SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20026
         (735 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X16869-1|CAA34756.1|  462|Homo sapiens protein ( Human mRNA for ...   225   2e-58
X03558-1|CAA27245.1|  462|Homo sapiens protein ( Human mRNA for ...   225   2e-58
J04617-1|AAA52343.1|  462|Homo sapiens EEF1A protein.                 225   2e-58
EF362804-1|ABO30531.1|  462|Homo sapiens EF1a protein.                225   2e-58
BC111051-1|AAI11052.1|  462|Homo sapiens eukaryotic translation ...   225   2e-58
BC082268-1|AAH82268.1|  462|Homo sapiens eukaryotic translation ...   225   2e-58
BC072385-1|AAH72385.1|  462|Homo sapiens eukaryotic translation ...   225   2e-58
BC071841-1|AAH71841.1|  462|Homo sapiens eukaryotic translation ...   225   2e-58
BC071741-1|AAH71741.1|  462|Homo sapiens eukaryotic translation ...   225   2e-58
BC071619-1|AAH71619.1|  441|Homo sapiens EEF1A1 protein protein.      225   2e-58
BC066893-1|AAH66893.1|  462|Homo sapiens eukaryotic translation ...   225   2e-58
BC057391-1|AAH57391.1|  462|Homo sapiens eukaryotic translation ...   225   2e-58
BC038339-1|AAH38339.1|  462|Homo sapiens eukaryotic translation ...   225   2e-58
BC028674-1|AAH28674.1|  462|Homo sapiens eukaryotic translation ...   225   2e-58
BC021686-1|AAH21686.1|  462|Homo sapiens eukaryotic translation ...   225   2e-58
BC019669-1|AAH19669.1|  462|Homo sapiens EEF1A1 protein protein.      225   2e-58
BC018641-1|AAH18641.1|  462|Homo sapiens eukaryotic translation ...   225   2e-58
BC018150-1|AAH18150.1|  462|Homo sapiens eukaryotic translation ...   225   2e-58
BC014224-1|AAH14224.1|  462|Homo sapiens eukaryotic translation ...   225   2e-58
BC012891-1|AAH12891.1|  462|Homo sapiens eukaryotic translation ...   225   2e-58
BC010735-1|AAH10735.1|  462|Homo sapiens eukaryotic translation ...   225   2e-58
BC009875-1|AAH09875.1|  462|Homo sapiens eukaryotic translation ...   225   2e-58
BC009733-1|AAH09733.1|  462|Homo sapiens eukaryotic translation ...   225   2e-58
BC008587-1|AAH08587.1|  462|Homo sapiens eukaryotic translation ...   225   2e-58
AY043301-1|AAK95378.1|  462|Homo sapiens elongation factor 1-alp...   225   2e-58
AL603910-9|CAI40951.1|  145|Homo sapiens eukaryotic translation ...   225   2e-58
AL603910-8|CAI14883.1|  462|Homo sapiens eukaryotic translation ...   225   2e-58
AL593851-4|CAH73620.1|  462|Homo sapiens eukaryotic translation ...   225   2e-58
AK223046-1|BAD96766.1|  462|Homo sapiens eukaryotic translation ...   225   2e-58
AK223030-1|BAD96750.1|  462|Homo sapiens eukaryotic translation ...   225   2e-58
AK222982-1|BAD96702.1|  462|Homo sapiens eukaryotic translation ...   225   2e-58
AK222551-1|BAD96271.1|  462|Homo sapiens eukaryotic translation ...   225   2e-58
AK222523-1|BAD96243.1|  462|Homo sapiens eukaryotic translation ...   225   2e-58
AK222515-1|BAD96235.1|  462|Homo sapiens eukaryotic translation ...   225   2e-58
AF267861-1|AAG44730.1|  427|Homo sapiens EF1a-like protein protein.   225   2e-58
X70940-1|CAA50280.1|  463|Homo sapiens elongation factor 1 alpha...   223   5e-58
BC110409-1|AAI10410.1|  463|Homo sapiens eukaryotic translation ...   223   5e-58
BC000432-1|AAH00432.1|  463|Homo sapiens eukaryotic translation ...   223   5e-58
AL121829-9|CAC15522.1|  463|Homo sapiens EEF1A2 protein.              223   5e-58
AF163763-1|AAF80488.1|  463|Homo sapiens elongation factor 1 A-2...   223   5e-58
BC071727-1|AAH71727.1|  462|Homo sapiens eukaryotic translation ...   220   4e-57
AL603910-10|CAO03613.1|  107|Homo sapiens eukaryotic translation...   174   2e-43
L10340-1|AAA91835.1|  435|Homo sapiens elongation factor-1 alpha...   165   2e-40
AK223042-1|BAD96762.1|  433|Homo sapiens eukaryotic translation ...   161   2e-39
X03689-1|CAA27325.1|   94|Homo sapiens protein ( Human mRNA frag...   145   1e-34
AF174496-1|AAF36537.1|  426|Homo sapiens glucocorticoid receptor...   144   2e-34
L41498-1|AAC09386.1|  398|Homo sapiens longation factor 1-alpha ...   139   8e-33
L41490-1|AAC09385.1|  398|Homo sapiens eukaryotic translation el...   139   8e-33
AY062434-1|AAL38981.1|  398|Homo sapiens elongation factor 1-alp...   139   8e-33
AK222519-1|BAD96239.1|  366|Homo sapiens eukaryotic translation ...   139   8e-33
AF397403-1|AAK93966.1|  398|Homo sapiens translation elongation ...   139   8e-33
AF328730-1|AAN09722.1|  361|Homo sapiens CTCL tumor antigen HD-C...   139   8e-33
AF322220-1|AAN51932.1|  361|Homo sapiens cervical cancer suppres...   139   8e-33
AB209064-1|BAD92301.1|  340|Homo sapiens eukaryotic translation ...   139   1e-32
U87791-1|AAD00645.1|  684|Homo sapiens eRFS protein.                  130   4e-30
M29548-1|AAA52367.1|  327|Homo sapiens EEF1A protein.                 130   4e-30
BC040849-1|AAH40849.1|  684|Homo sapiens HBS1-like (S. cerevisia...   130   4e-30
BC001465-1|AAH01465.1|  684|Homo sapiens HBS1-like (S. cerevisia...   130   4e-30
AL445190-5|CAI95161.1|  684|Homo sapiens HBS1-like (S. cerevisia...   130   4e-30
AL353596-2|CAI17912.1|  684|Homo sapiens HBS1-like (S. cerevisia...   130   4e-30
AJ459826-1|CAD30873.1|  684|Homo sapiens HBS1-like protein protein.   130   4e-30
AB028961-1|BAA82990.1|  496|Homo sapiens KIAA1038 protein protein.    130   4e-30
X17644-1|CAA35635.1|  499|Homo sapiens protein ( Human GST1-Hs m...   130   5e-30
U95742-2|AAB67250.1|  499|Homo sapiens G1 to S phase transition ...   130   5e-30
BT006722-1|AAP35368.1|  498|Homo sapiens G1 to S phase transitio...   130   5e-30
BC009503-1|AAH09503.2|  633|Homo sapiens GSPT1 protein protein.       130   5e-30
BC036077-1|AAH36077.1|  628|Homo sapiens G1 to S phase transitio...   128   3e-29
AL929101-2|CAH71524.1|  628|Homo sapiens G1 to S phase transitio...   128   3e-29
AK023155-1|BAB14435.1|  504|Homo sapiens protein ( Homo sapiens ...   128   3e-29
AJ251548-1|CAB91089.1|  628|Homo sapiens polypeptide chain relea...   128   3e-29
AK001303-1|BAA91612.1|  628|Homo sapiens protein ( Homo sapiens ...   127   4e-29
BC070131-1|AAH70131.1|  111|Homo sapiens EEF1A1 protein protein.      125   1e-28
BC070500-1|AAH70500.1|   67|Homo sapiens EEF1A1 protein protein.      106   7e-23
BC094687-1|AAH94687.1|  308|Homo sapiens EEF1A1 protein protein.       99   8e-21
BC063511-1|AAH63511.1|  290|Homo sapiens EEF1A1 protein protein.       69   1e-11
X84694-1|CAA59169.1|  452|Homo sapiens mitochondrial elongation ...    66   9e-11
S75463-1|AAC60647.1|  452|Homo sapiens P43 protein.                    66   9e-11
L38995-1|AAB00499.1|  452|Homo sapiens elongation factor Tu prot...    66   9e-11
BC010041-1|AAH10041.2|  455|Homo sapiens Tu translation elongati...    66   9e-11
BC001633-1|AAH01633.2|  455|Homo sapiens Tu translation elongati...    66   9e-11
BC014377-1|AAH14377.1|  287|Homo sapiens Unknown (protein for IM...    64   7e-10
AL445190-4|CAI95162.1|  453|Homo sapiens HBS1-like (S. cerevisia...    59   1e-08
AL353596-1|CAI17913.1|  453|Homo sapiens HBS1-like (S. cerevisia...    59   1e-08
BC030612-1|AAH30612.1|  777|Homo sapiens G elongation factor, mi...    45   3e-04
BC015712-1|AAH15712.1|  779|Homo sapiens GFM2 protein protein.         45   3e-04
AY453587-1|AAS49035.1|  531|Homo sapiens elongation factor G iso...    45   3e-04
AK025314-1|BAB15109.1|  513|Homo sapiens protein ( Homo sapiens ...    45   3e-04
AF367997-1|AAK53401.1|  779|Homo sapiens elongation factor G2 pr...    45   3e-04
AF111808-1|AAL39010.1|  732|Homo sapiens MSTP027 protein.              45   3e-04
BC049210-1|AAH49210.1|  751|Homo sapiens G elongation factor, mi...    42   0.002
AF367998-1|AAK53402.1|  751|Homo sapiens elongation factor G1 pr...    42   0.002
AF309777-1|AAK58877.1|  751|Homo sapiens elongation factor G pro...    42   0.002
AK023282-1|BAB14507.1|  669|Homo sapiens protein ( Homo sapiens ...    41   0.004
Z11692-1|CAA77750.1|  858|Homo sapiens human  elongation factor ...    40   0.009
X51466-1|CAA35829.1|  858|Homo sapiens elongation factor 2 protein.    40   0.009
BC126259-1|AAI26260.1|  858|Homo sapiens EEF2 protein protein.         40   0.009
BC006547-1|AAH06547.1|  583|Homo sapiens EEF2 protein protein.         40   0.009
AY942181-1|AAX34409.1|  858|Homo sapiens elongation factor 2 pro...    40   0.009
BC036768-1|AAH36768.1|  669|Homo sapiens GUF1 GTPase homolog (S....    39   0.016
L34600-1|AAA67038.1|  727|Homo sapiens initiation factor 2 protein.    31   3.2  
BC064977-1|AAH64977.1|  465|Homo sapiens MTIF2 protein protein.        31   3.2  
BC039848-1|AAH39848.1|  500|Homo sapiens Similar to mitochondria...    31   3.2  
AF495546-1|AAM70196.1|  727|Homo sapiens translation initiation ...    31   3.2  
AF494407-1|AAM14617.1|  727|Homo sapiens mitochondrial translati...    31   3.2  
L19161-1|AAA19696.1|  472|Homo sapiens translation initiation fa...    31   4.3  
DQ120619-1|ABB92405.1|  471|Homo sapiens eFI-2-gamma protein.          31   4.3  
BC087847-1|AAH87847.1|  465|Homo sapiens Unknown (protein for IM...    31   4.3  
BC019906-1|AAH19906.1|  472|Homo sapiens eukaryotic translation ...    31   4.3  
BC007933-1|AAH07933.1|  569|Homo sapiens EEFSEC protein protein.       31   4.3  
AK222577-1|BAD96297.1|  472|Homo sapiens eukaryotic translation ...    31   4.3  
AJ006932-1|CAA07331.1|  248|Homo sapiens eIF-2gA protein.              31   4.3  
AF268872-1|AAG13375.1|  526|Homo sapiens MJ0495-like protein Sel...    31   4.3  
AY280362-1|AAP35084.1| 2386|Homo sapiens EGF domain-containing p...    30   7.5  
AB065617-1|BAC05844.1|  528|Homo sapiens seven transmembrane hel...    30   7.5  
AB011541-1|BAA32469.2| 2785|Homo sapiens MEGF8 protein.                30   7.5  

>X16869-1|CAA34756.1|  462|Homo sapiens protein ( Human mRNA for
           elongation factor 1-alpha (clone CEF4). ).
          Length = 462

 Score =  225 bits (549), Expect = 2e-58
 Identities = 110/133 (82%), Positives = 112/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 
Sbjct: 61  DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  139 bits (337), Expect = 8e-33
 Identities = 64/75 (85%), Positives = 69/75 (92%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPI
Sbjct: 134 REHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGW+GDNMLEPS  M
Sbjct: 194 SGWNGDNMLEPSANM 208


>X03558-1|CAA27245.1|  462|Homo sapiens protein ( Human mRNA for
           elongation factor 1 alpha subunit (EF-1 alpha). ).
          Length = 462

 Score =  225 bits (549), Expect = 2e-58
 Identities = 110/133 (82%), Positives = 112/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 
Sbjct: 61  DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  139 bits (337), Expect = 8e-33
 Identities = 64/75 (85%), Positives = 69/75 (92%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPI
Sbjct: 134 REHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGW+GDNMLEPS  M
Sbjct: 194 SGWNGDNMLEPSANM 208


>J04617-1|AAA52343.1|  462|Homo sapiens EEF1A protein.
          Length = 462

 Score =  225 bits (549), Expect = 2e-58
 Identities = 110/133 (82%), Positives = 112/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 
Sbjct: 61  DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  139 bits (337), Expect = 8e-33
 Identities = 64/75 (85%), Positives = 69/75 (92%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPI
Sbjct: 134 REHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGW+GDNMLEPS  M
Sbjct: 194 SGWNGDNMLEPSANM 208


>EF362804-1|ABO30531.1|  462|Homo sapiens EF1a protein.
          Length = 462

 Score =  225 bits (549), Expect = 2e-58
 Identities = 110/133 (82%), Positives = 112/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 
Sbjct: 61  DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  139 bits (337), Expect = 8e-33
 Identities = 64/75 (85%), Positives = 69/75 (92%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPI
Sbjct: 134 REHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGW+GDNMLEPS  M
Sbjct: 194 SGWNGDNMLEPSANM 208


>BC111051-1|AAI11052.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  225 bits (549), Expect = 2e-58
 Identities = 110/133 (82%), Positives = 112/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 
Sbjct: 61  DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  139 bits (337), Expect = 8e-33
 Identities = 64/75 (85%), Positives = 69/75 (92%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPI
Sbjct: 134 REHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGW+GDNMLEPS  M
Sbjct: 194 SGWNGDNMLEPSANM 208


>BC082268-1|AAH82268.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  225 bits (549), Expect = 2e-58
 Identities = 110/133 (82%), Positives = 112/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 
Sbjct: 61  DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  139 bits (337), Expect = 8e-33
 Identities = 64/75 (85%), Positives = 69/75 (92%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPI
Sbjct: 134 REHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGW+GDNMLEPS  M
Sbjct: 194 SGWNGDNMLEPSANM 208


>BC072385-1|AAH72385.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  225 bits (549), Expect = 2e-58
 Identities = 110/133 (82%), Positives = 112/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 
Sbjct: 61  DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  139 bits (337), Expect = 8e-33
 Identities = 64/75 (85%), Positives = 69/75 (92%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPI
Sbjct: 134 REHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGW+GDNMLEPS  M
Sbjct: 194 SGWNGDNMLEPSANM 208


>BC071841-1|AAH71841.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  225 bits (549), Expect = 2e-58
 Identities = 110/133 (82%), Positives = 112/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 
Sbjct: 61  DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  139 bits (337), Expect = 8e-33
 Identities = 64/75 (85%), Positives = 69/75 (92%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPI
Sbjct: 134 REHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGW+GDNMLEPS  M
Sbjct: 194 SGWNGDNMLEPSANM 208


>BC071741-1|AAH71741.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  225 bits (549), Expect = 2e-58
 Identities = 110/133 (82%), Positives = 112/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 
Sbjct: 61  DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  139 bits (337), Expect = 8e-33
 Identities = 64/75 (85%), Positives = 69/75 (92%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPI
Sbjct: 134 REHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGW+GDNMLEPS  M
Sbjct: 194 SGWNGDNMLEPSANM 208


>BC071619-1|AAH71619.1|  441|Homo sapiens EEF1A1 protein protein.
          Length = 441

 Score =  225 bits (549), Expect = 2e-58
 Identities = 110/133 (82%), Positives = 112/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 
Sbjct: 61  DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score = 89.4 bits (212), Expect = 1e-17
 Identities = 45/81 (55%), Positives = 54/81 (66%), Gaps = 4/81 (4%)
 Frame = +3

Query: 504 SNREHALLAFTLGVKQLIVGVNKMDSTEP----PYSEPRFEEIKKEVSSYIKKIGYNPAA 671
           S  + A+L    GV +   G++K   T       YS+ R+EEI KEVS+YIKKIGYNP  
Sbjct: 107 SQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYSQKRYEEIVKEVSTYIKKIGYNPDT 166

Query: 672 VAFVPISGWHGDNMLEPSTKM 734
           VAFVPISGW+GDNMLEPS  M
Sbjct: 167 VAFVPISGWNGDNMLEPSANM 187


>BC066893-1|AAH66893.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  225 bits (549), Expect = 2e-58
 Identities = 110/133 (82%), Positives = 112/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 
Sbjct: 61  DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  139 bits (337), Expect = 8e-33
 Identities = 64/75 (85%), Positives = 69/75 (92%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPI
Sbjct: 134 REHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGW+GDNMLEPS  M
Sbjct: 194 SGWNGDNMLEPSANM 208


>BC057391-1|AAH57391.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  225 bits (549), Expect = 2e-58
 Identities = 110/133 (82%), Positives = 112/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 
Sbjct: 61  DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  139 bits (337), Expect = 8e-33
 Identities = 64/75 (85%), Positives = 69/75 (92%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPI
Sbjct: 134 REHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGW+GDNMLEPS  M
Sbjct: 194 SGWNGDNMLEPSANM 208


>BC038339-1|AAH38339.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  225 bits (549), Expect = 2e-58
 Identities = 110/133 (82%), Positives = 112/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 
Sbjct: 61  DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  139 bits (337), Expect = 8e-33
 Identities = 64/75 (85%), Positives = 69/75 (92%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPI
Sbjct: 134 REHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGW+GDNMLEPS  M
Sbjct: 194 SGWNGDNMLEPSANM 208


>BC028674-1|AAH28674.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  225 bits (549), Expect = 2e-58
 Identities = 110/133 (82%), Positives = 112/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 
Sbjct: 61  DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  139 bits (337), Expect = 8e-33
 Identities = 64/75 (85%), Positives = 69/75 (92%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPI
Sbjct: 134 REHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGW+GDNMLEPS  M
Sbjct: 194 SGWNGDNMLEPSANM 208


>BC021686-1|AAH21686.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  225 bits (549), Expect = 2e-58
 Identities = 110/133 (82%), Positives = 112/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 
Sbjct: 61  DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  139 bits (337), Expect = 8e-33
 Identities = 64/75 (85%), Positives = 69/75 (92%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPI
Sbjct: 134 REHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGW+GDNMLEPS  M
Sbjct: 194 SGWNGDNMLEPSANM 208


>BC019669-1|AAH19669.1|  462|Homo sapiens EEF1A1 protein protein.
          Length = 462

 Score =  225 bits (549), Expect = 2e-58
 Identities = 110/133 (82%), Positives = 112/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 
Sbjct: 61  DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  139 bits (337), Expect = 8e-33
 Identities = 64/75 (85%), Positives = 69/75 (92%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPI
Sbjct: 134 REHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGW+GDNMLEPS  M
Sbjct: 194 SGWNGDNMLEPSANM 208


>BC018641-1|AAH18641.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  225 bits (549), Expect = 2e-58
 Identities = 110/133 (82%), Positives = 112/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 
Sbjct: 61  DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  139 bits (337), Expect = 8e-33
 Identities = 64/75 (85%), Positives = 69/75 (92%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPI
Sbjct: 134 REHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGW+GDNMLEPS  M
Sbjct: 194 SGWNGDNMLEPSANM 208


>BC018150-1|AAH18150.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  225 bits (549), Expect = 2e-58
 Identities = 110/133 (82%), Positives = 112/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 
Sbjct: 61  DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  139 bits (337), Expect = 8e-33
 Identities = 64/75 (85%), Positives = 69/75 (92%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPI
Sbjct: 134 REHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGW+GDNMLEPS  M
Sbjct: 194 SGWNGDNMLEPSANM 208


>BC014224-1|AAH14224.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  225 bits (549), Expect = 2e-58
 Identities = 110/133 (82%), Positives = 112/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 
Sbjct: 61  DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  139 bits (337), Expect = 8e-33
 Identities = 64/75 (85%), Positives = 69/75 (92%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPI
Sbjct: 134 REHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGW+GDNMLEPS  M
Sbjct: 194 SGWNGDNMLEPSANM 208


>BC012891-1|AAH12891.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  225 bits (549), Expect = 2e-58
 Identities = 110/133 (82%), Positives = 112/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 
Sbjct: 61  DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  139 bits (337), Expect = 8e-33
 Identities = 64/75 (85%), Positives = 69/75 (92%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPI
Sbjct: 134 REHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGW+GDNMLEPS  M
Sbjct: 194 SGWNGDNMLEPSANM 208


>BC010735-1|AAH10735.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  225 bits (549), Expect = 2e-58
 Identities = 110/133 (82%), Positives = 112/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 
Sbjct: 61  DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  139 bits (337), Expect = 8e-33
 Identities = 64/75 (85%), Positives = 69/75 (92%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPI
Sbjct: 134 REHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGW+GDNMLEPS  M
Sbjct: 194 SGWNGDNMLEPSANM 208


>BC009875-1|AAH09875.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  225 bits (549), Expect = 2e-58
 Identities = 110/133 (82%), Positives = 112/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 
Sbjct: 61  DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  139 bits (337), Expect = 8e-33
 Identities = 64/75 (85%), Positives = 69/75 (92%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPI
Sbjct: 134 REHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGW+GDNMLEPS  M
Sbjct: 194 SGWNGDNMLEPSANM 208


>BC009733-1|AAH09733.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  225 bits (549), Expect = 2e-58
 Identities = 110/133 (82%), Positives = 112/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 
Sbjct: 61  DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  139 bits (337), Expect = 8e-33
 Identities = 64/75 (85%), Positives = 69/75 (92%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPI
Sbjct: 134 REHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGW+GDNMLEPS  M
Sbjct: 194 SGWNGDNMLEPSANM 208


>BC008587-1|AAH08587.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  225 bits (549), Expect = 2e-58
 Identities = 110/133 (82%), Positives = 112/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 
Sbjct: 61  DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  139 bits (337), Expect = 8e-33
 Identities = 64/75 (85%), Positives = 69/75 (92%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPI
Sbjct: 134 REHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGW+GDNMLEPS  M
Sbjct: 194 SGWNGDNMLEPSANM 208


>AY043301-1|AAK95378.1|  462|Homo sapiens elongation factor 1-alpha
           protein.
          Length = 462

 Score =  225 bits (549), Expect = 2e-58
 Identities = 110/133 (82%), Positives = 112/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 
Sbjct: 61  DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  139 bits (337), Expect = 8e-33
 Identities = 64/75 (85%), Positives = 69/75 (92%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPI
Sbjct: 134 REHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGW+GDNMLEPS  M
Sbjct: 194 SGWNGDNMLEPSANM 208


>AL603910-9|CAI40951.1|  145|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 145

 Score =  225 bits (549), Expect = 2e-58
 Identities = 110/133 (82%), Positives = 112/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 
Sbjct: 61  DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133


>AL603910-8|CAI14883.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  225 bits (549), Expect = 2e-58
 Identities = 110/133 (82%), Positives = 112/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 
Sbjct: 61  DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  139 bits (337), Expect = 8e-33
 Identities = 64/75 (85%), Positives = 69/75 (92%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPI
Sbjct: 134 REHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGW+GDNMLEPS  M
Sbjct: 194 SGWNGDNMLEPSANM 208


>AL593851-4|CAH73620.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha-like 3 protein.
          Length = 462

 Score =  225 bits (549), Expect = 2e-58
 Identities = 110/133 (82%), Positives = 112/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 
Sbjct: 61  DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  139 bits (337), Expect = 8e-33
 Identities = 64/75 (85%), Positives = 69/75 (92%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPI
Sbjct: 134 REHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGW+GDNMLEPS  M
Sbjct: 194 SGWNGDNMLEPSANM 208


>AK223046-1|BAD96766.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 462

 Score =  225 bits (549), Expect = 2e-58
 Identities = 110/133 (82%), Positives = 112/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 
Sbjct: 61  DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  140 bits (338), Expect = 6e-33
 Identities = 64/75 (85%), Positives = 69/75 (92%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPI
Sbjct: 134 REHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIAKEVSTYIKKIGYNPDTVAFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGW+GDNMLEPS  M
Sbjct: 194 SGWNGDNMLEPSANM 208


>AK223030-1|BAD96750.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 462

 Score =  225 bits (549), Expect = 2e-58
 Identities = 110/133 (82%), Positives = 112/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 
Sbjct: 61  DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  139 bits (337), Expect = 8e-33
 Identities = 64/75 (85%), Positives = 69/75 (92%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPI
Sbjct: 134 REHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGW+GDNMLEPS  M
Sbjct: 194 SGWNGDNMLEPSANM 208


>AK222982-1|BAD96702.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 462

 Score =  225 bits (549), Expect = 2e-58
 Identities = 110/133 (82%), Positives = 112/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 
Sbjct: 61  DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  139 bits (337), Expect = 8e-33
 Identities = 64/75 (85%), Positives = 69/75 (92%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPI
Sbjct: 134 REHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSAYIKKIGYNPDTVAFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGW+GDNMLEPS  M
Sbjct: 194 SGWNGDNMLEPSANM 208


>AK222551-1|BAD96271.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 462

 Score =  225 bits (549), Expect = 2e-58
 Identities = 110/133 (82%), Positives = 112/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 
Sbjct: 61  DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  139 bits (337), Expect = 8e-33
 Identities = 64/75 (85%), Positives = 69/75 (92%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPI
Sbjct: 134 REHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGW+GDNMLEPS  M
Sbjct: 194 SGWNGDNMLEPSANM 208


>AK222523-1|BAD96243.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 462

 Score =  225 bits (549), Expect = 2e-58
 Identities = 110/133 (82%), Positives = 112/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 
Sbjct: 61  DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  139 bits (337), Expect = 8e-33
 Identities = 64/75 (85%), Positives = 69/75 (92%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPI
Sbjct: 134 REHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGW+GDNMLEPS  M
Sbjct: 194 SGWNGDNMLEPSANM 208


>AK222515-1|BAD96235.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 462

 Score =  225 bits (549), Expect = 2e-58
 Identities = 110/133 (82%), Positives = 112/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 
Sbjct: 61  DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  139 bits (337), Expect = 8e-33
 Identities = 64/75 (85%), Positives = 69/75 (92%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPI
Sbjct: 134 REHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGW+GDNMLEPS  M
Sbjct: 194 SGWNGDNMLEPSANM 208


>AF267861-1|AAG44730.1|  427|Homo sapiens EF1a-like protein protein.
          Length = 427

 Score =  225 bits (549), Expect = 2e-58
 Identities = 110/133 (82%), Positives = 112/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 
Sbjct: 61  DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  139 bits (337), Expect = 8e-33
 Identities = 64/75 (85%), Positives = 69/75 (92%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPI
Sbjct: 134 REHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGW+GDNMLEPS  M
Sbjct: 194 SGWNGDNMLEPSANM 208


>X70940-1|CAA50280.1|  463|Homo sapiens elongation factor 1 alpha-2
           protein.
          Length = 463

 Score =  223 bits (545), Expect = 5e-58
 Identities = 108/133 (81%), Positives = 112/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDI+LWKFET+KYY+TIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 
Sbjct: 61  DKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  139 bits (336), Expect = 1e-32
 Identities = 64/75 (85%), Positives = 68/75 (90%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEP YSE R++EI KEVS+YIKKIGYNPA V FVPI
Sbjct: 134 REHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGWHGDNMLEPS  M
Sbjct: 194 SGWHGDNMLEPSPNM 208


>BC110409-1|AAI10410.1|  463|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 2 protein.
          Length = 463

 Score =  223 bits (545), Expect = 5e-58
 Identities = 108/133 (81%), Positives = 112/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDI+LWKFET+KYY+TIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 
Sbjct: 61  DKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  139 bits (336), Expect = 1e-32
 Identities = 64/75 (85%), Positives = 68/75 (90%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEP YSE R++EI KEVS+YIKKIGYNPA V FVPI
Sbjct: 134 REHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGWHGDNMLEPS  M
Sbjct: 194 SGWHGDNMLEPSPNM 208


>BC000432-1|AAH00432.1|  463|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 2 protein.
          Length = 463

 Score =  223 bits (545), Expect = 5e-58
 Identities = 108/133 (81%), Positives = 112/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDI+LWKFET+KYY+TIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 
Sbjct: 61  DKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  139 bits (336), Expect = 1e-32
 Identities = 64/75 (85%), Positives = 68/75 (90%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEP YSE R++EI KEVS+YIKKIGYNPA V FVPI
Sbjct: 134 REHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGWHGDNMLEPS  M
Sbjct: 194 SGWHGDNMLEPSPNM 208


>AL121829-9|CAC15522.1|  463|Homo sapiens EEF1A2 protein.
          Length = 463

 Score =  223 bits (545), Expect = 5e-58
 Identities = 108/133 (81%), Positives = 112/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDI+LWKFET+KYY+TIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 
Sbjct: 61  DKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  139 bits (336), Expect = 1e-32
 Identities = 64/75 (85%), Positives = 68/75 (90%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEP YSE R++EI KEVS+YIKKIGYNPA V FVPI
Sbjct: 134 REHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGWHGDNMLEPS  M
Sbjct: 194 SGWHGDNMLEPSPNM 208


>AF163763-1|AAF80488.1|  463|Homo sapiens elongation factor 1 A-2
           protein.
          Length = 463

 Score =  223 bits (545), Expect = 5e-58
 Identities = 108/133 (81%), Positives = 112/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDI+LWKFET+KYY+TIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 
Sbjct: 61  DKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  139 bits (336), Expect = 1e-32
 Identities = 64/75 (85%), Positives = 68/75 (90%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEP YSE R++EI KEVS+YIKKIGYNPA V FVPI
Sbjct: 134 REHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGWHGDNMLEPS  M
Sbjct: 194 SGWHGDNMLEPSPNM 208


>BC071727-1|AAH71727.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  220 bits (538), Expect = 4e-57
 Identities = 109/133 (81%), Positives = 111/133 (83%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKFGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 
Sbjct: 61  DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  139 bits (337), Expect = 8e-33
 Identities = 64/75 (85%), Positives = 69/75 (92%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPI
Sbjct: 134 REHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGW+GDNMLEPS  M
Sbjct: 194 SGWNGDNMLEPSANM 208


>AL603910-10|CAO03613.1|  107|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 107

 Score =  174 bits (424), Expect = 2e-43
 Identities = 85/107 (79%), Positives = 87/107 (81%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTS 432
              +     GITIDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTS
Sbjct: 61  DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTS 107


>L10340-1|AAA91835.1|  435|Homo sapiens elongation factor-1 alpha
           protein.
          Length = 435

 Score =  165 bits (400), Expect = 2e-40
 Identities = 80/105 (76%), Positives = 84/105 (80%)
 Frame = +1

Query: 196 YKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVSVGITIDIALWKFETSKYYVT 375
           YKCGGIDKRTIEKFEKEA E  K            +     GITIDI+LWKFET+KYY+T
Sbjct: 1   YKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETTKYYIT 60

Query: 376 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQT 510
           IIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQT
Sbjct: 61  IIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQT 105



 Score =  139 bits (336), Expect = 1e-32
 Identities = 64/75 (85%), Positives = 68/75 (90%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEP YSE R++EI KEVS+YIKKIGYNPA V FVPI
Sbjct: 106 REHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPI 165

Query: 690 SGWHGDNMLEPSTKM 734
           SGWHGDNMLEPS  M
Sbjct: 166 SGWHGDNMLEPSPNM 180


>AK223042-1|BAD96762.1|  433|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 433

 Score =  161 bits (392), Expect = 2e-39
 Identities = 80/104 (76%), Positives = 82/104 (78%)
 Frame = +1

Query: 199 KCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVSVGITIDIALWKFETSKYYVTI 378
           KCGGIDKRTIEKFEKEA E  K            +     GITIDI+LWKFETSKYYVT 
Sbjct: 1   KCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTT 60

Query: 379 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQT 510
           IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQT
Sbjct: 61  IDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQT 104



 Score =  139 bits (337), Expect = 8e-33
 Identities = 64/75 (85%), Positives = 69/75 (92%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPI
Sbjct: 105 REHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPI 164

Query: 690 SGWHGDNMLEPSTKM 734
           SGW+GDNMLEPS  M
Sbjct: 165 SGWNGDNMLEPSANM 179


>X03689-1|CAA27325.1|   94|Homo sapiens protein ( Human mRNA
           fragment for elongation factor TU (N-terminus). ).
          Length = 94

 Score =  145 bits (352), Expect = 1e-34
 Identities = 71/94 (75%), Positives = 74/94 (78%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPG 393
              +     GITIDI+LWKFET+KYYVTIIDAPG
Sbjct: 61  DKLKAERERGITIDISLWKFETAKYYVTIIDAPG 94


>AF174496-1|AAF36537.1|  426|Homo sapiens glucocorticoid receptor
           AF-1 specific elongation factor protein.
          Length = 426

 Score =  144 bits (350), Expect = 2e-34
 Identities = 71/93 (76%), Positives = 73/93 (78%)
 Frame = +1

Query: 232 KFEKEAQEWVKDPSNMLGYWTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIK 411
           KFEKEA E  K        W   +     GITIDI+LWKFETSKYYVTIIDAPGHRDFIK
Sbjct: 5   KFEKEAAEMGKGSFKYAWVWDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIK 64

Query: 412 NMITGTSQADCAVLIVAAGTGEFEAGISKNGQT 510
           NMITGTSQADCAVLIVAAG GEFEAGISKNGQT
Sbjct: 65  NMITGTSQADCAVLIVAAGVGEFEAGISKNGQT 97



 Score =  132 bits (319), Expect = 1e-30
 Identities = 61/75 (81%), Positives = 66/75 (88%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNK  STEPPYS+ R+EEI KEV +YIKKIGYNP  VAFVPI
Sbjct: 98  REHALLAYTLGVKQLIVGVNKSHSTEPPYSQKRYEEIVKEVRTYIKKIGYNPDTVAFVPI 157

Query: 690 SGWHGDNMLEPSTKM 734
           SGW+GDNMLEPS  M
Sbjct: 158 SGWNGDNMLEPSANM 172


>L41498-1|AAC09386.1|  398|Homo sapiens longation factor 1-alpha 1
           protein.
          Length = 398

 Score =  139 bits (337), Expect = 8e-33
 Identities = 64/75 (85%), Positives = 69/75 (92%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPI
Sbjct: 70  REHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPI 129

Query: 690 SGWHGDNMLEPSTKM 734
           SGW+GDNMLEPS  M
Sbjct: 130 SGWNGDNMLEPSANM 144



 Score =  132 bits (319), Expect = 1e-30
 Identities = 61/64 (95%), Positives = 63/64 (98%)
 Frame = +1

Query: 319 GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISK 498
           GITIDI+LWKFETSKYYVTIIDAPGHRDFI+NMITGTSQADCAVLIVAAG GEFEAGISK
Sbjct: 6   GITIDISLWKFETSKYYVTIIDAPGHRDFIQNMITGTSQADCAVLIVAAGVGEFEAGISK 65

Query: 499 NGQT 510
           NGQT
Sbjct: 66  NGQT 69


>L41490-1|AAC09385.1|  398|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1-like 14 protein.
          Length = 398

 Score =  139 bits (337), Expect = 8e-33
 Identities = 64/75 (85%), Positives = 69/75 (92%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPI
Sbjct: 70  REHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPI 129

Query: 690 SGWHGDNMLEPSTKM 734
           SGW+GDNMLEPS  M
Sbjct: 130 SGWNGDNMLEPSANM 144



 Score =  132 bits (319), Expect = 1e-30
 Identities = 61/64 (95%), Positives = 63/64 (98%)
 Frame = +1

Query: 319 GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISK 498
           GITIDI+LWKFETSKYYVTIIDAPGHRDFI+NMITGTSQADCAVLIVAAG GEFEAGISK
Sbjct: 6   GITIDISLWKFETSKYYVTIIDAPGHRDFIQNMITGTSQADCAVLIVAAGVGEFEAGISK 65

Query: 499 NGQT 510
           NGQT
Sbjct: 66  NGQT 69


>AY062434-1|AAL38981.1|  398|Homo sapiens elongation factor 1-alpha
           1 protein.
          Length = 398

 Score =  139 bits (337), Expect = 8e-33
 Identities = 64/75 (85%), Positives = 69/75 (92%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPI
Sbjct: 70  REHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPI 129

Query: 690 SGWHGDNMLEPSTKM 734
           SGW+GDNMLEPS  M
Sbjct: 130 SGWNGDNMLEPSANM 144



 Score =  132 bits (319), Expect = 1e-30
 Identities = 61/64 (95%), Positives = 63/64 (98%)
 Frame = +1

Query: 319 GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISK 498
           GITIDI+LWKFETSKYYVTIIDAPGHRDFI+NMITGTSQADCAVLIVAAG GEFEAGISK
Sbjct: 6   GITIDISLWKFETSKYYVTIIDAPGHRDFIQNMITGTSQADCAVLIVAAGVGEFEAGISK 65

Query: 499 NGQT 510
           NGQT
Sbjct: 66  NGQT 69


>AK222519-1|BAD96239.1|  366|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 366

 Score =  139 bits (337), Expect = 8e-33
 Identities = 64/75 (85%), Positives = 69/75 (92%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPI
Sbjct: 38  REHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPI 97

Query: 690 SGWHGDNMLEPSTKM 734
           SGW+GDNMLEPS  M
Sbjct: 98  SGWNGDNMLEPSANM 112



 Score = 77.0 bits (181), Expect = 7e-14
 Identities = 36/37 (97%), Positives = 36/37 (97%)
 Frame = +1

Query: 400 DFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQT 510
           DFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQT
Sbjct: 1   DFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQT 37


>AF397403-1|AAK93966.1|  398|Homo sapiens translation elongation
           factor 1 alpha 1-like 14 protein.
          Length = 398

 Score =  139 bits (337), Expect = 8e-33
 Identities = 64/75 (85%), Positives = 69/75 (92%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPI
Sbjct: 70  REHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPI 129

Query: 690 SGWHGDNMLEPSTKM 734
           SGW+GDNMLEPS  M
Sbjct: 130 SGWNGDNMLEPSANM 144



 Score =  134 bits (323), Expect = 4e-31
 Identities = 62/64 (96%), Positives = 63/64 (98%)
 Frame = +1

Query: 319 GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISK 498
           GITIDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISK
Sbjct: 6   GITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISK 65

Query: 499 NGQT 510
           NGQT
Sbjct: 66  NGQT 69


>AF328730-1|AAN09722.1|  361|Homo sapiens CTCL tumor antigen
           HD-CL-08 protein.
          Length = 361

 Score =  139 bits (337), Expect = 8e-33
 Identities = 64/75 (85%), Positives = 69/75 (92%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPI
Sbjct: 33  REHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPI 92

Query: 690 SGWHGDNMLEPSTKM 734
           SGW+GDNMLEPS  M
Sbjct: 93  SGWNGDNMLEPSANM 107



 Score = 66.1 bits (154), Expect = 1e-10
 Identities = 31/32 (96%), Positives = 31/32 (96%)
 Frame = +1

Query: 415 MITGTSQADCAVLIVAAGTGEFEAGISKNGQT 510
           MITGTSQADCAVLIVAAG GEFEAGISKNGQT
Sbjct: 1   MITGTSQADCAVLIVAAGVGEFEAGISKNGQT 32


>AF322220-1|AAN51932.1|  361|Homo sapiens cervical cancer suppressor
           3 protein.
          Length = 361

 Score =  139 bits (337), Expect = 8e-33
 Identities = 64/75 (85%), Positives = 69/75 (92%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPI
Sbjct: 33  REHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPI 92

Query: 690 SGWHGDNMLEPSTKM 734
           SGW+GDNMLEPS  M
Sbjct: 93  SGWNGDNMLEPSANM 107



 Score = 66.1 bits (154), Expect = 1e-10
 Identities = 31/32 (96%), Positives = 31/32 (96%)
 Frame = +1

Query: 415 MITGTSQADCAVLIVAAGTGEFEAGISKNGQT 510
           MITGTSQADCAVLIVAAG GEFEAGISKNGQT
Sbjct: 1   MITGTSQADCAVLIVAAGVGEFEAGISKNGQT 32


>AB209064-1|BAD92301.1|  340|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 2 variant protein.
          Length = 340

 Score =  139 bits (336), Expect = 1e-32
 Identities = 64/75 (85%), Positives = 68/75 (90%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEP YSE R++EI KEVS+YIKKIGYNPA V FVPI
Sbjct: 110 REHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPI 169

Query: 690 SGWHGDNMLEPSTKM 734
           SGWHGDNMLEPS  M
Sbjct: 170 SGWHGDNMLEPSPNM 184



 Score =  132 bits (319), Expect = 1e-30
 Identities = 60/64 (93%), Positives = 63/64 (98%)
 Frame = +1

Query: 319 GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISK 498
           GITIDI+LWKFET+KYY+TIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISK
Sbjct: 46  GITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISK 105

Query: 499 NGQT 510
           NGQT
Sbjct: 106 NGQT 109



 Score = 48.8 bits (111), Expect = 2e-05
 Identities = 21/21 (100%), Positives = 21/21 (100%)
 Frame = +3

Query: 255 MGKGSFKYAWVLDKLKAERER 317
           MGKGSFKYAWVLDKLKAERER
Sbjct: 25  MGKGSFKYAWVLDKLKAERER 45


>U87791-1|AAD00645.1|  684|Homo sapiens eRFS protein.
          Length = 684

 Score =  130 bits (315), Expect = 4e-30
 Identities = 63/129 (48%), Positives = 86/129 (66%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*R 303
           K  +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++  K             
Sbjct: 258 KQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETG 317

Query: 304 LSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 483
                G+T+D+ + KFET+   +T++DAPGH+DFI NMITG +QAD AVL+V A  GEFE
Sbjct: 318 EERERGVTMDVGMTKFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFE 377

Query: 484 AGISKNGQT 510
           AG    GQT
Sbjct: 378 AGFETGGQT 386



 Score = 63.3 bits (147), Expect = 9e-10
 Identities = 30/72 (41%), Positives = 45/72 (62%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REH LL  +LGV QL V VNKMD     + + RF+EI  ++  ++K+ G+  + V F+P 
Sbjct: 387 REHGLLVRSLGVTQLAVAVNKMDQVN--WQQERFQEITGKLGHFLKQAGFKESDVGFIPT 444

Query: 690 SGWHGDNMLEPS 725
           SG  G+N++  S
Sbjct: 445 SGLSGENLITRS 456


>M29548-1|AAA52367.1|  327|Homo sapiens EEF1A protein.
          Length = 327

 Score =  130 bits (315), Expect = 4e-30
 Identities = 60/71 (84%), Positives = 65/71 (91%)
 Frame = +3

Query: 522 LLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWH 701
           LLA+TLGVKQLIVGVNKMDSTEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+
Sbjct: 3   LLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWN 62

Query: 702 GDNMLEPSTKM 734
           GDNMLEPS  M
Sbjct: 63  GDNMLEPSANM 73


>BC040849-1|AAH40849.1|  684|Homo sapiens HBS1-like (S. cerevisiae)
           protein.
          Length = 684

 Score =  130 bits (315), Expect = 4e-30
 Identities = 63/129 (48%), Positives = 86/129 (66%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*R 303
           K  +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++  K             
Sbjct: 258 KQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETG 317

Query: 304 LSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 483
                G+T+D+ + KFET+   +T++DAPGH+DFI NMITG +QAD AVL+V A  GEFE
Sbjct: 318 EERERGVTMDVGMTKFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFE 377

Query: 484 AGISKNGQT 510
           AG    GQT
Sbjct: 378 AGFETGGQT 386



 Score = 63.3 bits (147), Expect = 9e-10
 Identities = 30/72 (41%), Positives = 45/72 (62%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REH LL  +LGV QL V VNKMD     + + RF+EI  ++  ++K+ G+  + V F+P 
Sbjct: 387 REHGLLVRSLGVTQLAVAVNKMDQVN--WQQERFQEITGKLGHFLKQAGFKESDVGFIPT 444

Query: 690 SGWHGDNMLEPS 725
           SG  G+N++  S
Sbjct: 445 SGLSGENLITRS 456


>BC001465-1|AAH01465.1|  684|Homo sapiens HBS1-like (S. cerevisiae)
           protein.
          Length = 684

 Score =  130 bits (315), Expect = 4e-30
 Identities = 63/129 (48%), Positives = 86/129 (66%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*R 303
           K  +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++  K             
Sbjct: 258 KQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETG 317

Query: 304 LSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 483
                G+T+D+ + KFET+   +T++DAPGH+DFI NMITG +QAD AVL+V A  GEFE
Sbjct: 318 EERERGVTMDVGMTKFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFE 377

Query: 484 AGISKNGQT 510
           AG    GQT
Sbjct: 378 AGFETGGQT 386



 Score = 63.3 bits (147), Expect = 9e-10
 Identities = 30/72 (41%), Positives = 45/72 (62%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REH LL  +LGV QL V VNKMD     + + RF+EI  ++  ++K+ G+  + V F+P 
Sbjct: 387 REHGLLVRSLGVTQLAVAVNKMDQVN--WQQERFQEITGKLGHFLKQAGFKESDVGFIPT 444

Query: 690 SGWHGDNMLEPS 725
           SG  G+N++  S
Sbjct: 445 SGLSGENLITRS 456


>AL445190-5|CAI95161.1|  684|Homo sapiens HBS1-like (S. cerevisiae)
           protein.
          Length = 684

 Score =  130 bits (315), Expect = 4e-30
 Identities = 63/129 (48%), Positives = 86/129 (66%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*R 303
           K  +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++  K             
Sbjct: 258 KQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETG 317

Query: 304 LSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 483
                G+T+D+ + KFET+   +T++DAPGH+DFI NMITG +QAD AVL+V A  GEFE
Sbjct: 318 EERERGVTMDVGMTKFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFE 377

Query: 484 AGISKNGQT 510
           AG    GQT
Sbjct: 378 AGFETGGQT 386



 Score = 63.3 bits (147), Expect = 9e-10
 Identities = 30/72 (41%), Positives = 45/72 (62%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REH LL  +LGV QL V VNKMD     + + RF+EI  ++  ++K+ G+  + V F+P 
Sbjct: 387 REHGLLVRSLGVTQLAVAVNKMDQVN--WQQERFQEITGKLGHFLKQAGFKESDVGFIPT 444

Query: 690 SGWHGDNMLEPS 725
           SG  G+N++  S
Sbjct: 445 SGLSGENLITRS 456


>AL353596-2|CAI17912.1|  684|Homo sapiens HBS1-like (S. cerevisiae)
           protein.
          Length = 684

 Score =  130 bits (315), Expect = 4e-30
 Identities = 63/129 (48%), Positives = 86/129 (66%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*R 303
           K  +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++  K             
Sbjct: 258 KQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETG 317

Query: 304 LSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 483
                G+T+D+ + KFET+   +T++DAPGH+DFI NMITG +QAD AVL+V A  GEFE
Sbjct: 318 EERERGVTMDVGMTKFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFE 377

Query: 484 AGISKNGQT 510
           AG    GQT
Sbjct: 378 AGFETGGQT 386



 Score = 63.3 bits (147), Expect = 9e-10
 Identities = 30/72 (41%), Positives = 45/72 (62%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REH LL  +LGV QL V VNKMD     + + RF+EI  ++  ++K+ G+  + V F+P 
Sbjct: 387 REHGLLVRSLGVTQLAVAVNKMDQVN--WQQERFQEITGKLGHFLKQAGFKESDVGFIPT 444

Query: 690 SGWHGDNMLEPS 725
           SG  G+N++  S
Sbjct: 445 SGLSGENLITRS 456


>AJ459826-1|CAD30873.1|  684|Homo sapiens HBS1-like protein protein.
          Length = 684

 Score =  130 bits (315), Expect = 4e-30
 Identities = 63/129 (48%), Positives = 86/129 (66%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*R 303
           K  +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++  K             
Sbjct: 258 KQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETG 317

Query: 304 LSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 483
                G+T+D+ + KFET+   +T++DAPGH+DFI NMITG +QAD AVL+V A  GEFE
Sbjct: 318 EERERGVTMDVGMTKFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFE 377

Query: 484 AGISKNGQT 510
           AG    GQT
Sbjct: 378 AGFETGGQT 386



 Score = 63.3 bits (147), Expect = 9e-10
 Identities = 30/72 (41%), Positives = 45/72 (62%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REH LL  +LGV QL V VNKMD     + + RF+EI  ++  ++K+ G+  + V F+P 
Sbjct: 387 REHGLLVRSLGVTQLAVAVNKMDQVN--WQQERFQEITGKLGHFLKQAGFKESDVGFIPT 444

Query: 690 SGWHGDNMLEPS 725
           SG  G+N++  S
Sbjct: 445 SGLSGENLITRS 456


>AB028961-1|BAA82990.1|  496|Homo sapiens KIAA1038 protein protein.
          Length = 496

 Score =  130 bits (315), Expect = 4e-30
 Identities = 63/129 (48%), Positives = 86/129 (66%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*R 303
           K  +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++  K             
Sbjct: 70  KQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETG 129

Query: 304 LSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 483
                G+T+D+ + KFET+   +T++DAPGH+DFI NMITG +QAD AVL+V A  GEFE
Sbjct: 130 EERERGVTMDVGMTKFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFE 189

Query: 484 AGISKNGQT 510
           AG    GQT
Sbjct: 190 AGFETGGQT 198



 Score = 63.3 bits (147), Expect = 9e-10
 Identities = 30/72 (41%), Positives = 45/72 (62%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REH LL  +LGV QL V VNKMD     + + RF+EI  ++  ++K+ G+  + V F+P 
Sbjct: 199 REHGLLVRSLGVTQLAVAVNKMDQVN--WQQERFQEITGKLGHFLKQAGFKESDVGFIPT 256

Query: 690 SGWHGDNMLEPS 725
           SG  G+N++  S
Sbjct: 257 SGLSGENLITRS 268


>X17644-1|CAA35635.1|  499|Homo sapiens protein ( Human GST1-Hs mRNA
           for GTP-binding protein. ).
          Length = 499

 Score =  130 bits (314), Expect = 5e-30
 Identities = 62/135 (45%), Positives = 87/135 (64%)
 Frame = +1

Query: 106 PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLG 285
           P    +K H+N+V IGHVD+GKST  G ++Y  G +DKRT+EK+E+EA+E  ++   +  
Sbjct: 66  PPGAPKKEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYEREAKEKNRETWYLSW 125

Query: 286 YWTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAA 465
                +     G T+++    FET K + TI+DAPGH+ F+ NMI G SQAD AVL+++A
Sbjct: 126 ALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGASQADLAVLVISA 185

Query: 466 GTGEFEAGISKNGQT 510
             GEFE G  K GQT
Sbjct: 186 RKGEFETGFEKGGQT 200



 Score = 71.3 bits (167), Expect = 3e-12
 Identities = 35/73 (47%), Positives = 49/73 (67%), Gaps = 1/73 (1%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAA-VAFVP 686
           REHA+LA T GVK LIV +NKMD     +S  R+EE K+++  ++KK+G+NP   + F+P
Sbjct: 201 REHAMLAKTAGVKHLIVLINKMDDPTVNWSNERYEECKEKLVPFLKKVGFNPKKDIHFMP 260

Query: 687 ISGWHGDNMLEPS 725
            SG  G N+ E S
Sbjct: 261 CSGLTGANLKEQS 273


>U95742-2|AAB67250.1|  499|Homo sapiens G1 to S phase transition
           protein protein.
          Length = 499

 Score =  130 bits (314), Expect = 5e-30
 Identities = 62/135 (45%), Positives = 87/135 (64%)
 Frame = +1

Query: 106 PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLG 285
           P    +K H+N+V IGHVD+GKST  G ++Y  G +DKRT+EK+E+EA+E  ++   +  
Sbjct: 66  PPGAPKKEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYEREAKEKNRETWYLSW 125

Query: 286 YWTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAA 465
                +     G T+++    FET K + TI+DAPGH+ F+ NMI G SQAD AVL+++A
Sbjct: 126 ALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGASQADLAVLVISA 185

Query: 466 GTGEFEAGISKNGQT 510
             GEFE G  K GQT
Sbjct: 186 RKGEFETGFEKGGQT 200



 Score = 71.3 bits (167), Expect = 3e-12
 Identities = 35/73 (47%), Positives = 49/73 (67%), Gaps = 1/73 (1%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAA-VAFVP 686
           REHA+LA T GVK LIV +NKMD     +S  R+EE K+++  ++KK+G+NP   + F+P
Sbjct: 201 REHAMLAKTAGVKHLIVLINKMDDPTVNWSNERYEECKEKLVPFLKKVGFNPKKDIHFMP 260

Query: 687 ISGWHGDNMLEPS 725
            SG  G N+ E S
Sbjct: 261 CSGLTGANLKEQS 273


>BT006722-1|AAP35368.1|  498|Homo sapiens G1 to S phase transition 1
           protein.
          Length = 498

 Score =  130 bits (314), Expect = 5e-30
 Identities = 62/135 (45%), Positives = 87/135 (64%)
 Frame = +1

Query: 106 PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLG 285
           P    +K H+N+V IGHVD+GKST  G ++Y  G +DKRT+EK+E+EA+E  ++   +  
Sbjct: 65  PPGAPKKEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYEREAKEKNRETWYLSW 124

Query: 286 YWTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAA 465
                +     G T+++    FET K + TI+DAPGH+ F+ NMI G SQAD AVL+++A
Sbjct: 125 ALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGASQADLAVLVISA 184

Query: 466 GTGEFEAGISKNGQT 510
             GEFE G  K GQT
Sbjct: 185 RKGEFETGFEKGGQT 199



 Score = 71.3 bits (167), Expect = 3e-12
 Identities = 35/73 (47%), Positives = 49/73 (67%), Gaps = 1/73 (1%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAA-VAFVP 686
           REHA+LA T GVK LIV +NKMD     +S  R+EE K+++  ++KK+G+NP   + F+P
Sbjct: 200 REHAMLAKTAGVKHLIVLINKMDDPTVNWSNERYEECKEKLVPFLKKVGFNPKKDIHFMP 259

Query: 687 ISGWHGDNMLEPS 725
            SG  G N+ E S
Sbjct: 260 CSGLTGANLKEQS 272


>BC009503-1|AAH09503.2|  633|Homo sapiens GSPT1 protein protein.
          Length = 633

 Score =  130 bits (314), Expect = 5e-30
 Identities = 62/135 (45%), Positives = 87/135 (64%)
 Frame = +1

Query: 106 PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLG 285
           P    +K H+N+V IGHVD+GKST  G ++Y  G +DKRT+EK+E+EA+E  ++   +  
Sbjct: 200 PPGAPKKEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYEREAKEKNRETWYLSW 259

Query: 286 YWTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAA 465
                +     G T+++    FET K + TI+DAPGH+ F+ NMI G SQAD AVL+++A
Sbjct: 260 ALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGASQADLAVLVISA 319

Query: 466 GTGEFEAGISKNGQT 510
             GEFE G  K GQT
Sbjct: 320 RKGEFETGFEKGGQT 334



 Score = 71.3 bits (167), Expect = 3e-12
 Identities = 35/73 (47%), Positives = 49/73 (67%), Gaps = 1/73 (1%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAA-VAFVP 686
           REHA+LA T GVK LIV +NKMD     +S  R+EE K+++  ++KK+G+NP   + F+P
Sbjct: 335 REHAMLAKTAGVKHLIVLINKMDDPTVNWSNERYEECKEKLVPFLKKVGFNPKKDIHFMP 394

Query: 687 ISGWHGDNMLEPS 725
            SG  G N+ E S
Sbjct: 395 CSGLTGANLKEQS 407


>BC036077-1|AAH36077.1|  628|Homo sapiens G1 to S phase transition 2
           protein.
          Length = 628

 Score =  128 bits (308), Expect = 3e-29
 Identities = 60/135 (44%), Positives = 87/135 (64%)
 Frame = +1

Query: 106 PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLG 285
           P    +K H+N+V IGHVD+GKST  G +++  G +DKRT+EK+E+EA+E  ++   +  
Sbjct: 195 PSGAPKKEHVNVVFIGHVDAGKSTIGGQIMFLTGMVDKRTLEKYEREAKEKNRETWYLSW 254

Query: 286 YWTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAA 465
                +     G T+++    FET + + TI+DAPGH+ F+ NMI G SQAD AVL+++A
Sbjct: 255 ALDTNQEERDKGKTVEVGRAYFETERKHFTILDAPGHKSFVPNMIGGASQADLAVLVISA 314

Query: 466 GTGEFEAGISKNGQT 510
             GEFE G  K GQT
Sbjct: 315 RKGEFETGFEKGGQT 329



 Score = 67.3 bits (157), Expect = 5e-11
 Identities = 34/73 (46%), Positives = 49/73 (67%), Gaps = 1/73 (1%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAA-VAFVP 686
           REHA+LA T GVK LIV +NKMD     +S  R+EE K+++  ++KK+G++P   + F+P
Sbjct: 330 REHAMLAKTAGVKHLIVLINKMDDHTVNWSIERYEECKEKLVPFLKKVGFSPKKDIHFMP 389

Query: 687 ISGWHGDNMLEPS 725
            SG  G N+ E S
Sbjct: 390 CSGLTGANIKEQS 402


>AL929101-2|CAH71524.1|  628|Homo sapiens G1 to S phase transition 2
           protein.
          Length = 628

 Score =  128 bits (308), Expect = 3e-29
 Identities = 60/135 (44%), Positives = 87/135 (64%)
 Frame = +1

Query: 106 PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLG 285
           P    +K H+N+V IGHVD+GKST  G +++  G +DKRT+EK+E+EA+E  ++   +  
Sbjct: 195 PSGAPKKEHVNVVFIGHVDAGKSTIGGQIMFLTGMVDKRTLEKYEREAKEKNRETWYLSW 254

Query: 286 YWTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAA 465
                +     G T+++    FET + + TI+DAPGH+ F+ NMI G SQAD AVL+++A
Sbjct: 255 ALDTNQEERDKGKTVEVGRAYFETERKHFTILDAPGHKSFVPNMIGGASQADLAVLVISA 314

Query: 466 GTGEFEAGISKNGQT 510
             GEFE G  K GQT
Sbjct: 315 RKGEFETGFEKGGQT 329



 Score = 67.7 bits (158), Expect = 4e-11
 Identities = 34/73 (46%), Positives = 49/73 (67%), Gaps = 1/73 (1%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAA-VAFVP 686
           REHA+LA T GVK LIV +NKMD     +S  R+EE K+++  ++KK+G++P   + F+P
Sbjct: 330 REHAMLAKTAGVKHLIVLINKMDDPTVNWSIERYEECKEKLVPFLKKVGFSPKKDIHFMP 389

Query: 687 ISGWHGDNMLEPS 725
            SG  G N+ E S
Sbjct: 390 CSGLTGANIKEQS 402


>AK023155-1|BAB14435.1|  504|Homo sapiens protein ( Homo sapiens
           cDNA FLJ13093 fis, clone NT2RP3002151, highly similar to
           G1 TO S PHASE TRANSITION PROTEIN 1 HOMOLOG. ).
          Length = 504

 Score =  128 bits (308), Expect = 3e-29
 Identities = 60/135 (44%), Positives = 87/135 (64%)
 Frame = +1

Query: 106 PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLG 285
           P    +K H+N+V IGHVD+GKST  G +++  G +DKRT+EK+E+EA+E  ++   +  
Sbjct: 92  PSGAPKKEHVNVVFIGHVDAGKSTIGGQIMFLTGMVDKRTLEKYEREAKEKNRETWYLSW 151

Query: 286 YWTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAA 465
                +     G T+++    FET + + TI+DAPGH+ F+ NMI G SQAD AVL+++A
Sbjct: 152 ALDTNQEERDKGKTVEVGRAYFETERKHFTILDAPGHKSFVPNMIGGASQADLAVLVISA 211

Query: 466 GTGEFEAGISKNGQT 510
             GEFE G  K GQT
Sbjct: 212 RKGEFETGFEKGGQT 226



 Score = 67.7 bits (158), Expect = 4e-11
 Identities = 34/73 (46%), Positives = 49/73 (67%), Gaps = 1/73 (1%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAA-VAFVP 686
           REHA+LA T GVK LIV +NKMD     +S  R+EE K+++  ++KK+G++P   + F+P
Sbjct: 227 REHAMLAKTAGVKHLIVLINKMDDPTVNWSIERYEECKEKLVPFLKKVGFSPKKDIHFMP 286

Query: 687 ISGWHGDNMLEPS 725
            SG  G N+ E S
Sbjct: 287 CSGLTGANIKEQS 299


>AJ251548-1|CAB91089.1|  628|Homo sapiens polypeptide chain release
           factor 3b protein.
          Length = 628

 Score =  128 bits (308), Expect = 3e-29
 Identities = 60/135 (44%), Positives = 87/135 (64%)
 Frame = +1

Query: 106 PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLG 285
           P    +K H+N+V IGHVD+GKST  G +++  G +DKRT+EK+E+EA+E  ++   +  
Sbjct: 195 PSGAPKKEHVNVVFIGHVDAGKSTIGGQIMFLTGMVDKRTLEKYEREAKEKNRETWYLSW 254

Query: 286 YWTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAA 465
                +     G T+++    FET + + TI+DAPGH+ F+ NMI G SQAD AVL+++A
Sbjct: 255 ALDTNQEERDKGKTVEVGRAYFETERKHFTILDAPGHKSFVPNMIGGASQADLAVLVISA 314

Query: 466 GTGEFEAGISKNGQT 510
             GEFE G  K GQT
Sbjct: 315 RKGEFETGFEKGGQT 329



 Score = 67.7 bits (158), Expect = 4e-11
 Identities = 34/73 (46%), Positives = 49/73 (67%), Gaps = 1/73 (1%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAA-VAFVP 686
           REHA+LA T GVK LIV +NKMD     +S  R+EE K+++  ++KK+G++P   + F+P
Sbjct: 330 REHAMLAKTAGVKHLIVLINKMDDPTVNWSIERYEECKEKLVPFLKKVGFSPKKDIHFMP 389

Query: 687 ISGWHGDNMLEPS 725
            SG  G N+ E S
Sbjct: 390 CSGLTGANIKEQS 402


>AK001303-1|BAA91612.1|  628|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10441 fis, clone NT2RP1000733, highly similar to
           Human mRNA for GSPT1-TK protein. ).
          Length = 628

 Score =  127 bits (307), Expect = 4e-29
 Identities = 60/135 (44%), Positives = 87/135 (64%)
 Frame = +1

Query: 106 PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLG 285
           P    +K H+N+V IGHVD+GKST  G +++  G +DKRT+EK+E+EA+E  ++   +  
Sbjct: 195 PSGAPKKEHVNVVFIGHVDAGKSTIGGQIMFLTGMVDKRTLEKYEREAKEKNRETWYLSW 254

Query: 286 YWTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAA 465
                +     G T+++    FET + + TI+DAPGH+ F+ NMI G SQAD AVL+++A
Sbjct: 255 ALDTNQEERDKGKTVEVGRAYFETERKHFTILDAPGHKGFVPNMIGGASQADLAVLVISA 314

Query: 466 GTGEFEAGISKNGQT 510
             GEFE G  K GQT
Sbjct: 315 RKGEFETGFEKGGQT 329



 Score = 67.7 bits (158), Expect = 4e-11
 Identities = 34/73 (46%), Positives = 49/73 (67%), Gaps = 1/73 (1%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAA-VAFVP 686
           REHA+LA T GVK LIV +NKMD     +S  R+EE K+++  ++KK+G++P   + F+P
Sbjct: 330 REHAMLAKTAGVKHLIVLINKMDDPTVNWSIERYEECKEKLVPFLKKVGFSPKKDIHFMP 389

Query: 687 ISGWHGDNMLEPS 725
            SG  G N+ E S
Sbjct: 390 CSGLTGANIKEQS 402


>BC070131-1|AAH70131.1|  111|Homo sapiens EEF1A1 protein protein.
          Length = 111

 Score =  125 bits (302), Expect = 1e-28
 Identities = 62/86 (72%), Positives = 65/86 (75%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYY 369
              +     GITIDI+LWKFETSK +
Sbjct: 61  DKLKAERERGITIDISLWKFETSKQW 86


>BC070500-1|AAH70500.1|   67|Homo sapiens EEF1A1 protein protein.
          Length = 67

 Score =  106 bits (255), Expect = 7e-23
 Identities = 49/54 (90%), Positives = 50/54 (92%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPS 273
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  + PS
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGRSPS 54


>BC094687-1|AAH94687.1|  308|Homo sapiens EEF1A1 protein protein.
          Length = 308

 Score =   99 bits (238), Expect = 8e-21
 Identities = 44/54 (81%), Positives = 48/54 (88%)
 Frame = +3

Query: 573 MDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKM 734
           MDSTEPPYS+ R+EEI KEVS+YIKKIGYNP  VAFVPISGW+GDNMLEPS  M
Sbjct: 1   MDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANM 54


>BC063511-1|AAH63511.1|  290|Homo sapiens EEF1A1 protein protein.
          Length = 290

 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 30/36 (83%), Positives = 32/36 (88%)
 Frame = +3

Query: 627 EVSSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKM 734
           EVS+YIKKIGYNP  VAFVPISGW+GDNMLEPS  M
Sbjct: 1   EVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANM 36


>X84694-1|CAA59169.1|  452|Homo sapiens mitochondrial elongation
           factor Tu protein.
          Length = 452

 Score = 66.5 bits (155), Expect = 9e-11
 Identities = 40/122 (32%), Positives = 63/122 (51%), Gaps = 3/122 (2%)
 Frame = +1

Query: 118 KEKTHINIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGY 288
           ++K H+N+  IGHVD GK+T T     ++ + GG   +  E+ +   +E  +        
Sbjct: 53  RDKPHVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERAR-------- 104

Query: 289 WTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 468
                     GITI+ A  ++ T+  +    D PGH D++KNMITGT+  D  +L+VAA 
Sbjct: 105 ----------GITINAAHVEYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAAN 154

Query: 469 TG 474
            G
Sbjct: 155 DG 156



 Score = 33.5 bits (73), Expect = 0.80
 Identities = 17/50 (34%), Positives = 28/50 (56%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGY 659
           REH LLA  +GV+ ++V VNK D+ +        E ++ E+   + + GY
Sbjct: 162 REHLLLARQIGVEHVVVYVNKADAVQ---DSEMVELVELEIRELLTEFGY 208


>S75463-1|AAC60647.1|  452|Homo sapiens P43 protein.
          Length = 452

 Score = 66.5 bits (155), Expect = 9e-11
 Identities = 40/122 (32%), Positives = 63/122 (51%), Gaps = 3/122 (2%)
 Frame = +1

Query: 118 KEKTHINIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGY 288
           ++K H+N+  IGHVD GK+T T     ++ + GG   +  E+ +   +E  +        
Sbjct: 56  RDKPHVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERAR-------- 107

Query: 289 WTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 468
                     GITI+ A  ++ T+  +    D PGH D++KNMITGT+  D  +L+VAA 
Sbjct: 108 ----------GITINAAHVEYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAAN 157

Query: 469 TG 474
            G
Sbjct: 158 DG 159



 Score = 31.9 bits (69), Expect = 2.5
 Identities = 17/50 (34%), Positives = 28/50 (56%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGY 659
           REH LLA  +GV+ ++V VNK D+ +        E ++ E+   + + GY
Sbjct: 165 REHLLLARQIGVEHVVVYVNKADAVQDS------EMVELEIRELLTEFGY 208


>L38995-1|AAB00499.1|  452|Homo sapiens elongation factor Tu
           protein.
          Length = 452

 Score = 66.5 bits (155), Expect = 9e-11
 Identities = 40/122 (32%), Positives = 63/122 (51%), Gaps = 3/122 (2%)
 Frame = +1

Query: 118 KEKTHINIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGY 288
           ++K H+N+  IGHVD GK+T T     ++ + GG   +  E+ +   +E  +        
Sbjct: 53  RDKPHVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERAR-------- 104

Query: 289 WTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 468
                     GITI+ A  ++ T+  +    D PGH D++KNMITGT+  D  +L+VAA 
Sbjct: 105 ----------GITINAAHVEYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAAN 154

Query: 469 TG 474
            G
Sbjct: 155 DG 156



 Score = 33.5 bits (73), Expect = 0.80
 Identities = 17/50 (34%), Positives = 28/50 (56%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGY 659
           REH LLA  +GV+ ++V VNK D+ +        E ++ E+   + + GY
Sbjct: 162 REHLLLARQIGVEHVVVYVNKADAVQ---DSEMVELVELEIRELLTEFGY 208


>BC010041-1|AAH10041.2|  455|Homo sapiens Tu translation elongation
           factor, mitochondrial protein.
          Length = 455

 Score = 66.5 bits (155), Expect = 9e-11
 Identities = 40/122 (32%), Positives = 63/122 (51%), Gaps = 3/122 (2%)
 Frame = +1

Query: 118 KEKTHINIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGY 288
           ++K H+N+  IGHVD GK+T T     ++ + GG   +  E+ +   +E  +        
Sbjct: 56  RDKPHVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERAR-------- 107

Query: 289 WTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 468
                     GITI+ A  ++ T+  +    D PGH D++KNMITGT+  D  +L+VAA 
Sbjct: 108 ----------GITINAAHVEYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAAN 157

Query: 469 TG 474
            G
Sbjct: 158 DG 159



 Score = 33.5 bits (73), Expect = 0.80
 Identities = 17/50 (34%), Positives = 28/50 (56%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGY 659
           REH LLA  +GV+ ++V VNK D+ +        E ++ E+   + + GY
Sbjct: 165 REHLLLARQIGVEHVVVYVNKADAVQ---DSEMVELVELEIRELLTEFGY 211


>BC001633-1|AAH01633.2|  455|Homo sapiens Tu translation elongation
           factor, mitochondrial protein.
          Length = 455

 Score = 66.5 bits (155), Expect = 9e-11
 Identities = 40/122 (32%), Positives = 63/122 (51%), Gaps = 3/122 (2%)
 Frame = +1

Query: 118 KEKTHINIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGY 288
           ++K H+N+  IGHVD GK+T T     ++ + GG   +  E+ +   +E  +        
Sbjct: 56  RDKPHVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERAR-------- 107

Query: 289 WTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 468
                     GITI+ A  ++ T+  +    D PGH D++KNMITGT+  D  +L+VAA 
Sbjct: 108 ----------GITINAAHVEYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAAN 157

Query: 469 TG 474
            G
Sbjct: 158 DG 159



 Score = 33.5 bits (73), Expect = 0.80
 Identities = 17/50 (34%), Positives = 28/50 (56%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGY 659
           REH LLA  +GV+ ++V VNK D+ +        E ++ E+   + + GY
Sbjct: 165 REHLLLARQIGVEHVVVYVNKADAVQ---DSEMVELVELEIRELLTEFGY 211


>BC014377-1|AAH14377.1|  287|Homo sapiens Unknown (protein for
           IMAGE:4041545) protein.
          Length = 287

 Score = 63.7 bits (148), Expect = 7e-10
 Identities = 27/32 (84%), Positives = 28/32 (87%)
 Frame = +3

Query: 639 YIKKIGYNPAAVAFVPISGWHGDNMLEPSTKM 734
           YIKKIGYNP  VAFVPISGW+GDNMLEPS  M
Sbjct: 2   YIKKIGYNPDTVAFVPISGWNGDNMLEPSANM 33


>AL445190-4|CAI95162.1|  453|Homo sapiens HBS1-like (S. cerevisiae)
           protein.
          Length = 453

 Score = 59.3 bits (137), Expect = 1e-08
 Identities = 24/44 (54%), Positives = 36/44 (81%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQE 255
           K  +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++
Sbjct: 258 KQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKK 301



 Score = 34.7 bits (76), Expect = 0.35
 Identities = 17/34 (50%), Positives = 21/34 (61%)
 Frame = +3

Query: 216 QTYHREVREGGPGMGKGSFKYAWVLDKLKAERER 317
           +T H+  +E     GK SF YAWVLD+   ERER
Sbjct: 290 RTMHKYEQESKKA-GKASFAYAWVLDETGEERER 322


>AL353596-1|CAI17913.1|  453|Homo sapiens HBS1-like (S. cerevisiae)
           protein.
          Length = 453

 Score = 59.3 bits (137), Expect = 1e-08
 Identities = 24/44 (54%), Positives = 36/44 (81%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQE 255
           K  +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++
Sbjct: 258 KQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKK 301



 Score = 34.7 bits (76), Expect = 0.35
 Identities = 17/34 (50%), Positives = 21/34 (61%)
 Frame = +3

Query: 216 QTYHREVREGGPGMGKGSFKYAWVLDKLKAERER 317
           +T H+  +E     GK SF YAWVLD+   ERER
Sbjct: 290 RTMHKYEQESKKA-GKASFAYAWVLDETGEERER 322


>BC030612-1|AAH30612.1|  777|Homo sapiens G elongation factor,
           mitochondrial 2 protein.
          Length = 777

 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 34/113 (30%), Positives = 50/113 (44%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NI ++ H+D+GK+TTT  ++Y  G         + +   + V D   +  +    R    
Sbjct: 72  NIGIMAHIDAGKTTTTERILYYSG---------YTRSLGD-VDDGDTVTDFMAQER---E 118

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
            GITI  A   F+   Y V +ID PGH DF   +       D AV +  A  G
Sbjct: 119 RGITIQSAAVTFDWKGYRVNLIDTPGHVDFTLEVERCLRVLDGAVAVFDASAG 171


>BC015712-1|AAH15712.1|  779|Homo sapiens GFM2 protein protein.
          Length = 779

 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 34/113 (30%), Positives = 50/113 (44%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NI ++ H+D+GK+TTT  ++Y  G         + +   + V D   +  +    R    
Sbjct: 72  NIGIMAHIDAGKTTTTERILYYSG---------YTRSLGD-VDDGDTVTDFMAQER---E 118

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
            GITI  A   F+   Y V +ID PGH DF   +       D AV +  A  G
Sbjct: 119 RGITIQSAAVTFDWKGYRVNLIDTPGHVDFTLEVERCLRVLDGAVAVFDASAG 171


>AY453587-1|AAS49035.1|  531|Homo sapiens elongation factor G
           isoform protein.
          Length = 531

 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 34/113 (30%), Positives = 50/113 (44%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NI ++ H+D+GK+TTT  ++Y  G         + +   + V D   +  +    R    
Sbjct: 72  NIGIMAHIDAGKTTTTERILYYSG---------YTRSLGD-VDDGDTVTDFMAQER---E 118

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
            GITI  A   F+   Y V +ID PGH DF   +       D AV +  A  G
Sbjct: 119 RGITIQSAAVTFDWKGYRVNLIDTPGHVDFTLEVERCLRVLDGAVAVFDASAG 171


>AK025314-1|BAB15109.1|  513|Homo sapiens protein ( Homo sapiens
           cDNA: FLJ21661 fis, clone COL08837. ).
          Length = 513

 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 34/113 (30%), Positives = 50/113 (44%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NI ++ H+D+GK+TTT  ++Y  G         + +   + V D   +  +    R    
Sbjct: 72  NIGIMAHIDAGKTTTTERILYYSG---------YTRSLGD-VDDGDTVTDFMAQER---E 118

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
            GITI  A   F+   Y V +ID PGH DF   +       D AV +  A  G
Sbjct: 119 RGITIQSAAVTFDWKGYRVNLIDTPGHVDFTLEVERCLRVLDGAVAVFDASAG 171


>AF367997-1|AAK53401.1|  779|Homo sapiens elongation factor G2
           protein.
          Length = 779

 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 34/113 (30%), Positives = 50/113 (44%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NI ++ H+D+GK+TTT  ++Y  G         + +   + V D   +  +    R    
Sbjct: 72  NIGIMAHIDAGKTTTTERILYYSG---------YTRSLGD-VDDGDTVTDFMAQER---E 118

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
            GITI  A   F+   Y V +ID PGH DF   +       D AV +  A  G
Sbjct: 119 RGITIQSAAVTFDWKGYRVNLIDTPGHVDFTLEVERCLRVLDGAVAVFDASAG 171


>AF111808-1|AAL39010.1|  732|Homo sapiens MSTP027 protein.
          Length = 732

 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 34/113 (30%), Positives = 50/113 (44%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NI ++ H+D+GK+TTT  ++Y  G         + +   + V D   +  +    R    
Sbjct: 72  NIGIMAHIDAGKTTTTERILYYSG---------YTRSLGD-VDDGDTVTDFMAQER---E 118

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
            GITI  A   F+   Y V +ID PGH DF   +       D AV +  A  G
Sbjct: 119 RGITIQSAAVTFDWKGYRVNLIDTPGHVDFTLEVERCLRVLDGAVAVFDASAG 171


>BC049210-1|AAH49210.1|  751|Homo sapiens G elongation factor,
           mitochondrial 1 protein.
          Length = 751

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 35/113 (30%), Positives = 46/113 (40%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NI +  H+DSGK+T T  ++Y  G I K             VK    +     +  L   
Sbjct: 48  NIGISAHIDSGKTTLTERVLYYTGRIAK----------MHEVKGKDGVGAVMDSMELERQ 97

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
            GITI  A          + IID PGH DF   +       D AVL++ A  G
Sbjct: 98  RGITIQSAATYTMWKDVNINIIDTPGHVDFTIEVERALRVLDGAVLVLCAVGG 150


>AF367998-1|AAK53402.1|  751|Homo sapiens elongation factor G1
           protein.
          Length = 751

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 35/113 (30%), Positives = 46/113 (40%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NI +  H+DSGK+T T  ++Y  G I K             VK    +     +  L   
Sbjct: 48  NIGISAHIDSGKTTLTERVLYYTGRIAK----------MHEVKGKDGVGAVMDSMELERQ 97

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
            GITI  A          + IID PGH DF   +       D AVL++ A  G
Sbjct: 98  RGITIQSAATYTMWKDVNINIIDTPGHVDFTIEVERALRVLDGAVLVLCAVGG 150


>AF309777-1|AAK58877.1|  751|Homo sapiens elongation factor G
           protein.
          Length = 751

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 35/113 (30%), Positives = 46/113 (40%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NI +  H+DSGK+T T  ++Y  G I K             VK    +     +  L   
Sbjct: 48  NIGISAHIDSGKTTLTERVLYYTGRIAK----------MHEVKGKDGVGAVMDSMELERQ 97

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
            GITI  A          + IID PGH DF   +       D AVL++ A  G
Sbjct: 98  RGITIQSAATYTMWKDVNINIIDTPGHVDFTIEVERALRVLDGAVLVLCAVGG 150


>AK023282-1|BAB14507.1|  669|Homo sapiens protein ( Homo sapiens
           cDNA FLJ13220 fis, clone NT2RP4002047, moderately
           similar to GTP-BINDING PROTEIN LEPA. ).
          Length = 669

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 31/113 (27%), Positives = 47/113 (41%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           N  ++ HVD GKST T  L+   G IDK    K  K+  + ++               ++
Sbjct: 70  NFSIVAHVDHGKSTLTDRLLELTGTIDKT---KNNKQVLDKLQVERER---------GIT 117

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           V        +  E  +Y + +ID PGH DF   +    S     +L+V A  G
Sbjct: 118 VKAQTASLFYNCEGKQYLLNLIDTPGHVDFSYEVSRSLSACQGVLLVVDANEG 170


>Z11692-1|CAA77750.1|  858|Homo sapiens human  elongation factor 2
           protein.
          Length = 858

 Score = 39.9 bits (89), Expect = 0.009
 Identities = 32/124 (25%), Positives = 55/124 (44%), Gaps = 3/124 (2%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           M K+    N+ VI HVD GKST T  L+ K G I   +    E    +  KD        
Sbjct: 13  MDKKANIRNMSVIAHVDHGKSTLTDSLVCKAGII--ASARAGETRFTDTRKDEQERCITI 70

Query: 292 TN*RLSVSVGIT---IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVA 462
            +  +S+   ++   ++      + + + + +ID+PGH DF   +       D A+++V 
Sbjct: 71  KSTAISLFYELSENDLNFIKQSKDGAGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVD 130

Query: 463 AGTG 474
             +G
Sbjct: 131 CVSG 134


>X51466-1|CAA35829.1|  858|Homo sapiens elongation factor 2 protein.
          Length = 858

 Score = 39.9 bits (89), Expect = 0.009
 Identities = 32/124 (25%), Positives = 55/124 (44%), Gaps = 3/124 (2%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           M K+    N+ VI HVD GKST T  L+ K G I   +    E    +  KD        
Sbjct: 13  MDKKANIRNMSVIAHVDHGKSTLTDSLVCKAGII--ASARAGETRFTDTRKDEQERCITI 70

Query: 292 TN*RLSVSVGIT---IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVA 462
            +  +S+   ++   ++      + + + + +ID+PGH DF   +       D A+++V 
Sbjct: 71  KSTAISLFYELSENDLNFIKQSKDGAGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVD 130

Query: 463 AGTG 474
             +G
Sbjct: 131 CVSG 134


>BC126259-1|AAI26260.1|  858|Homo sapiens EEF2 protein protein.
          Length = 858

 Score = 39.9 bits (89), Expect = 0.009
 Identities = 32/124 (25%), Positives = 55/124 (44%), Gaps = 3/124 (2%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           M K+    N+ VI HVD GKST T  L+ K G I   +    E    +  KD        
Sbjct: 13  MDKKANIRNMSVIAHVDHGKSTLTDSLVCKAGII--ASARAGETRFTDTRKDEQERCITI 70

Query: 292 TN*RLSVSVGIT---IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVA 462
            +  +S+   ++   ++      + + + + +ID+PGH DF   +       D A+++V 
Sbjct: 71  KSTAISLFYELSENDLNFIKQSKDGAGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVD 130

Query: 463 AGTG 474
             +G
Sbjct: 131 CVSG 134


>BC006547-1|AAH06547.1|  583|Homo sapiens EEF2 protein protein.
          Length = 583

 Score = 39.9 bits (89), Expect = 0.009
 Identities = 32/124 (25%), Positives = 55/124 (44%), Gaps = 3/124 (2%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           M K+    N+ VI HVD GKST T  L+ K G I   +    E    +  KD        
Sbjct: 13  MDKKANIRNMSVIAHVDHGKSTLTDSLVCKAGII--ASARAGETRFTDTRKDEQERCITI 70

Query: 292 TN*RLSVSVGIT---IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVA 462
            +  +S+   ++   ++      + + + + +ID+PGH DF   +       D A+++V 
Sbjct: 71  KSTAISLFYELSENDLNFIKQSKDGAGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVD 130

Query: 463 AGTG 474
             +G
Sbjct: 131 CVSG 134


>AY942181-1|AAX34409.1|  858|Homo sapiens elongation factor 2
           protein.
          Length = 858

 Score = 39.9 bits (89), Expect = 0.009
 Identities = 32/124 (25%), Positives = 55/124 (44%), Gaps = 3/124 (2%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           M K+    N+ VI HVD GKST T  L+ K G I   +    E    +  KD        
Sbjct: 13  MDKKANIRNMSVIAHVDHGKSTLTDSLVCKAGII--ASARAGETRFTDTRKDEQERCITI 70

Query: 292 TN*RLSVSVGIT---IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVA 462
            +  +S+   ++   ++      + + + + +ID+PGH DF   +       D A+++V 
Sbjct: 71  KSTAISLFYELSENDLNFIKQSKDGAGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVD 130

Query: 463 AGTG 474
             +G
Sbjct: 131 CVSG 134


>BC036768-1|AAH36768.1|  669|Homo sapiens GUF1 GTPase homolog (S.
           cerevisiae) protein.
          Length = 669

 Score = 39.1 bits (87), Expect = 0.016
 Identities = 30/113 (26%), Positives = 46/113 (40%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           N  ++ HVD GKST    L+   G IDK    K  K+  + ++               ++
Sbjct: 70  NFSIVAHVDHGKSTLADRLLELTGTIDKT---KNNKQVLDKLQVERER---------GIT 117

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           V        +  E  +Y + +ID PGH DF   +    S     +L+V A  G
Sbjct: 118 VKAQTASLFYNCEGKQYLLNLIDTPGHVDFSYEVSRSLSACQGVLLVVDANEG 170


>L34600-1|AAA67038.1|  727|Homo sapiens initiation factor 2 protein.
          Length = 727

 Score = 31.5 bits (68), Expect = 3.2
 Identities = 14/35 (40%), Positives = 17/35 (48%)
 Frame = +1

Query: 370 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           +T +D PGH  F      G    D  VL+VAA  G
Sbjct: 230 ITFLDTPGHAAFSAMRARGAQVTDIVVLVVAADDG 264


>BC064977-1|AAH64977.1|  465|Homo sapiens MTIF2 protein protein.
          Length = 465

 Score = 31.5 bits (68), Expect = 3.2
 Identities = 14/35 (40%), Positives = 17/35 (48%)
 Frame = +1

Query: 370 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           +T +D PGH  F      G    D  VL+VAA  G
Sbjct: 230 ITFLDTPGHAAFSAMRARGAQVTDIVVLVVAADDG 264


>BC039848-1|AAH39848.1|  500|Homo sapiens Similar to mitochondrial
           translational initiation factor 2 protein.
          Length = 500

 Score = 31.5 bits (68), Expect = 3.2
 Identities = 14/35 (40%), Positives = 17/35 (48%)
 Frame = +1

Query: 370 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           +T +D PGH  F      G    D  VL+VAA  G
Sbjct: 230 ITFLDTPGHAAFSAMRARGAQVTDIVVLVVAADDG 264


>AF495546-1|AAM70196.1|  727|Homo sapiens translation initiation
           factor 2 protein.
          Length = 727

 Score = 31.5 bits (68), Expect = 3.2
 Identities = 14/35 (40%), Positives = 17/35 (48%)
 Frame = +1

Query: 370 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           +T +D PGH  F      G    D  VL+VAA  G
Sbjct: 230 ITFLDTPGHAAFSAMRARGAQVTDIVVLVVAADDG 264


>AF494407-1|AAM14617.1|  727|Homo sapiens mitochondrial
           translation-initiation factor 2 protein.
          Length = 727

 Score = 31.5 bits (68), Expect = 3.2
 Identities = 14/35 (40%), Positives = 17/35 (48%)
 Frame = +1

Query: 370 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           +T +D PGH  F      G    D  VL+VAA  G
Sbjct: 230 ITFLDTPGHAAFSAMRARGAQVTDIVVLVVAADDG 264


>L19161-1|AAA19696.1|  472|Homo sapiens translation initiation
           factor eIF-2 gamma subunit protein.
          Length = 472

 Score = 31.1 bits (67), Expect = 4.3
 Identities = 11/32 (34%), Positives = 20/32 (62%)
 Frame = +1

Query: 367 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVA 462
           +V+ +D PGH   +  M+ G +  D A+L++A
Sbjct: 129 HVSFVDCPGHDILMATMLNGAAVMDAALLLIA 160


>DQ120619-1|ABB92405.1|  471|Homo sapiens eFI-2-gamma protein.
          Length = 471

 Score = 31.1 bits (67), Expect = 4.3
 Identities = 11/32 (34%), Positives = 20/32 (62%)
 Frame = +1

Query: 367 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVA 462
           +V+ +D PGH   +  M+ G +  D A+L++A
Sbjct: 129 HVSFVDCPGHDILMATMLNGAAVMDAALLLIA 160


>BC087847-1|AAH87847.1|  465|Homo sapiens Unknown (protein for
           IMAGE:30389268) protein.
          Length = 465

 Score = 31.1 bits (67), Expect = 4.3
 Identities = 11/32 (34%), Positives = 20/32 (62%)
 Frame = +1

Query: 367 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVA 462
           +V+ +D PGH   +  M+ G +  D A+L++A
Sbjct: 128 HVSFVDCPGHDILMATMLNGAAVMDAALLLIA 159


>BC019906-1|AAH19906.1|  472|Homo sapiens eukaryotic translation
           initiation factor 2, subunit 3 gamma, 52kDa protein.
          Length = 472

 Score = 31.1 bits (67), Expect = 4.3
 Identities = 11/32 (34%), Positives = 20/32 (62%)
 Frame = +1

Query: 367 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVA 462
           +V+ +D PGH   +  M+ G +  D A+L++A
Sbjct: 129 HVSFVDCPGHDILMATMLNGAAVMDAALLLIA 160


>BC007933-1|AAH07933.1|  569|Homo sapiens EEFSEC protein protein.
          Length = 569

 Score = 31.1 bits (67), Expect = 4.3
 Identities = 12/35 (34%), Positives = 19/35 (54%)
 Frame = +1

Query: 370 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           VT++D PGH   I+ +I G    D  +L++    G
Sbjct: 61  VTLVDCPGHASLIRTIIGGAQIIDLMMLVIDVTKG 95


>AK222577-1|BAD96297.1|  472|Homo sapiens eukaryotic translation
           initiation factor 2, subunit 3 gamma, 52kDa variant
           protein.
          Length = 472

 Score = 31.1 bits (67), Expect = 4.3
 Identities = 11/32 (34%), Positives = 20/32 (62%)
 Frame = +1

Query: 367 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVA 462
           +V+ +D PGH   +  M+ G +  D A+L++A
Sbjct: 129 HVSFVDCPGHDILMATMLNGAAVMDAALLLIA 160


>AJ006932-1|CAA07331.1|  248|Homo sapiens eIF-2gA protein.
          Length = 248

 Score = 31.1 bits (67), Expect = 4.3
 Identities = 11/32 (34%), Positives = 20/32 (62%)
 Frame = +1

Query: 367 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVA 462
           +V+ +D PGH   +  M+ G +  D A+L++A
Sbjct: 69  HVSFVDCPGHDILMATMLNGAAVMDAALLLIA 100


>AF268872-1|AAG13375.1|  526|Homo sapiens MJ0495-like protein SelB
           protein.
          Length = 526

 Score = 31.1 bits (67), Expect = 4.3
 Identities = 12/35 (34%), Positives = 19/35 (54%)
 Frame = +1

Query: 370 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           VT++D PGH   I+ +I G    D  +L++    G
Sbjct: 18  VTLVDCPGHASLIRTIIGGAQIIDLMMLVIDVTKG 52


>AY280362-1|AAP35084.1| 2386|Homo sapiens EGF domain-containing
           protein protein.
          Length = 2386

 Score = 30.3 bits (65), Expect = 7.5
 Identities = 14/28 (50%), Positives = 16/28 (57%), Gaps = 1/28 (3%)
 Frame = -3

Query: 274 LKDPLPIPGPPS-RTSRWYVCQYHHICR 194
           L  P P PGPP+ R SR   C +H  CR
Sbjct: 686 LPPPTPAPGPPAPRCSRDCGCSFHSHCR 713


>AB065617-1|BAC05844.1|  528|Homo sapiens seven transmembrane helix
           receptor protein.
          Length = 528

 Score = 30.3 bits (65), Expect = 7.5
 Identities = 11/33 (33%), Positives = 17/33 (51%)
 Frame = -3

Query: 277 YLKDPLPIPGPPSRTSRWYVCQYHHICRSSDQW 179
           Y+  PLP+  P   T  W + + HH+ R+   W
Sbjct: 494 YIYCPLPVRSPGMPTGWWSLLRGHHVARAGLPW 526


>AB011541-1|BAA32469.2| 2785|Homo sapiens MEGF8 protein.
          Length = 2785

 Score = 30.3 bits (65), Expect = 7.5
 Identities = 14/28 (50%), Positives = 16/28 (57%), Gaps = 1/28 (3%)
 Frame = -3

Query: 274  LKDPLPIPGPPS-RTSRWYVCQYHHICR 194
            L  P P PGPP+ R SR   C +H  CR
Sbjct: 1085 LPPPTPAPGPPAPRCSRDCGCSFHSHCR 1112


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 112,437,166
Number of Sequences: 237096
Number of extensions: 2425580
Number of successful extensions: 5468
Number of sequences better than 10.0: 115
Number of HSP's better than 10.0 without gapping: 4998
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5340
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8735159784
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -