKDNE-KNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMP 322

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q ER    +QF+    R+L+ T
Sbjct: 323 QEERLSRYQQFKDFQRRILVAT 344


>AL662847-20|CAI17664.2|  428|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 428

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVT-EADRRALKDIED 432
           L  RG+D+++V+   NYD+P + + Y                  FV+ E D + L D++D
Sbjct: 346 LFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQD 405

Query: 433 FYHTSIVEMPSDV 471
            +  +I E+P ++
Sbjct: 406 RFEVNISELPDEI 418



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 25/82 (30%), Positives = 42/82 (51%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+ ++  E K   L DL D L   Q VIF  + ++   L + +  ++F   A+H  M 
Sbjct: 264 QYYVKLKDNE-KNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMP 322

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q ER    +QF+    R+L+ T
Sbjct: 323 QEERLSRYQQFKDFQRRILVAT 344


>AL662847-19|CAO72084.1|  186|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 186

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVT-EADRRALKDIED 432
           L  RG+D+++V+   NYD+P + + Y                  FV+ E D + L D++D
Sbjct: 109 LFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQD 168

Query: 433 FYHTSIVEMPSDV 471
            +  +I E+P ++
Sbjct: 169 RFEVNISELPDEI 181



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 25/82 (30%), Positives = 42/82 (51%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+ ++  E K   L DL D L   Q VIF  + ++   L + +  ++F   A+H  M 
Sbjct: 27  QYYVKLKDNE-KNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMP 85

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q ER    +QF+    R+L+ T
Sbjct: 86  QEERLSRYQQFKDFQRRILVAT 107


>AL662801-3|CAI18280.1|  428|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 428

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVT-EADRRALKDIED 432
           L  RG+D+++V+   NYD+P + + Y                  FV+ E D + L D++D
Sbjct: 346 LFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQD 405

Query: 433 FYHTSIVEMPSDV 471
            +  +I E+P ++
Sbjct: 406 RFEVNISELPDEI 418



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 25/82 (30%), Positives = 42/82 (51%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+ ++  E K   L DL D L   Q VIF  + ++   L + +  ++F   A+H  M 
Sbjct: 264 QYYVKLKDNE-KNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMP 322

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q ER    +QF+    R+L+ T
Sbjct: 323 QEERLSRYQQFKDFQRRILVAT 344


>AL662801-2|CAM25575.1|  186|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 186

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVT-EADRRALKDIED 432
           L  RG+D+++V+   NYD+P + + Y                  FV+ E D + L D++D
Sbjct: 109 LFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQD 168

Query: 433 FYHTSIVEMPSDV 471
            +  +I E+P ++
Sbjct: 169 RFEVNISELPDEI 181



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 25/82 (30%), Positives = 42/82 (51%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+ ++  E K   L DL D L   Q VIF  + ++   L + +  ++F   A+H  M 
Sbjct: 27  QYYVKLKDNE-KNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMP 85

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q ER    +QF+    R+L+ T
Sbjct: 86  QEERLSRYQQFKDFQRRILVAT 107


>AK222912-1|BAD96632.1|  428|Homo sapiens HLA-B associated
           transcript 1 variant protein.
          Length = 428

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVT-EADRRALKDIED 432
           L  RG+D+++V+   NYD+P + + Y                  FV+ E D + L D++D
Sbjct: 346 LFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQD 405

Query: 433 FYHTSIVEMPSDV 471
            +  +I E+P ++
Sbjct: 406 RFEVNISELPDEI 418



 Score = 39.5 bits (88), Expect = 0.012
 Identities = 24/82 (29%), Positives = 42/82 (51%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+ ++  E K   L DL D L   + VIF  + ++   L + +  ++F   A+H  M 
Sbjct: 264 QYYVKLKDNE-KNRKLFDLLDVLEFNRVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMP 322

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q ER    +QF+    R+L+ T
Sbjct: 323 QEERLSRYQQFKDFQRRILVAT 344


>AF029062-1|AAC63046.1|  284|Homo sapiens DEAD-box protein protein.
          Length = 284

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVT-EADRRALKDIED 432
           L  RG+D+++V+   NYD+P + + Y                  FV+ E D + L D++D
Sbjct: 202 LFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQD 261

Query: 433 FYHTSIVEMPSDV 471
            +  +I E+P ++
Sbjct: 262 RFEVNISELPDEI 274



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 25/82 (30%), Positives = 42/82 (51%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+ ++  E K   L DL D L   Q VIF  + ++   L + +  ++F   A+H  M 
Sbjct: 120 QYYVKLKDNE-KNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMP 178

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q ER    +QF+    R+L+ T
Sbjct: 179 QEERLSRYQQFKDFQRRILVAT 200


>AF029061-1|AAB94615.1|  284|Homo sapiens BAT1 protein.
          Length = 284

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVT-EADRRALKDIED 432
           L  RG+D+++V+   NYD+P + + Y                  FV+ E D + L D++D
Sbjct: 202 LFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQD 261

Query: 433 FYHTSIVEMPSDV 471
            +  +I E+P ++
Sbjct: 262 RFEVNISELPDEI 274



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 25/82 (30%), Positives = 42/82 (51%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+ ++  E K   L DL D L   Q VIF  + ++   L + +  ++F   A+H  M 
Sbjct: 120 QYYVKLKDNE-KNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMP 178

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q ER    +QF+    R+L+ T
Sbjct: 179 QEERLSRYQQFKDFQRRILVAT 200


>AB202112-3|BAE78637.1|  428|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 428

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVT-EADRRALKDIED 432
           L  RG+D+++V+   NYD+P + + Y                  FV+ E D + L D++D
Sbjct: 346 LFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQD 405

Query: 433 FYHTSIVEMPSDV 471
            +  +I E+P ++
Sbjct: 406 RFEVNISELPDEI 418



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 25/82 (30%), Positives = 42/82 (51%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+ ++  E K   L DL D L   Q VIF  + ++   L + +  ++F   A+H  M 
Sbjct: 264 QYYVKLKDNE-KNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMP 322

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q ER    +QF+    R+L+ T
Sbjct: 323 QEERLSRYQQFKDFQRRILVAT 344


>AB103621-3|BAF31287.1|  443|Homo sapiens BAT1 protein protein.
          Length = 443

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVT-EADRRALKDIED 432
           L  RG+D+++V+   NYD+P + + Y                  FV+ E D + L D++D
Sbjct: 361 LFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQD 420

Query: 433 FYHTSIVEMPSDV 471
            +  +I E+P ++
Sbjct: 421 RFEVNISELPDEI 433



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 25/82 (30%), Positives = 42/82 (51%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+ ++  E K   L DL D L   Q VIF  + ++   L + +  ++F   A+H  M 
Sbjct: 279 QYYVKLKDNE-KNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMP 337

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q ER    +QF+    R+L+ T
Sbjct: 338 QEERLSRYQQFKDFQRRILVAT 359


>AB088115-3|BAC54953.1|  428|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 428

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVT-EADRRALKDIED 432
           L  RG+D+++V+   NYD+P + + Y                  FV+ E D + L D++D
Sbjct: 346 LFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQD 405

Query: 433 FYHTSIVEMPSDV 471
            +  +I E+P ++
Sbjct: 406 RFEVNISELPDEI 418



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 25/82 (30%), Positives = 42/82 (51%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+ ++  E K   L DL D L   Q VIF  + ++   L + +  ++F   A+H  M 
Sbjct: 264 QYYVKLKDNE-KNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMP 322

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q ER    +QF+    R+L+ T
Sbjct: 323 QEERLSRYQQFKDFQRRILVAT 344


>U90426-1|AAB50231.1|  427|Homo sapiens nuclear RNA helicase
           protein.
          Length = 427

 Score = 43.2 bits (97), Expect = 0.001
 Identities = 19/73 (26%), Positives = 36/73 (49%), Gaps = 1/73 (1%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVT-EADRRALKDIED 432
           L  RG+D+++V+ V NYD+P + + Y                  FV+ E D + L  ++D
Sbjct: 345 LFGRGMDIERVNIVFNYDMPEDSDTYLHRVARGGRFGTKGLAITFVSDENDAKILNHVQD 404

Query: 433 FYHTSIVEMPSDV 471
               ++ E+P ++
Sbjct: 405 RCEVNVAELPEEI 417



 Score = 40.3 bits (90), Expect = 0.007
 Identities = 24/82 (29%), Positives = 42/82 (51%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+ ++  E K   L DL D L   Q +IF  + ++   L + +  ++F   A+H  M 
Sbjct: 263 QYYVKLKDSE-KNRKLFDLLDVLEFNQVIIFVKSVQRCMALAQLLVEQNFPAIAIHRGMA 321

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q ER    +QF+    R+L+ T
Sbjct: 322 QEERLSRYQQFKDFQRRILVAT 343


>BX248516-4|CAI41924.2|  425|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 425

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 25/82 (30%), Positives = 42/82 (51%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+ ++  E K   L DL D L   Q VIF  + ++   L + +  ++F   A+H  M 
Sbjct: 264 QYYVKLKDNE-KNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMP 322

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q ER    +QF+    R+L+ T
Sbjct: 323 QEERLSRYQQFKDFQRRILVAT 344



 Score = 31.9 bits (69), Expect = 2.3
 Identities = 10/26 (38%), Positives = 18/26 (69%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENY 333
           L  RG+D+++V+   NYD+P + + Y
Sbjct: 346 LFGRGMDIERVNIAFNYDMPEDSDTY 371


>AL662847-21|CAI17672.2|  425|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 425

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 25/82 (30%), Positives = 42/82 (51%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+ ++  E K   L DL D L   Q VIF  + ++   L + +  ++F   A+H  M 
Sbjct: 264 QYYVKLKDNE-KNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMP 322

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q ER    +QF+    R+L+ T
Sbjct: 323 QEERLSRYQQFKDFQRRILVAT 344



 Score = 31.9 bits (69), Expect = 2.3
 Identities = 10/26 (38%), Positives = 18/26 (69%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENY 333
           L  RG+D+++V+   NYD+P + + Y
Sbjct: 346 LFGRGMDIERVNIAFNYDMPEDSDTY 371


>AL662801-4|CAI18284.2|  425|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 425

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 25/82 (30%), Positives = 42/82 (51%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+ ++  E K   L DL D L   Q VIF  + ++   L + +  ++F   A+H  M 
Sbjct: 264 QYYVKLKDNE-KNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMP 322

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q ER    +QF+    R+L+ T
Sbjct: 323 QEERLSRYQQFKDFQRRILVAT 344



 Score = 31.9 bits (69), Expect = 2.3
 Identities = 10/26 (38%), Positives = 18/26 (69%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENY 333
           L  RG+D+++V+   NYD+P + + Y
Sbjct: 346 LFGRGMDIERVNIAFNYDMPEDSDTY 371


>BC041785-1|AAH41785.1|  599|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 52 protein.
          Length = 599

 Score = 39.5 bits (88), Expect = 0.012
 Identities = 22/67 (32%), Positives = 30/67 (44%)
 Frame = +1

Query: 226 WLFSCLDHHCLLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEAD 405
           W+  C     LLARGID + V+ VINYD P++   Y                  F TE D
Sbjct: 464 WVLICT---ALLARGIDFKGVNLVINYDFPTSSVEYIHRIGRTGRAGNKGKAITFFTEDD 520

Query: 406 RRALKDI 426
           +  L+ +
Sbjct: 521 KPLLRSV 527


>BC034953-1|AAH34953.1|  824|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 20 protein.
          Length = 824

 Score = 39.5 bits (88), Expect = 0.012
 Identities = 21/79 (26%), Positives = 41/79 (51%)
 Frame = +2

Query: 17  IAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQRE 196
           +A ++ E K + L +L+  +   QA++F N   +   L + +  + F    + G+M+Q +
Sbjct: 288 LAHKVFEEKTQHLQELFSRIPFNQALVFSNLHSRAQHLADILSSKGFPAECISGNMNQNQ 347

Query: 197 REVIMRQFRTGSSRVLITT 253
           R   M + +    RVLI+T
Sbjct: 348 RLDAMAKLKHFHCRVLIST 366



 Score = 30.7 bits (66), Expect = 5.4
 Identities = 12/26 (46%), Positives = 19/26 (73%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENY 333
           L +RGID ++V+ V+N D+P + E Y
Sbjct: 368 LTSRGIDAEKVNLVVNLDVPLDWETY 393


>BC031062-1|AAH31062.1|  824|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 20 protein.
          Length = 824

 Score = 39.5 bits (88), Expect = 0.012
 Identities = 21/79 (26%), Positives = 41/79 (51%)
 Frame = +2

Query: 17  IAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQRE 196
           +A ++ E K + L +L+  +   QA++F N   +   L + +  + F    + G+M+Q +
Sbjct: 288 LAHKVFEEKTQHLQELFSRIPFNQALVFSNLHSRAQHLADILSSKGFPAECISGNMNQNQ 347

Query: 197 REVIMRQFRTGSSRVLITT 253
           R   M + +    RVLI+T
Sbjct: 348 RLDAMAKLKHFHCRVLIST 366



 Score = 30.7 bits (66), Expect = 5.4
 Identities = 12/26 (46%), Positives = 19/26 (73%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENY 333
           L +RGID ++V+ V+N D+P + E Y
Sbjct: 368 LTSRGIDAEKVNLVVNLDVPLDWETY 393


>BC012304-1|AAH12304.1| 1031|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 46 protein.
          Length = 1031

 Score = 39.5 bits (88), Expect = 0.012
 Identities = 21/79 (26%), Positives = 40/79 (50%)
 Frame = +2

Query: 17  IAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQRE 196
           I IE E+  L+ L  L         +IF + +   D L + +    +   ++HG +DQ +
Sbjct: 598 IVIEEEKKFLKLLELLGHYQESGSVIIFVDKQEHADGLLKDLMRASYPCMSLHGGIDQYD 657

Query: 197 REVIMRQFRTGSSRVLITT 253
           R+ I+  F+ G+ ++L+ T
Sbjct: 658 RDSIINDFKNGTCKLLVAT 676



 Score = 37.1 bits (82), Expect = 0.062
 Identities = 21/73 (28%), Positives = 31/73 (42%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+DV+ +  V+NY  P++ E+Y                  F+TE   R   DI     
Sbjct: 680 ARGLDVKHLILVVNYSCPNHYEDYVHRAGRTGRAGNKGYAYTFITEDQARYAGDIIKALE 739

Query: 442 TSIVEMPSDVANL 480
            S   +P D+  L
Sbjct: 740 LSGTAVPPDLEKL 752


>BC011556-1|AAH11556.1|  824|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 20 protein.
          Length = 824

 Score = 39.5 bits (88), Expect = 0.012
 Identities = 21/79 (26%), Positives = 41/79 (51%)
 Frame = +2

Query: 17  IAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQRE 196
           +A ++ E K + L +L+  +   QA++F N   +   L + +  + F    + G+M+Q +
Sbjct: 288 LAHKVFEEKTQHLQELFSRIPFNQALVFSNLHSRAQHLADILSSKGFPAECISGNMNQNQ 347

Query: 197 REVIMRQFRTGSSRVLITT 253
           R   M + +    RVLI+T
Sbjct: 348 RLDAMAKLKHFHCRVLIST 366



 Score = 30.7 bits (66), Expect = 5.4
 Identities = 12/26 (46%), Positives = 19/26 (73%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENY 333
           L +RGID ++V+ V+N D+P + E Y
Sbjct: 368 LTSRGIDAEKVNLVVNLDVPLDWETY 393


>BC002366-1|AAH02366.1|  820|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 23 protein.
          Length = 820

 Score = 39.5 bits (88), Expect = 0.012
 Identities = 20/72 (27%), Positives = 33/72 (45%), Gaps = 1/72 (1%)
 Frame = +1

Query: 265 RGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIED-FYH 441
           RGID+Q VS V+NYD+  N E+Y                  F+T+ D     +++     
Sbjct: 726 RGIDIQDVSMVVNYDMAKNIEDYIHRIGRTGRAGKSGVAITFLTKEDSAVFYELKQAILE 785

Query: 442 TSIVEMPSDVAN 477
           + +   P ++AN
Sbjct: 786 SPVSSCPPELAN 797



 Score = 36.7 bits (81), Expect = 0.082
 Identities = 14/54 (25%), Positives = 27/54 (50%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           +IF N ++  D L +S+    +    +HG   Q +RE  +   + G+  +L+ T
Sbjct: 668 IIFVNQKKGCDVLAKSLEKMGYNACTLHGGKGQEQREFALSNLKAGAKDILVAT 721


>AL049557-7|CAB55686.2|  824|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 20 protein.
          Length = 824

 Score = 39.5 bits (88), Expect = 0.012
 Identities = 21/79 (26%), Positives = 41/79 (51%)
 Frame = +2

Query: 17  IAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQRE 196
           +A ++ E K + L +L+  +   QA++F N   +   L + +  + F    + G+M+Q +
Sbjct: 288 LAHKVFEEKTQHLQELFSRIPFNQALVFSNLHSRAQHLADILSSKGFPAECISGNMNQNQ 347

Query: 197 REVIMRQFRTGSSRVLITT 253
           R   M + +    RVLI+T
Sbjct: 348 RLDAMAKLKHFHCRVLIST 366



 Score = 30.7 bits (66), Expect = 5.4
 Identities = 12/26 (46%), Positives = 19/26 (73%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENY 333
           L +RGID ++V+ V+N D+P + E Y
Sbjct: 368 LTSRGIDAEKVNLVVNLDVPLDWETY 393


>AK001652-1|BAA91812.1|  491|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10790 fis, clone NT2RP4000518, weakly similar to
           ATP-DEPENDENT RNA HELICASE ROK1. ).
          Length = 491

 Score = 39.5 bits (88), Expect = 0.012
 Identities = 22/67 (32%), Positives = 30/67 (44%)
 Frame = +1

Query: 226 WLFSCLDHHCLLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEAD 405
           W+  C     LLARGID + V+ VINYD P++   Y                  F TE D
Sbjct: 356 WVLICT---ALLARGIDFKGVNLVINYDFPTSSVEYIHRIGRTGRAGNKGKAITFFTEDD 412

Query: 406 RRALKDI 426
           +  L+ +
Sbjct: 413 KPLLRSV 419


>AK001506-1|BAA91727.1|  824|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10644 fis, clone NT2RP2005763, weakly similar to
           EUKARYOTIC INITIATION FACTOR 4A. ).
          Length = 824

 Score = 39.5 bits (88), Expect = 0.012
 Identities = 21/79 (26%), Positives = 41/79 (51%)
 Frame = +2

Query: 17  IAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQRE 196
           +A ++ E K + L +L+  +   QA++F N   +   L + +  + F    + G+M+Q +
Sbjct: 288 LAHKVFEEKTQHLQELFSRIPFNQALVFSNLHSRAQHLADILSSKGFPAECISGNMNQNQ 347

Query: 197 REVIMRQFRTGSSRVLITT 253
           R   M + +    RVLI+T
Sbjct: 348 RLDAMAKLKHFHCRVLIST 366



 Score = 30.7 bits (66), Expect = 5.4
 Identities = 12/26 (46%), Positives = 19/26 (73%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENY 333
           L +RGID ++V+ V+N D+P + E Y
Sbjct: 368 LTSRGIDAEKVNLVVNLDVPLDWETY 393


>AJ010840-1|CAA09374.1|  420|Homo sapiens ATP-dependent RNA helicase
           protein.
          Length = 420

 Score = 39.5 bits (88), Expect = 0.012
 Identities = 22/67 (32%), Positives = 30/67 (44%)
 Frame = +1

Query: 226 WLFSCLDHHCLLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEAD 405
           W+  C     LLARGID + V+ VINYD P++   Y                  F TE D
Sbjct: 285 WVLICT---ALLARGIDFKGVNLVINYDFPTSSVEYIHRIGRTGRAGNKGKAITFFTEDD 341

Query: 406 RRALKDI 426
           +  L+ +
Sbjct: 342 KPLLRSV 348


>AF171063-1|AAF14544.1|  824|Homo sapiens DEAD box RNA helicase
           Gemin3 protein.
          Length = 824

 Score = 39.5 bits (88), Expect = 0.012
 Identities = 21/79 (26%), Positives = 41/79 (51%)
 Frame = +2

Query: 17  IAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQRE 196
           +A ++ E K + L +L+  +   QA++F N   +   L + +  + F    + G+M+Q +
Sbjct: 288 LAHKVFEEKTQHLQELFSRIPFNQALVFSNLHSRAQHLADILSSKGFPAECISGNMNQNQ 347

Query: 197 REVIMRQFRTGSSRVLITT 253
           R   M + +    RVLI+T
Sbjct: 348 RLDAMAKLKHFHCRVLIST 366



 Score = 30.7 bits (66), Expect = 5.4
 Identities = 12/26 (46%), Positives = 19/26 (73%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENY 333
           L +RGID ++V+ V+N D+P + E Y
Sbjct: 368 LTSRGIDAEKVNLVVNLDVPLDWETY 393


>AF106680-1|AAD43033.1| 1031|Homo sapiens RNA helicase protein.
          Length = 1031

 Score = 39.5 bits (88), Expect = 0.012
 Identities = 21/79 (26%), Positives = 40/79 (50%)
 Frame = +2

Query: 17  IAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQRE 196
           I IE E+  L+ L  L         +IF + +   D L + +    +   ++HG +DQ +
Sbjct: 597 IVIEEEKKFLKLLELLGHYQESGSVIIFVDKQEHADGLLKDLMRASYPCMSLHGGIDQYD 656

Query: 197 REVIMRQFRTGSSRVLITT 253
           R+ I+  F+ G+ ++L+ T
Sbjct: 657 RDSIINDFKNGTCKLLVAT 675



 Score = 37.1 bits (82), Expect = 0.062
 Identities = 21/73 (28%), Positives = 31/73 (42%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+DV+ +  V+NY  P++ E+Y                  F+TE   R   DI     
Sbjct: 679 ARGLDVKHLILVVNYSCPNHYEDYVHRAGRTGRAGNKGYAYTFITEDQARYAGDIIKALE 738

Query: 442 TSIVEMPSDVANL 480
            S   +P D+  L
Sbjct: 739 LSGTAVPPDLEKL 751


>AF106019-1|AAD42744.1|  824|Homo sapiens DEAD-box protein protein.
          Length = 824

 Score = 39.5 bits (88), Expect = 0.012
 Identities = 21/79 (26%), Positives = 41/79 (51%)
 Frame = +2

Query: 17  IAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQRE 196
           +A ++ E K + L +L+  +   QA++F N   +   L + +  + F    + G+M+Q +
Sbjct: 288 LAHKVFEEKTQHLQELFSRIPFNQALVFSNLHSRAQHLADILSSKGFPAECISGNMNQNQ 347

Query: 197 REVIMRQFRTGSSRVLITT 253
           R   M + +    RVLI+T
Sbjct: 348 RLDAMAKLKHFHCRVLIST 366



 Score = 30.7 bits (66), Expect = 5.4
 Identities = 12/26 (46%), Positives = 19/26 (73%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENY 333
           L +RGID ++V+ V+N D+P + E Y
Sbjct: 368 LTSRGIDAEKVNLVVNLDVPLDWETY 393


>AF026402-1|AAB87902.1|  820|Homo sapiens U5 snRNP 100 kD protein
           protein.
          Length = 820

 Score = 39.5 bits (88), Expect = 0.012
 Identities = 20/72 (27%), Positives = 33/72 (45%), Gaps = 1/72 (1%)
 Frame = +1

Query: 265 RGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIED-FYH 441
           RGID+Q VS V+NYD+  N E+Y                  F+T+ D     +++     
Sbjct: 726 RGIDIQDVSMVVNYDMAKNIEDYIHRIGRTGRAGKSGVAITFLTKEDSAVFYELKQAILE 785

Query: 442 TSIVEMPSDVAN 477
           + +   P ++AN
Sbjct: 786 SPVSSCPPELAN 797



 Score = 36.7 bits (81), Expect = 0.082
 Identities = 14/54 (25%), Positives = 27/54 (50%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           +IF N ++  D L +S+    +    +HG   Q +RE  +   + G+  +L+ T
Sbjct: 668 IIFVNQKKGCDVLAKSLEKMGYNACTLHGGKGQEQREFALSNLKAGAKDILVAT 721


>AB018344-1|BAA34521.2| 1058|Homo sapiens KIAA0801 protein protein.
          Length = 1058

 Score = 39.5 bits (88), Expect = 0.012
 Identities = 21/79 (26%), Positives = 40/79 (50%)
 Frame = +2

Query: 17  IAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQRE 196
           I IE E+  L+ L  L         +IF + +   D L + +    +   ++HG +DQ +
Sbjct: 624 IVIEEEKKFLKLLELLGHYQESGSVIIFVDKQEHADGLLKDLMRASYPCMSLHGGIDQYD 683

Query: 197 REVIMRQFRTGSSRVLITT 253
           R+ I+  F+ G+ ++L+ T
Sbjct: 684 RDSIINDFKNGTCKLLVAT 702



 Score = 37.1 bits (82), Expect = 0.062
 Identities = 21/73 (28%), Positives = 31/73 (42%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+DV+ +  V+NY  P++ E+Y                  F+TE   R   DI     
Sbjct: 706 ARGLDVKHLILVVNYSCPNHYEDYVHRAGRTGRAGNKGYAYTFITEDQARYAGDIIKALE 765

Query: 442 TSIVEMPSDVANL 480
            S   +P D+  L
Sbjct: 766 LSGTAVPPDLEKL 778


>AF155803-1|AAK56799.1|  824|Homo sapiens DEAD-box corepressor DP103
           protein.
          Length = 824

 Score = 38.7 bits (86), Expect = 0.020
 Identities = 21/79 (26%), Positives = 41/79 (51%)
 Frame = +2

Query: 17  IAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQRE 196
           +A ++ E K + L +L+  +   QA++F N   +   L + +  + F    + G+M+Q +
Sbjct: 288 LAHKVFEEKTQHLQELFSRIPFNQALVFSNLHSRAQHLADILSSKGFPAECILGNMNQNQ 347

Query: 197 REVIMRQFRTGSSRVLITT 253
           R   M + +    RVLI+T
Sbjct: 348 RLDAMAKLKHFHCRVLIST 366



 Score = 30.7 bits (66), Expect = 5.4
 Identities = 12/26 (46%), Positives = 19/26 (73%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENY 333
           L +RGID ++V+ V+N D+P + E Y
Sbjct: 368 LTSRGIDAEKVNLVVNLDVPLDWETY 393


>BC067878-1|AAH67878.1|  631|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 53 protein.
          Length = 631

 Score = 38.3 bits (85), Expect = 0.027
 Identities = 13/56 (23%), Positives = 35/56 (62%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           + ++F + +   D L+   +++  +  ++HG+ +Q ++E  +  F++G+ ++LITT
Sbjct: 469 KVIMFVSQKHIADDLSSDFNIQGISAESLHGNSEQSDQERAVEDFKSGNIKILITT 524



 Score = 30.7 bits (66), Expect = 5.4
 Identities = 15/72 (20%), Positives = 30/72 (41%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           +++RG+D+  V+ V NYD P N + Y                   +T+ D +   ++   
Sbjct: 526 IVSRGLDLNDVTHVYNYDFPRNIDVYVHRVGYIGRTGKTGTSVTLITQRDSKMAGELIKI 585

Query: 436 YHTSIVEMPSDV 471
              +   +P D+
Sbjct: 586 LDRANQSVPEDL 597


>BC051703-1|AAH51703.1|  631|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 53 protein.
          Length = 631

 Score = 38.3 bits (85), Expect = 0.027
 Identities = 13/56 (23%), Positives = 35/56 (62%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           + ++F + +   D L+   +++  +  ++HG+ +Q ++E  +  F++G+ ++LITT
Sbjct: 469 KVIMFVSQKHIADDLSSDFNIQGISAESLHGNSEQSDQERAVEDFKSGNIKILITT 524



 Score = 30.7 bits (66), Expect = 5.4
 Identities = 15/72 (20%), Positives = 30/72 (41%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           +++RG+D+  V+ V NYD P N + Y                   +T+ D +   ++   
Sbjct: 526 IVSRGLDLNDVTHVYNYDFPRNIDVYVHRVGYIGRTGKTGTSVTLITQRDSKMAGELIKI 585

Query: 436 YHTSIVEMPSDV 471
              +   +P D+
Sbjct: 586 LDRANQSVPEDL 597


>AY039237-1|AAK72102.1|  630|Homo sapiens DEAD-box protein CAGE
           protein.
          Length = 630

 Score = 38.3 bits (85), Expect = 0.027
 Identities = 13/56 (23%), Positives = 35/56 (62%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           + ++F + +   D L+   +++  +  ++HG+ +Q ++E  +  F++G+ ++LITT
Sbjct: 469 KVIMFVSQKHIADDLSSDFNIQGISAESLHGNSEQSDQERAVEDFKSGNIKILITT 524


>BX538033-1|CAD97978.1|  822|Homo sapiens hypothetical protein
           protein.
          Length = 822

 Score = 36.3 bits (80), Expect = 0.11
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRT 226
           + ++F      +D L +  HLRDF  S ++G M   ERE  M  F T
Sbjct: 601 KVLLFSQMTSMLDILMDYCHLRDFNFSRLNGSMSYSEREKNMHSFNT 647


>BC093081-1|AAH93081.1|  938|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 42 protein.
          Length = 938

 Score = 35.5 bits (78), Expect = 0.19
 Identities = 16/64 (25%), Positives = 29/64 (45%)
 Frame = +2

Query: 62  LYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRV 241
           L +  S    ++F   +   + L  ++      +  +HGDMDQ ER  ++  F+     V
Sbjct: 492 LVEFTSSGSVLLFVTKKANAEELANNLKQEGHNLGLLHGDMDQSERNKVISDFKKKDIPV 551

Query: 242 LITT 253
           L+ T
Sbjct: 552 LVAT 555


>BC078667-1|AAH78667.1|  919|Homo sapiens DDX42 protein protein.
          Length = 919

 Score = 35.5 bits (78), Expect = 0.19
 Identities = 16/64 (25%), Positives = 29/64 (45%)
 Frame = +2

Query: 62  LYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRV 241
           L +  S    ++F   +   + L  ++      +  +HGDMDQ ER  ++  F+     V
Sbjct: 473 LVEFTSSGSVLLFVTKKANAEELANNLKQEGHNLGLLHGDMDQSERNKVISDFKKKDIPV 532

Query: 242 LITT 253
           L+ T
Sbjct: 533 LVAT 536


>BC031004-1|AAH31004.1|  348|Homo sapiens HELLS protein protein.
          Length = 348

 Score = 35.5 bits (78), Expect = 0.19
 Identities = 17/47 (36%), Positives = 23/47 (48%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRT 226
           + ++F      +D L +  HLRDF  S + G M   ERE  M  F T
Sbjct: 127 KVLLFSQMTSMLDILMDYCHLRDFNFSRLDGSMSYSEREKNMHSFNT 173


>BC030963-1|AAH30963.1|  348|Homo sapiens HELLS protein protein.
          Length = 348

 Score = 35.5 bits (78), Expect = 0.19
 Identities = 17/47 (36%), Positives = 23/47 (48%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRT 226
           + ++F      +D L +  HLRDF  S + G M   ERE  M  F T
Sbjct: 127 KVLLFSQMTSMLDILMDYCHLRDFNFSRLDGSMSYSEREKNMHSFNT 173


>BC029381-1|AAH29381.1|  348|Homo sapiens HELLS protein protein.
          Length = 348

 Score = 35.5 bits (78), Expect = 0.19
 Identities = 17/47 (36%), Positives = 23/47 (48%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRT 226
           + ++F      +D L +  HLRDF  S + G M   ERE  M  F T
Sbjct: 127 KVLLFSQMTSMLDILMDYCHLRDFNFSRLDGSMSYSEREKNMHSFNT 173


>BC015505-1|AAH15505.1|  819|Homo sapiens DDX42 protein protein.
          Length = 819

 Score = 35.5 bits (78), Expect = 0.19
 Identities = 16/64 (25%), Positives = 29/64 (45%)
 Frame = +2

Query: 62  LYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRV 241
           L +  S    ++F   +   + L  ++      +  +HGDMDQ ER  ++  F+     V
Sbjct: 373 LVEFTSSGSVLLFVTKKANAEELANNLKQEGHNLGLLHGDMDQSERNKVISDFKKKDIPV 432

Query: 242 LITT 253
           L+ T
Sbjct: 433 LVAT 436


>BC015477-1|AAH15477.1|  317|Homo sapiens HELLS protein protein.
          Length = 317

 Score = 35.5 bits (78), Expect = 0.19
 Identities = 17/47 (36%), Positives = 23/47 (48%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRT 226
           + ++F      +D L +  HLRDF  S + G M   ERE  M  F T
Sbjct: 96  KVLLFSQMTSMLDILMDYCHLRDFNFSRLDGSMSYSEREKNMHSFNT 142


>AY007108-1|AAG01987.1|  348|Homo sapiens protein ( Homo sapiens
           clone TCCCTA00017 mRNA sequence. ).
          Length = 348

 Score = 35.5 bits (78), Expect = 0.19
 Identities = 17/47 (36%), Positives = 23/47 (48%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRT 226
           + ++F      +D L +  HLRDF  S + G M   ERE  M  F T
Sbjct: 127 KVLLFSQMTSMLDILMDYCHLRDFNFSRLDGSMSYSEREKNMHSFNT 173


>AL138759-4|CAH70224.1|  310|Homo sapiens helicase,
           lymphoid-specific protein.
          Length = 310

 Score = 35.5 bits (78), Expect = 0.19
 Identities = 17/47 (36%), Positives = 23/47 (48%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRT 226
           + ++F      +D L +  HLRDF  S + G M   ERE  M  F T
Sbjct: 54  KVLLFSQMTSMLDILMDYCHLRDFNFSRLDGSMSYSEREKNMHSFNT 100


>AL138759-1|CAD13191.1|  838|Homo sapiens helicase,
           lymphoid-specific protein.
          Length = 838

 Score = 35.5 bits (78), Expect = 0.19
 Identities = 17/47 (36%), Positives = 23/47 (48%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRT 226
           + ++F      +D L +  HLRDF  S + G M   ERE  M  F T
Sbjct: 617 KVLLFSQMTSMLDILMDYCHLRDFNFSRLDGSMSYSEREKNMHSFNT 663


>AK001201-1|BAA91550.1|  310|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10339 fis, clone NT2RM2000740, weakly similar to
           POSSIBLE GLOBAL TRANSCRIPTION ACTIVATOR SNF2L. ).
          Length = 310

 Score = 35.5 bits (78), Expect = 0.19
 Identities = 17/47 (36%), Positives = 23/47 (48%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRT 226
           + ++F      +D L +  HLRDF  S + G M   ERE  M  F T
Sbjct: 54  KVLLFSQMTSMLDILMDYCHLRDFNFSRLDGSMSYSEREKNMHSFNT 100


>AF155827-1|AAF82262.1|  838|Homo sapiens proliferation-associated
           SNF2-like protein protein.
          Length = 838

 Score = 35.5 bits (78), Expect = 0.19
 Identities = 17/47 (36%), Positives = 23/47 (48%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRT 226
           + ++F      +D L +  HLRDF  S + G M   ERE  M  F T
Sbjct: 617 KVLLFSQMTSMLDILMDYCHLRDFNFSRLDGSMSYSEREKNMHSFNT 663


>AF083255-1|AAC32396.1|  709|Homo sapiens RNA helicase-related
           protein protein.
          Length = 709

 Score = 35.5 bits (78), Expect = 0.19
 Identities = 16/64 (25%), Positives = 29/64 (45%)
 Frame = +2

Query: 62  LYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRV 241
           L +  S    ++F   +   + L  ++      +  +HGDMDQ ER  ++  F+     V
Sbjct: 373 LVEFTSSGSVLLFVTKKANAEELANNLKQEGHNLGLLHGDMDQSERNKVISDFKKKDIPV 432

Query: 242 LITT 253
           L+ T
Sbjct: 433 LVAT 436


>AB208938-1|BAD92175.1|  512|Homo sapiens ATP-dependent RNA helicase
           ROK1 isoform a variant protein.
          Length = 512

 Score = 35.5 bits (78), Expect = 0.19
 Identities = 17/36 (47%), Positives = 22/36 (61%)
 Frame = +1

Query: 226 WLFSCLDHHCLLARGIDVQQVSCVINYDLPSNRENY 333
           W+  C     LLARGID + V+ VINYD P++   Y
Sbjct: 463 WVLICT---ALLARGIDFKGVNLVINYDFPTSSVEY 495


>AB113249-1|BAD24805.1|  782|Homo sapiens lymphoid specific helicase
           variant10 protein.
          Length = 782

 Score = 35.5 bits (78), Expect = 0.19
 Identities = 17/47 (36%), Positives = 23/47 (48%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRT 226
           + ++F      +D L +  HLRDF  S + G M   ERE  M  F T
Sbjct: 617 KVLLFSQMTSMLDILMDYCHLRDFNFSRLDGSMSYSEREKNMHSFNT 663


>AB113248-1|BAD24804.1|  809|Homo sapiens lymphoid specific helicase
           variant9 protein.
          Length = 809

 Score = 35.5 bits (78), Expect = 0.19
 Identities = 17/47 (36%), Positives = 23/47 (48%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRT 226
           + ++F      +D L +  HLRDF  S + G M   ERE  M  F T
Sbjct: 617 KVLLFSQMTSMLDILMDYCHLRDFNFSRLDGSMSYSEREKNMHSFNT 663


>AB102723-1|BAD10851.1|  884|Homo sapiens lymphoid specific helicase
           variant8 protein.
          Length = 884

 Score = 35.5 bits (78), Expect = 0.19
 Identities = 17/47 (36%), Positives = 23/47 (48%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRT 226
           + ++F      +D L +  HLRDF  S + G M   ERE  M  F T
Sbjct: 663 KVLLFSQMTSMLDILMDYCHLRDFNFSRLDGSMSYSEREKNMHSFNT 709


>AB102721-1|BAD10849.1|  740|Homo sapiens lymphoid specific helicase
           variant6 protein.
          Length = 740

 Score = 35.5 bits (78), Expect = 0.19
 Identities = 17/47 (36%), Positives = 23/47 (48%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRT 226
           + ++F      +D L +  HLRDF  S + G M   ERE  M  F T
Sbjct: 519 KVLLFSQMTSMLDILMDYCHLRDFNFSRLDGSMSYSEREKNMHSFNT 565


>AB102719-1|BAD10847.1|  708|Homo sapiens lymphoid specific helicase
           variant4 protein.
          Length = 708

 Score = 35.5 bits (78), Expect = 0.19
 Identities = 17/47 (36%), Positives = 23/47 (48%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRT 226
           + ++F      +D L +  HLRDF  S + G M   ERE  M  F T
Sbjct: 487 KVLLFSQMTSMLDILMDYCHLRDFNFSRLDGSMSYSEREKNMHSFNT 533


>AB102718-1|BAD10846.1|  806|Homo sapiens lymphoid specific helicase
           variant3 protein.
          Length = 806

 Score = 35.5 bits (78), Expect = 0.19
 Identities = 17/47 (36%), Positives = 23/47 (48%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRT 226
           + ++F      +D L +  HLRDF  S + G M   ERE  M  F T
Sbjct: 585 KVLLFSQMTSMLDILMDYCHLRDFNFSRLDGSMSYSEREKNMHSFNT 631


>AB074174-1|BAE45737.1|  372|Homo sapiens putative protein product
           of Nbla10143 protein.
          Length = 372

 Score = 35.5 bits (78), Expect = 0.19
 Identities = 17/47 (36%), Positives = 23/47 (48%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRT 226
           + ++F      +D L +  HLRDF  S + G M   ERE  M  F T
Sbjct: 151 KVLLFSQMTSMLDILMDYCHLRDFNFSRLDGSMSYSEREKNMHSFNT 197


>AB036090-1|BAC66466.1|  938|Homo sapiens RNA helicase-related
           protein protein.
          Length = 938

 Score = 35.5 bits (78), Expect = 0.19
 Identities = 16/64 (25%), Positives = 29/64 (45%)
 Frame = +2

Query: 62  LYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRV 241
           L +  S    ++F   +   + L  ++      +  +HGDMDQ ER  ++  F+     V
Sbjct: 492 LVEFTSSGSVLLFVTKKANAEELANNLKQEGHNLGLLHGDMDQSERNKVISDFKKKDIPV 551

Query: 242 LITT 253
           L+ T
Sbjct: 552 LVAT 555


>AK223116-1|BAD96836.1|  408|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 27 variant protein.
          Length = 408

 Score = 34.7 bits (76), Expect = 0.33
 Identities = 17/55 (30%), Positives = 28/55 (50%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDI 426
           ARG+D++ V  VIN+ +PS  ++Y                 + V E +R+ LK+I
Sbjct: 136 ARGLDIEGVKTVINFTMPSTIKHYVHRVGRTARAGRAGRSVSLVGEDERKMLKEI 190


>AK000603-1|BAA91284.1|  406|Homo sapiens protein ( Homo sapiens
           cDNA FLJ20596 fis, clone KAT08049. ).
          Length = 406

 Score = 34.7 bits (76), Expect = 0.33
 Identities = 17/55 (30%), Positives = 28/55 (50%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDI 426
           ARG+D++ V  VIN+ +PS  ++Y                 + V E +R+ LK+I
Sbjct: 134 ARGLDIEGVKTVINFTMPSTIKHYVHRVGRTARAGRAGRSVSLVGEDERKMLKEI 188


>BC068009-1|AAH68009.1|  455|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 47 protein.
          Length = 455

 Score = 34.3 bits (75), Expect = 0.44
 Identities = 16/68 (23%), Positives = 30/68 (44%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           +RG+D+  V  V+N+D+P++ ++Y                  FVT+ D    + IE    
Sbjct: 324 SRGLDIPHVDVVVNFDIPTHSKDYIHRVGRTARAGRSGKAITFVTQYDVELFQRIEHLIG 383

Query: 442 TSIVEMPS 465
             +   P+
Sbjct: 384 KKLPGFPT 391


>BC009379-1|AAH09379.2|  450|Homo sapiens DDX47 protein protein.
          Length = 450

 Score = 34.3 bits (75), Expect = 0.44
 Identities = 16/68 (23%), Positives = 30/68 (44%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           +RG+D+  V  V+N+D+P++ ++Y                  FVT+ D    + IE    
Sbjct: 319 SRGLDIPHVDVVVNFDIPTHSKDYIHRVGRTARAGRSGKAITFVTQYDVELFQRIEHLIG 378

Query: 442 TSIVEMPS 465
             +   P+
Sbjct: 379 KKLPGFPT 386


>AL136666-1|CAB66601.1|  455|Homo sapiens hypothetical protein
           protein.
          Length = 455

 Score = 34.3 bits (75), Expect = 0.44
 Identities = 16/68 (23%), Positives = 30/68 (44%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           +RG+D+  V  V+N+D+P++ ++Y                  FVT+ D    + IE    
Sbjct: 324 SRGLDIPHVDVVVNFDIPTHSKDYIHRVGRTARAGRSGKAITFVTQYDVELFQRIEHLIG 383

Query: 442 TSIVEMPS 465
             +   P+
Sbjct: 384 KKLPGFPT 391


>AK222940-1|BAD96660.1|  448|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 47 isoform 1 variant protein.
          Length = 448

 Score = 34.3 bits (75), Expect = 0.44
 Identities = 16/68 (23%), Positives = 30/68 (44%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           +RG+D+  V  V+N+D+P++ ++Y                  FVT+ D    + IE    
Sbjct: 317 SRGLDIPHVDVVVNFDIPTHSKDYIHRVGRTARAGRSGKAITFVTQYDVELFQRIEHLIG 376

Query: 442 TSIVEMPS 465
             +   P+
Sbjct: 377 KKLPGFPT 384


>AK054574-1|BAB70762.1|  455|Homo sapiens protein ( Homo sapiens
           cDNA FLJ30012 fis, clone 3NB692000281, moderately
           similar to PUTATIVE ATP-DEPENDENT RNA HELICASE T26G10.1
           IN CHROMOSOME III. ).
          Length = 455

 Score = 34.3 bits (75), Expect = 0.44
 Identities = 16/68 (23%), Positives = 30/68 (44%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           +RG+D+  V  V+N+D+P++ ++Y                  FVT+ D    + IE    
Sbjct: 324 SRGLDIPHVDVVVNFDIPTHSKDYIHRVGRTARAGRSGKAITFVTQYDVELFQRIEHLIG 383

Query: 442 TSIVEMPS 465
             +   P+
Sbjct: 384 KKLPGFPT 391


>AJ276704-1|CAC14786.1|  455|Homo sapiens DEAD box protein protein.
          Length = 455

 Score = 34.3 bits (75), Expect = 0.44
 Identities = 16/68 (23%), Positives = 30/68 (44%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           +RG+D+  V  V+N+D+P++ ++Y                  FVT+ D    + IE    
Sbjct: 324 SRGLDIPHVDVVVNFDIPTHSKDYIHRVGRTARAGRSGKAITFVTQYDVELFQRIEHLIG 383

Query: 442 TSIVEMPS 465
             +   P+
Sbjct: 384 KKLPGFPT 391


>AF078843-1|AAF23354.1|  274|Homo sapiens hqp0256 protein protein.
          Length = 274

 Score = 34.3 bits (75), Expect = 0.44
 Identities = 16/68 (23%), Positives = 30/68 (44%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           +RG+D+  V  V+N+D+P++ ++Y                  FVT+ D    + IE    
Sbjct: 143 SRGLDIPHVDVVVNFDIPTHSKDYIHRVGRTARAGRSGKAITFVTQYDVELFQRIEHLIG 202

Query: 442 TSIVEMPS 465
             +   P+
Sbjct: 203 KKLPGFPT 210


>AK222662-1|BAD96382.1|  547|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 56 variant protein.
          Length = 547

 Score = 33.9 bits (74), Expect = 0.58
 Identities = 19/58 (32%), Positives = 25/58 (43%)
 Frame = +1

Query: 259 LARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIED 432
           +ARGID   VS V+N+DLP   E Y                  FV   ++  L  IE+
Sbjct: 345 VARGIDFHHVSAVLNFDLPPTTEAYIHRAGRTARANNPGIVLTFVLPTEQFHLGKIEE 402


>CR457213-1|CAG33494.1|  547|Homo sapiens DDX56 protein.
          Length = 547

 Score = 33.5 bits (73), Expect = 0.77
 Identities = 19/58 (32%), Positives = 25/58 (43%)
 Frame = +1

Query: 259 LARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIED 432
           +ARGID   VS V+N+DLP   E Y                  FV   ++  L  IE+
Sbjct: 345 VARGIDFHHVSAVLNFDLPPTPEAYIHRAGRTARANNPGIVLTFVLPTEQFHLGKIEE 402


>BC130275-1|AAI30276.1|  796|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 27 protein.
          Length = 796

 Score = 33.5 bits (73), Expect = 0.77
 Identities = 16/55 (29%), Positives = 28/55 (50%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDI 426
           ARG+D++ V  VIN+ +P+  ++Y                 + V E +R+ LK+I
Sbjct: 524 ARGLDIEGVKTVINFTMPNTIKHYVHRVGRTARAGRAGRSVSLVGEDERKMLKEI 578


>BC126287-1|AAI26288.1|  796|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 27 protein.
          Length = 796

 Score = 33.5 bits (73), Expect = 0.77
 Identities = 16/55 (29%), Positives = 28/55 (50%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDI 426
           ARG+D++ V  VIN+ +P+  ++Y                 + V E +R+ LK+I
Sbjct: 524 ARGLDIEGVKTVINFTMPNTIKHYVHRVGRTARAGRAGRSVSLVGEDERKMLKEI 578


>BC016060-1|AAH16060.2|  767|Homo sapiens DDX27 protein protein.
          Length = 767

 Score = 33.5 bits (73), Expect = 0.77
 Identities = 16/55 (29%), Positives = 28/55 (50%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDI 426
           ARG+D++ V  VIN+ +P+  ++Y                 + V E +R+ LK+I
Sbjct: 495 ARGLDIEGVKTVINFTMPNTIKHYVHRVGRTARAGRAGRSVSLVGEDERKMLKEI 549


>BC011927-1|AAH11927.2|  767|Homo sapiens DDX27 protein protein.
          Length = 767

 Score = 33.5 bits (73), Expect = 0.77
 Identities = 16/55 (29%), Positives = 28/55 (50%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDI 426
           ARG+D++ V  VIN+ +P+  ++Y                 + V E +R+ LK+I
Sbjct: 495 ARGLDIEGVKTVINFTMPNTIKHYVHRVGRTARAGRAGRSVSLVGEDERKMLKEI 549


>BC009304-1|AAH09304.2|  769|Homo sapiens DDX27 protein protein.
          Length = 769

 Score = 33.5 bits (73), Expect = 0.77
 Identities = 16/55 (29%), Positives = 28/55 (50%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDI 426
           ARG+D++ V  VIN+ +P+  ++Y                 + V E +R+ LK+I
Sbjct: 497 ARGLDIEGVKTVINFTMPNTIKHYVHRVGRTARAGRAGRSVSLVGEDERKMLKEI 551


>BC002674-1|AAH02674.1|  483|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 49 protein.
          Length = 483

 Score = 33.5 bits (73), Expect = 0.77
 Identities = 17/54 (31%), Positives = 27/54 (50%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           +IF NT +    L   +    F   A+H  M Q+ER   + +F++   R+LI T
Sbjct: 252 IIFTNTCKTCQILCMMLRKFSFPTVALHSMMKQKERFAALAKFKSSIYRILIAT 305


>BC001235-1|AAH01235.1|  547|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 56 protein.
          Length = 547

 Score = 33.5 bits (73), Expect = 0.77
 Identities = 19/58 (32%), Positives = 25/58 (43%)
 Frame = +1

Query: 259 LARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIED 432
           +ARGID   VS V+N+DLP   E Y                  FV   ++  L  IE+
Sbjct: 345 VARGIDFHHVSAVLNFDLPPTPEAYIHRAGRTARANNPGIVLTFVLPTEQFHLGKIEE 402


>BC000979-1|AAH00979.2|  254|Homo sapiens DDX49 protein protein.
          Length = 254

 Score = 33.5 bits (73), Expect = 0.77
 Identities = 17/54 (31%), Positives = 27/54 (50%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           +IF NT +    L   +    F   A+H  M Q+ER   + +F++   R+LI T
Sbjct: 145 IIFTNTCKTCQILCMMLRKFSFPTVALHSMMKQKERFAALAKFKSSIYRILIAT 198


>AY044431-1|AAK95821.1|  796|Homo sapiens RNA helicase-like protein
           protein.
          Length = 796

 Score = 33.5 bits (73), Expect = 0.77
 Identities = 16/55 (29%), Positives = 28/55 (50%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDI 426
           ARG+D++ V  VIN+ +P+  ++Y                 + V E +R+ LK+I
Sbjct: 524 ARGLDIEGVKTVINFTMPNTIKHYDHRVGRTARAGRAGRSVSLVGEDERKMLKEI 578


>AL357560-1|CAH70236.1|  796|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 27 protein.
          Length = 796

 Score = 33.5 bits (73), Expect = 0.77
 Identities = 16/55 (29%), Positives = 28/55 (50%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDI 426
           ARG+D++ V  VIN+ +P+  ++Y                 + V E +R+ LK+I
Sbjct: 524 ARGLDIEGVKTVINFTMPNTIKHYVHRVGRTARAGRAGRSVSLVGEDERKMLKEI 578


>AL049766-1|CAI22427.1|  796|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 27 protein.
          Length = 796

 Score = 33.5 bits (73), Expect = 0.77
 Identities = 16/55 (29%), Positives = 28/55 (50%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDI 426
           ARG+D++ V  VIN+ +P+  ++Y                 + V E +R+ LK+I
Sbjct: 524 ARGLDIEGVKTVINFTMPNTIKHYVHRVGRTARAGRAGRSVSLVGEDERKMLKEI 578


>AK223294-1|BAD97014.1|  483|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 49 variant protein.
          Length = 483

 Score = 33.5 bits (73), Expect = 0.77
 Identities = 17/54 (31%), Positives = 27/54 (50%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           +IF NT +    L   +    F   A+H  M Q+ER   + +F++   R+LI T
Sbjct: 252 IIFTNTCKTCQILCMMLRKFSFPTVALHSMMKQKERFAALAKFKSSIYRILIAT 305


>AK022979-1|BAB14343.1|  765|Homo sapiens protein ( Homo sapiens
           cDNA FLJ12917 fis, clone NT2RP2004568, weakly similar to
           PUTATIVE ATP-DEPENDENT RNA HELICASE C30D11.03. ).
          Length = 765

 Score = 33.5 bits (73), Expect = 0.77
 Identities = 16/55 (29%), Positives = 28/55 (50%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDI 426
           ARG+D++ V  VIN+ +P+  ++Y                 + V E +R+ LK+I
Sbjct: 493 ARGLDIEGVKTVINFTMPNTIKHYDHRVGRTARAGRAGRSVSLVGEDERKMLKEI 547


>AK022774-1|BAB14238.1|  547|Homo sapiens protein ( Homo sapiens
           cDNA FLJ12712 fis, clone NT2RP1001080, weakly similar to
           PROBABLE ATP-DEPENDENT RNA HELICASE DBP9. ).
          Length = 547

 Score = 33.5 bits (73), Expect = 0.77
 Identities = 19/58 (32%), Positives = 25/58 (43%)
 Frame = +1

Query: 259 LARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIED 432
           +ARGID   VS V+N+DLP   E Y                  FV   ++  L  IE+
Sbjct: 345 VARGIDFHHVSAVLNFDLPPTPEAYIHRAGRTARANNPGIVLTFVLPTEQFHLGKIEE 402


>AJ131712-1|CAB87992.1|  547|Homo sapiens nucleolar RNA-helicase
           protein.
          Length = 547

 Score = 33.5 bits (73), Expect = 0.77
 Identities = 19/58 (32%), Positives = 25/58 (43%)
 Frame = +1

Query: 259 LARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIED 432
           +ARGID   VS V+N+DLP   E Y                  FV   ++  L  IE+
Sbjct: 345 VARGIDFHHVSAVLNFDLPPTPEAYIHRAGRTARANNPGIVLTFVLPTEQFHLGKIEE 402


>AF336851-1|AAK21271.1|  561|Homo sapiens RNA helicase-like protein
           protein.
          Length = 561

 Score = 33.5 bits (73), Expect = 0.77
 Identities = 16/55 (29%), Positives = 28/55 (50%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDI 426
           ARG+D++ V  VIN+ +P+  ++Y                 + V E +R+ LK+I
Sbjct: 289 ARGLDIEGVKTVINFTMPNTIKHYVHRVGRTARAGRAGRSVSLVGEDERKMLKEI 343


>AF247666-1|AAG36876.1|  547|Homo sapiens DEAD-box RNA helicase
           protein.
          Length = 547

 Score = 33.5 bits (73), Expect = 0.77
 Identities = 19/58 (32%), Positives = 25/58 (43%)
 Frame = +1

Query: 259 LARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIED 432
           +ARGID   VS V+N+DLP   E Y                  FV   ++  L  IE+
Sbjct: 345 VARGIDFHHVSAVLNFDLPPTPEAYIHRAGRTARANNPGIVLTFVLPTEQFHLGKIEE 402


>AC002985-2|AAB81544.1|  483|Homo sapiens R27090_2 protein.
          Length = 483

 Score = 33.5 bits (73), Expect = 0.77
 Identities = 17/54 (31%), Positives = 27/54 (50%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           +IF NT +    L   +    F   A+H  M Q+ER   + +F++   R+LI T
Sbjct: 252 IIFTNTCKTCQILCMMLRKFSFPTVALHSMMKQKERFAALAKFKSSIYRILIAT 305


>BC041801-1|AAH41801.1|  619|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 59 protein.
          Length = 619

 Score = 32.7 bits (71), Expect = 1.3
 Identities = 15/57 (26%), Positives = 25/57 (43%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDI 426
           +L RG+D+  V  V+N+D+PS+ + Y                  F+    +R   DI
Sbjct: 504 VLGRGLDLISVRLVVNFDMPSSMDEYVHQIGRVGRLGQNGTAITFINNNSKRLFWDI 560


>AL445483-6|CAI17056.1|  619|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 59 protein.
          Length = 619

 Score = 32.7 bits (71), Expect = 1.3
 Identities = 15/57 (26%), Positives = 25/57 (43%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDI 426
           +L RG+D+  V  V+N+D+PS+ + Y                  F+    +R   DI
Sbjct: 504 VLGRGLDLISVRLVVNFDMPSSMDEYVHQIGRVGRLGQNGTAITFINNNSKRLFWDI 560


>AL445483-4|CAI17054.1|  196|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 59 protein.
          Length = 196

 Score = 32.7 bits (71), Expect = 1.3
 Identities = 15/57 (26%), Positives = 25/57 (43%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDI 426
           +L RG+D+  V  V+N+D+PS+ + Y                  F+    +R   DI
Sbjct: 81  VLGRGLDLISVRLVVNFDMPSSMDEYVHQIGRVGRLGQNGTAITFINNNSKRLFWDI 137


>BC040185-1|AAH40185.1|  666|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 51 protein.
          Length = 666

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 14/24 (58%), Positives = 15/24 (62%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARGIDVQ V  V+NYD P     Y
Sbjct: 566 ARGIDVQGVELVVNYDAPQYLRTY 589


>BC012461-1|AAH12461.2|  186|Homo sapiens DDX51 protein protein.
          Length = 186

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 14/24 (58%), Positives = 15/24 (62%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARGIDVQ V  V+NYD P     Y
Sbjct: 86  ARGIDVQGVELVVNYDAPQYLRTY 109


>AK097078-1|BAC04942.1|  666|Homo sapiens protein ( Homo sapiens
           cDNA FLJ39759 fis, clone SMINT2019153, weakly similar to
           ATP-DEPENDENT RNA HELICASE DBP73D. ).
          Length = 666

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 14/24 (58%), Positives = 15/24 (62%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARGIDVQ V  V+NYD P     Y
Sbjct: 566 ARGIDVQGVELVVNYDAPQYLRTY 589


>BX641072-1|CAE46035.1|  496|Homo sapiens hypothetical protein
           protein.
          Length = 496

 Score = 31.5 bits (68), Expect = 3.1
 Identities = 16/57 (28%), Positives = 25/57 (43%), Gaps = 1/57 (1%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEA-DRRALKDIE 429
           ++G+D   +  VINYD+P   ENY                  F+ +A D   L D++
Sbjct: 367 SKGLDFPAIQHVINYDMPEEIENYVHRIGRTGRSGNTGIATTFINKACDESVLMDLK 423


>BC030020-1|AAH30020.1|  600|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 55 protein.
          Length = 600

 Score = 31.5 bits (68), Expect = 3.1
 Identities = 12/22 (54%), Positives = 18/22 (81%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSN 321
           ++ARGID+ +V+ V+ YD PSN
Sbjct: 327 VMARGIDIPEVNWVLQYDPPSN 348


>BC015476-1|AAH15476.1|  622|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 41 protein.
          Length = 622

 Score = 31.5 bits (68), Expect = 3.1
 Identities = 16/57 (28%), Positives = 25/57 (43%), Gaps = 1/57 (1%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEA-DRRALKDIE 429
           ++G+D   +  VINYD+P   ENY                  F+ +A D   L D++
Sbjct: 493 SKGLDFPAIQHVINYDMPEEIENYVHRIGRTGRSGNTGIATTFINKACDESVLMDLK 549


>BC005848-1|AAH05848.2|  864|Homo sapiens DDX54 protein protein.
          Length = 864

 Score = 31.5 bits (68), Expect = 3.1
 Identities = 14/56 (25%), Positives = 29/56 (51%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           Q V+F  T+   ++LTE +  +  + + ++  +D   R++ + +F  G    LI T
Sbjct: 323 QTVVFVATKHHAEYLTELLTTQRVSCAHIYSALDPTARKINLAKFTLGKCSTLIVT 378


>AY148094-1|AAN59978.1|  865|Homo sapiens DEAD box RNA helicase DP97
           protein.
          Length = 865

 Score = 31.5 bits (68), Expect = 3.1
 Identities = 14/56 (25%), Positives = 29/56 (51%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           Q V+F  T+   ++LTE +  +  + + ++  +D   R++ + +F  G    LI T
Sbjct: 324 QTVVFVATKHHAEYLTELLTTQRVSCAHIYSALDPTARKINLAKFTLGKCSTLIVT 379


>AL445483-5|CAI17055.1|  580|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 59 protein.
          Length = 580

 Score = 31.5 bits (68), Expect = 3.1
 Identities = 11/26 (42%), Positives = 19/26 (73%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENY 333
           +L RG+D+  V  V+N+D+PS+ + Y
Sbjct: 504 VLGRGLDLISVRLVVNFDMPSSMDEY 529


>AL445483-3|CAI17051.1|  205|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 59 protein.
          Length = 205

 Score = 31.5 bits (68), Expect = 3.1
 Identities = 11/26 (42%), Positives = 19/26 (73%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENY 333
           +L RG+D+  V  V+N+D+PS+ + Y
Sbjct: 142 VLGRGLDLISVRLVVNFDMPSSMDEY 167


>AL445483-2|CAI17050.1|   93|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 59 protein.
          Length = 93

 Score = 31.5 bits (68), Expect = 3.1
 Identities = 11/26 (42%), Positives = 19/26 (73%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENY 333
           +L RG+D+  V  V+N+D+PS+ + Y
Sbjct: 40  VLGRGLDLISVRLVVNFDMPSSMDEY 65


>AL137455-1|CAB70746.1|  240|Homo sapiens hypothetical protein
           protein.
          Length = 240

 Score = 31.5 bits (68), Expect = 3.1
 Identities = 16/57 (28%), Positives = 25/57 (43%), Gaps = 1/57 (1%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEA-DRRALKDIE 429
           ++G+D   +  VINYD+P   ENY                  F+ +A D   L D++
Sbjct: 111 SKGLDFPAIQHVINYDMPEEIENYVHRIGRTGRSGNTGIATTFINKACDESVLMDLK 167


>AK222598-1|BAD96318.1|  622|Homo sapiens DEAD-box protein abstrakt
           variant protein.
          Length = 622

 Score = 31.5 bits (68), Expect = 3.1
 Identities = 16/57 (28%), Positives = 25/57 (43%), Gaps = 1/57 (1%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEA-DRRALKDIE 429
           ++G+D   +  VINYD+P   ENY                  F+ +A D   L D++
Sbjct: 493 SKGLDFPAIQHVINYDMPEEIENYVHRIGRTGRSGNTGNATTFINKACDESVLMDLK 549


>AK131442-1|BAD18588.1|  267|Homo sapiens protein ( Homo sapiens
           cDNA FLJ16577 fis, clone TESTI2026647, weakly  similar
           to PROBABLE ATP-DEPENDENT RNA HELICASE DDX10. ).
          Length = 267

 Score = 31.5 bits (68), Expect = 3.1
 Identities = 12/22 (54%), Positives = 18/22 (81%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSN 321
           ++ARGID+ +V+ V+ YD PSN
Sbjct: 180 VMARGIDIPEVNWVLQYDPPSN 201


>AK074219-1|BAB85021.1|  353|Homo sapiens protein ( Homo sapiens
           cDNA FLJ23639 fis, clone CAS11535. ).
          Length = 353

 Score = 31.5 bits (68), Expect = 3.1
 Identities = 12/22 (54%), Positives = 18/22 (81%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSN 321
           ++ARGID+ +V+ V+ YD PSN
Sbjct: 327 VMARGIDIPEVNWVLQYDPPSN 348


>AK027768-1|BAB55355.1|  622|Homo sapiens protein ( Homo sapiens
           cDNA FLJ14862 fis, clone PLACE1001739, weakly similar to
           PUTATIVE ATP-DEPENDENT RNA HELICASE PL10. ).
          Length = 622

 Score = 31.5 bits (68), Expect = 3.1
 Identities = 16/57 (28%), Positives = 25/57 (43%), Gaps = 1/57 (1%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEA-DRRALKDIE 429
           ++G+D   +  VINYD+P   ENY                  F+ +A D   L D++
Sbjct: 493 SKGLDFPAIQHVINYDMPEEIENYVHRIGRTGRSGNTGIATTFINKACDESVLMDLK 549


>AK001255-1|BAA91585.1|  622|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10393 fis, clone NT2RM4000191, weakly similar to
           PUTATIVE ATP-DEPENDENT RNA HELICASE PL10. ).
          Length = 622

 Score = 31.5 bits (68), Expect = 3.1
 Identities = 16/57 (28%), Positives = 25/57 (43%), Gaps = 1/57 (1%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEA-DRRALKDIE 429
           ++G+D   +  VINYD+P   ENY                  F+ +A D   L D++
Sbjct: 493 SKGLDFPAIQHVINYDMPEEIENYVHRIGRTGRSGNTGIATTFINKACDESVLMDLK 549


>AF478457-1|AAL85336.1|  882|Homo sapiens ATP-dependent RNA helicase
           protein.
          Length = 882

 Score = 31.5 bits (68), Expect = 3.1
 Identities = 14/56 (25%), Positives = 29/56 (51%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           Q V+F  T+   ++LTE +  +  + + ++  +D   R++ + +F  G    LI T
Sbjct: 340 QTVVFVATKHHAEYLTELLTTQRVSCAHIYSALDPTARKINLAKFTLGKCSTLIVT 395


>AF195417-1|AAF04150.1|  621|Homo sapiens DEAD-box protein abstrakt
           protein.
          Length = 621

 Score = 31.5 bits (68), Expect = 3.1
 Identities = 16/57 (28%), Positives = 25/57 (43%), Gaps = 1/57 (1%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEA-DRRALKDIE 429
           ++G+D   +  VINYD+P   ENY                  F+ +A D   L D++
Sbjct: 492 SKGLDFPAIQHVINYDMPEEIENYVHRIGRTGRSGNTGIATTFINKACDESVLMDLK 548


>AB046815-1|BAB13421.1|  471|Homo sapiens KIAA1595 protein protein.
          Length = 471

 Score = 31.5 bits (68), Expect = 3.1
 Identities = 12/22 (54%), Positives = 18/22 (81%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSN 321
           ++ARGID+ +V+ V+ YD PSN
Sbjct: 198 VMARGIDIPEVNWVLQYDPPSN 219


>X70649-1|CAA49992.1|  740|Homo sapiens member of DEAD box protein
           family protein.
          Length = 740

 Score = 31.1 bits (67), Expect = 4.1
 Identities = 13/24 (54%), Positives = 16/24 (66%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARGID+  V  VIN  LP  ++NY
Sbjct: 576 ARGIDIHGVPYVINVTLPDEKQNY 599


>EF418571-1|ABN70941.1|  740|Homo sapiens DEAD box polypeptide 1
           protein.
          Length = 740

 Score = 31.1 bits (67), Expect = 4.1
 Identities = 13/24 (54%), Positives = 16/24 (66%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARGID+  V  VIN  LP  ++NY
Sbjct: 576 ARGIDIHGVPYVINVTLPDEKQNY 599


>EF418570-1|ABN70940.1|  740|Homo sapiens DEAD box polypeptide 1
           protein.
          Length = 740

 Score = 31.1 bits (67), Expect = 4.1
 Identities = 13/24 (54%), Positives = 16/24 (66%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARGID+  V  VIN  LP  ++NY
Sbjct: 576 ARGIDIHGVPYVINVTLPDEKQNY 599


>BC053673-1|AAH53673.1|  740|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 1 protein.
          Length = 740

 Score = 31.1 bits (67), Expect = 4.1
 Identities = 13/24 (54%), Positives = 16/24 (66%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARGID+  V  VIN  LP  ++NY
Sbjct: 576 ARGIDIHGVPYVINVTLPDEKQNY 599


>BC012132-1|AAH12132.1|  740|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 1 protein.
          Length = 740

 Score = 31.1 bits (67), Expect = 4.1
 Identities = 13/24 (54%), Positives = 16/24 (66%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARGID+  V  VIN  LP  ++NY
Sbjct: 576 ARGIDIHGVPYVINVTLPDEKQNY 599


>BC101491-1|AAI01492.1|  327|Homo sapiens olfactory receptor, family
           6, subfamily A, member 1 protein.
          Length = 327

 Score = 29.9 bits (64), Expect = 9.5
 Identities = 16/38 (42%), Positives = 20/38 (52%)
 Frame = +2

Query: 224 TGSSRVLITTVYWHVVLMYSKFPASSTMICHPTVKIIF 337
           TG+S V IT    H+     ++ A ST   H TV IIF
Sbjct: 219 TGASYVAITGAVMHIPSAAGRYKAFSTCASHLTVVIIF 256


>BC101489-1|AAI01490.1|  327|Homo sapiens olfactory receptor, family
           6, subfamily A, member 2 protein.
          Length = 327

 Score = 29.9 bits (64), Expect = 9.5
 Identities = 16/38 (42%), Positives = 20/38 (52%)
 Frame = +2

Query: 224 TGSSRVLITTVYWHVVLMYSKFPASSTMICHPTVKIIF 337
           TG+S V IT    H+     ++ A ST   H TV IIF
Sbjct: 219 TGASYVAITGAVMHIPSAAGRYKAFSTCASHLTVVIIF 256


>AF321237-5|AAG45208.1|  327|Homo sapiens hI7 olfactory receptor
           protein.
          Length = 327

 Score = 29.9 bits (64), Expect = 9.5
 Identities = 16/38 (42%), Positives = 20/38 (52%)
 Frame = +2

Query: 224 TGSSRVLITTVYWHVVLMYSKFPASSTMICHPTVKIIF 337
           TG+S V IT    H+     ++ A ST   H TV IIF
Sbjct: 219 TGASYVAITGAVMHIPSAAGRYKAFSTCASHLTVVIIF 256


>AB065822-1|BAC06041.1|  327|Homo sapiens seven transmembrane helix
           receptor protein.
          Length = 327

 Score = 29.9 bits (64), Expect = 9.5
 Identities = 16/38 (42%), Positives = 20/38 (52%)
 Frame = +2

Query: 224 TGSSRVLITTVYWHVVLMYSKFPASSTMICHPTVKIIF 337
           TG+S V IT    H+     ++ A ST   H TV IIF
Sbjct: 219 TGASYVAITGAVMHIPSAAGRYKAFSTCASHLTVVIIF 256


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 98,766,584
Number of Sequences: 237096
Number of extensions: 1976177
Number of successful extensions: 3461
Number of sequences better than 10.0: 209
Number of HSP's better than 10.0 without gapping: 3190
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3435
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8343197486
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -