SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20027
         (779 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X15306-1|CAA33366.1| 1020|Homo sapiens heavy neurofilament subun...    33   0.87 
BC073969-1|AAH73969.1| 1026|Homo sapiens NEFH protein protein.         33   0.87 
BC040137-1|AAH40137.1| 1268|Homo sapiens SEC24 related gene fami...    33   0.87 
AJ131245-1|CAA10335.1| 1268|Homo sapiens Sec24B protein protein.       33   0.87 
AF203032-1|AAF13722.1| 1026|Homo sapiens neurofilament protein p...    33   0.87 
AB020652-1|BAA74868.2| 1034|Homo sapiens KIAA0845 protein protein.     33   0.87 
BC039878-1|AAH39878.1|  825|Homo sapiens chromosome 14 open read...    33   1.2  
BC009449-1|AAH09449.1|  569|Homo sapiens MGC2641 protein protein.      32   2.7  
BC000755-1|AAH00755.1|  670|Homo sapiens hepatoma-derived growth...    32   2.7  
AY358600-1|AAQ88963.1|  671|Homo sapiens HGDF-related pro 2 prot...    32   2.7  
AF294267-1|AAP97281.1|  671|Homo sapiens hepatoma-derived growth...    32   2.7  
AB208892-1|BAD92129.1|  472|Homo sapiens hepatoma-derived growth...    32   2.7  
BC000713-1|AAH00713.1|  646|Homo sapiens A kinase (PRKA) anchor ...    31   4.7  
AJ243467-1|CAB65092.1|  646|Homo sapiens LA95 protein protein.         31   4.7  
AB025905-1|BAA85003.1|  646|Homo sapiens neighbor of A-kinase an...    31   4.7  
AB015332-1|BAA34791.1|  373|Homo sapiens HRIHFB2018 protein.           31   4.7  

>X15306-1|CAA33366.1| 1020|Homo sapiens heavy neurofilament subunit
           protein.
          Length = 1020

 Score = 33.5 bits (73), Expect = 0.87
 Identities = 25/85 (29%), Positives = 41/85 (48%), Gaps = 1/85 (1%)
 Frame = +2

Query: 518 SKEEKPSATDAEGSADSAAIIPNMVKKIDLAPTVESDAAAIPEIKTPEAADAPKLADNPV 697
           +KEE  S  +A+      A  P  VK  + A +   +     E K+P  A +P+ A +PV
Sbjct: 554 AKEEAKSPPEAKSPEKEEAKSPAEVKSPEKAKSPAKE-----EAKSPAEAKSPEKAKSPV 608

Query: 698 DEDKPADISPDAP-KAEAKSADDLR 769
            E+  +     +P K EAKS  +++
Sbjct: 609 KEEAKSPAEAKSPVKEEAKSPAEVK 633


>BC073969-1|AAH73969.1| 1026|Homo sapiens NEFH protein protein.
          Length = 1026

 Score = 33.5 bits (73), Expect = 0.87
 Identities = 25/85 (29%), Positives = 41/85 (48%), Gaps = 1/85 (1%)
 Frame = +2

Query: 518 SKEEKPSATDAEGSADSAAIIPNMVKKIDLAPTVESDAAAIPEIKTPEAADAPKLADNPV 697
           +KEE  S  +A+      A  P  VK  + A +   +     E K+P  A +P+ A +PV
Sbjct: 554 AKEEAKSPPEAKSPEKEEAKSPAEVKSPEKAKSPAKE-----EAKSPAEAKSPEKAKSPV 608

Query: 698 DEDKPADISPDAP-KAEAKSADDLR 769
            E+  +     +P K EAKS  +++
Sbjct: 609 KEEAKSPAEAKSPVKEEAKSPAEVK 633


>BC040137-1|AAH40137.1| 1268|Homo sapiens SEC24 related gene family,
           member B (S. cerevisiae) protein.
          Length = 1268

 Score = 33.5 bits (73), Expect = 0.87
 Identities = 23/84 (27%), Positives = 38/84 (45%), Gaps = 2/84 (2%)
 Frame = +2

Query: 494 STSYRAEISKEEKPSATDAEGSADSAAIIPNMVKKID--LAPTVESDAAAIPEIKTPEAA 667
           STS   E  +E++ +  D+  +  SA+ +PN    ++    P + S +A+ P    P+ A
Sbjct: 374 STSDDEEEEEEDEEAGVDSSSTTSSASPMPNSYDALEGGSYPDMLSSSASSP---APDPA 430

Query: 668 DAPKLADNPVDEDKPADISPDAPK 739
             P  A  P     PA + P   K
Sbjct: 431 PEPDPASAPAPASAPAPVVPQPSK 454


>AJ131245-1|CAA10335.1| 1268|Homo sapiens Sec24B protein protein.
          Length = 1268

 Score = 33.5 bits (73), Expect = 0.87
 Identities = 23/84 (27%), Positives = 38/84 (45%), Gaps = 2/84 (2%)
 Frame = +2

Query: 494 STSYRAEISKEEKPSATDAEGSADSAAIIPNMVKKID--LAPTVESDAAAIPEIKTPEAA 667
           STS   E  +E++ +  D+  +  SA+ +PN    ++    P + S +A+ P    P+ A
Sbjct: 374 STSDDEEEEEEDEEAGVDSSSTTSSASPMPNSYDALEGGSYPDMLSSSASSP---APDPA 430

Query: 668 DAPKLADNPVDEDKPADISPDAPK 739
             P  A  P     PA + P   K
Sbjct: 431 PEPDPASAPAPASAPAPVVPQPSK 454


>AF203032-1|AAF13722.1| 1026|Homo sapiens neurofilament protein
           protein.
          Length = 1026

 Score = 33.5 bits (73), Expect = 0.87
 Identities = 25/85 (29%), Positives = 41/85 (48%), Gaps = 1/85 (1%)
 Frame = +2

Query: 518 SKEEKPSATDAEGSADSAAIIPNMVKKIDLAPTVESDAAAIPEIKTPEAADAPKLADNPV 697
           +KEE  S  +A+      A  P  VK  + A +   +     E K+P  A +P+ A +PV
Sbjct: 554 AKEEAKSPPEAKSPEKEEAKSPAEVKSPEKAKSPAKE-----EAKSPAEAKSPEKAKSPV 608

Query: 698 DEDKPADISPDAP-KAEAKSADDLR 769
            E+  +     +P K EAKS  +++
Sbjct: 609 KEEAKSPAEAKSPVKEEAKSPAEVK 633


>AB020652-1|BAA74868.2| 1034|Homo sapiens KIAA0845 protein protein.
          Length = 1034

 Score = 33.5 bits (73), Expect = 0.87
 Identities = 25/85 (29%), Positives = 41/85 (48%), Gaps = 1/85 (1%)
 Frame = +2

Query: 518 SKEEKPSATDAEGSADSAAIIPNMVKKIDLAPTVESDAAAIPEIKTPEAADAPKLADNPV 697
           +KEE  S  +A+      A  P  VK  + A +   +     E K+P  A +P+ A +PV
Sbjct: 562 AKEEAKSPPEAKSPEKEEAKSPAEVKSPEKAKSPAKE-----EAKSPAEAKSPEKAKSPV 616

Query: 698 DEDKPADISPDAP-KAEAKSADDLR 769
            E+  +     +P K EAKS  +++
Sbjct: 617 KEEAKSPAEAKSPVKEEAKSPAEVK 641


>BC039878-1|AAH39878.1|  825|Homo sapiens chromosome 14 open reading
           frame 155 protein.
          Length = 825

 Score = 33.1 bits (72), Expect = 1.2
 Identities = 24/82 (29%), Positives = 37/82 (45%)
 Frame = +2

Query: 515 ISKEEKPSATDAEGSADSAAIIPNMVKKIDLAPTVESDAAAIPEIKTPEAADAPKLADNP 694
           +S EE P         ++ A   +   ++ LA T  S   A  E++ P A +AP     P
Sbjct: 567 VSIEEAPLELQPPSGEETTAEEASAAIQL-LAATEASAEEAPAEVQPPPAEEAPAEVQPP 625

Query: 695 VDEDKPADISPDAPKAEAKSAD 760
             E+ PA++ P  P AE   A+
Sbjct: 626 PAEEAPAEVQP--PPAEETPAE 645



 Score = 30.7 bits (66), Expect = 6.1
 Identities = 23/84 (27%), Positives = 36/84 (42%), Gaps = 1/84 (1%)
 Frame = +2

Query: 512 EISKEEKPSATDAEGSADSAAIIPNMVKKIDLAPTVESDAAAIP-EIKTPEAADAPKLAD 688
           E S EE P+      + ++ A +     +   A      A   P E++ P A +AP    
Sbjct: 600 EASAEEAPAEVQPPPAEEAPAEVQPPPAEEAPAEVQPPPAEETPAEVQPPPAEEAPAEVQ 659

Query: 689 NPVDEDKPADISPDAPKAEAKSAD 760
            P  E+ PA++ P  P AE   A+
Sbjct: 660 PPPAEEAPAEVQP--PPAEEAPAE 681


>BC009449-1|AAH09449.1|  569|Homo sapiens MGC2641 protein protein.
          Length = 569

 Score = 31.9 bits (69), Expect = 2.7
 Identities = 19/82 (23%), Positives = 38/82 (46%), Gaps = 1/82 (1%)
 Frame = +2

Query: 521 KEEKPSATDAEGSADSAAIIPNMVKKIDLAPTVESDAAAI-PEIKTPEAADAPKLADNPV 697
           K++ PSA+D++  ADS    P  V     A +  S +++   ++   +     K A+ P+
Sbjct: 123 KKKAPSASDSDSKADSDGAKPEPVAMARSASSSSSSSSSSDSDVSVKKPPRGRKPAEKPL 182

Query: 698 DEDKPADISPDAPKAEAKSADD 763
            + +     P+ P + + S  D
Sbjct: 183 PKPRGRKPKPERPPSSSSSDSD 204


>BC000755-1|AAH00755.1|  670|Homo sapiens hepatoma-derived growth
           factor-related protein 2 protein.
          Length = 670

 Score = 31.9 bits (69), Expect = 2.7
 Identities = 19/82 (23%), Positives = 38/82 (46%), Gaps = 1/82 (1%)
 Frame = +2

Query: 521 KEEKPSATDAEGSADSAAIIPNMVKKIDLAPTVESDAAAI-PEIKTPEAADAPKLADNPV 697
           K++ PSA+D++  ADS    P  V     A +  S +++   ++   +     K A+ P+
Sbjct: 225 KKKAPSASDSDSKADSDGAKPEPVAMARSASSSSSSSSSSDSDVSVKKPPRGRKPAEKPL 284

Query: 698 DEDKPADISPDAPKAEAKSADD 763
            + +     P+ P + + S  D
Sbjct: 285 PKPRGRKPKPERPPSSSSSDSD 306


>AY358600-1|AAQ88963.1|  671|Homo sapiens HGDF-related pro 2
           protein.
          Length = 671

 Score = 31.9 bits (69), Expect = 2.7
 Identities = 19/82 (23%), Positives = 38/82 (46%), Gaps = 1/82 (1%)
 Frame = +2

Query: 521 KEEKPSATDAEGSADSAAIIPNMVKKIDLAPTVESDAAAI-PEIKTPEAADAPKLADNPV 697
           K++ PSA+D++  ADS    P  V     A +  S +++   ++   +     K A+ P+
Sbjct: 225 KKKAPSASDSDSKADSDGAKPEPVAMARSASSSSSSSSSSDSDVSVKKPPRGRKPAEKPL 284

Query: 698 DEDKPADISPDAPKAEAKSADD 763
            + +     P+ P + + S  D
Sbjct: 285 PKPRGRKPKPERPPSSSSSDSD 306


>AF294267-1|AAP97281.1|  671|Homo sapiens hepatoma-derived growth
           factor 2 protein.
          Length = 671

 Score = 31.9 bits (69), Expect = 2.7
 Identities = 19/82 (23%), Positives = 38/82 (46%), Gaps = 1/82 (1%)
 Frame = +2

Query: 521 KEEKPSATDAEGSADSAAIIPNMVKKIDLAPTVESDAAAI-PEIKTPEAADAPKLADNPV 697
           K++ PSA+D++  ADS    P  V     A +  S +++   ++   +     K A+ P+
Sbjct: 225 KKKAPSASDSDSKADSDGAKPEPVAMARSASSSSSSSSSSDSDVSVKKPPRGRKPAEKPL 284

Query: 698 DEDKPADISPDAPKAEAKSADD 763
            + +     P+ P + + S  D
Sbjct: 285 PKPRGRKPKPERPPSSSSSDSD 306


>AB208892-1|BAD92129.1|  472|Homo sapiens hepatoma-derived growth
           factor-related protein 2 isoform 1 variant protein.
          Length = 472

 Score = 31.9 bits (69), Expect = 2.7
 Identities = 19/82 (23%), Positives = 38/82 (46%), Gaps = 1/82 (1%)
 Frame = +2

Query: 521 KEEKPSATDAEGSADSAAIIPNMVKKIDLAPTVESDAAAI-PEIKTPEAADAPKLADNPV 697
           K++ PSA+D++  ADS    P  V     A +  S +++   ++   +     K A+ P+
Sbjct: 176 KKKAPSASDSDSKADSDGAKPEPVAMARSASSSSSSSSSSDSDVSVKKPPRGRKPAEKPL 235

Query: 698 DEDKPADISPDAPKAEAKSADD 763
            + +     P+ P + + S  D
Sbjct: 236 PKPRGRKPKPERPPSSSSSDSD 257


>BC000713-1|AAH00713.1|  646|Homo sapiens A kinase (PRKA) anchor
           protein 8-like protein.
          Length = 646

 Score = 31.1 bits (67), Expect = 4.7
 Identities = 12/45 (26%), Positives = 28/45 (62%)
 Frame = +2

Query: 494 STSYRAEISKEEKPSATDAEGSADSAAIIPNMVKKIDLAPTVESD 628
           +TS+  E+   +  + T A GSA + +++  + +++D+ P +E+D
Sbjct: 64  ATSHSWEMPSSDTNANTSASGSASADSVLSRINQRLDMVPHLETD 108


>AJ243467-1|CAB65092.1|  646|Homo sapiens LA95 protein protein.
          Length = 646

 Score = 31.1 bits (67), Expect = 4.7
 Identities = 12/45 (26%), Positives = 28/45 (62%)
 Frame = +2

Query: 494 STSYRAEISKEEKPSATDAEGSADSAAIIPNMVKKIDLAPTVESD 628
           +TS+  E+   +  + T A GSA + +++  + +++D+ P +E+D
Sbjct: 64  ATSHSWEMPSSDTNANTSASGSASADSVLSRINQRLDMVPHLETD 108


>AB025905-1|BAA85003.1|  646|Homo sapiens neighbor of A-kinase
           anchoring protein 95 protein.
          Length = 646

 Score = 31.1 bits (67), Expect = 4.7
 Identities = 12/45 (26%), Positives = 28/45 (62%)
 Frame = +2

Query: 494 STSYRAEISKEEKPSATDAEGSADSAAIIPNMVKKIDLAPTVESD 628
           +TS+  E+   +  + T A GSA + +++  + +++D+ P +E+D
Sbjct: 64  ATSHSWEMPSSDTNANTSASGSASADSVLSRINQRLDMVPHLETD 108


>AB015332-1|BAA34791.1|  373|Homo sapiens HRIHFB2018 protein.
          Length = 373

 Score = 31.1 bits (67), Expect = 4.7
 Identities = 12/45 (26%), Positives = 28/45 (62%)
 Frame = +2

Query: 494 STSYRAEISKEEKPSATDAEGSADSAAIIPNMVKKIDLAPTVESD 628
           +TS+  E+   +  + T A GSA + +++  + +++D+ P +E+D
Sbjct: 79  ATSHSWEMPSSDTNANTSASGSASADSVLSRINQRLDMVPHLETD 123


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 89,321,234
Number of Sequences: 237096
Number of extensions: 1646785
Number of successful extensions: 5463
Number of sequences better than 10.0: 16
Number of HSP's better than 10.0 without gapping: 4991
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5456
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 9478778060
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -