SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20024
         (560 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X79198-1|CAA55790.1| 1938|Homo sapiens host cell factor protein.       32   1.6  
BC030560-1|AAH30560.1|  551|Homo sapiens HCFC1 protein protein.        32   1.6  
BC019887-1|AAH19887.1|  551|Homo sapiens Unknown (protein for IM...    32   1.6  
AL353708-3|CAI41052.1|  295|Homo sapiens torsin A interacting pr...    32   1.6  
U80746-1|AAB91444.1|  358|Homo sapiens CAGH4 protein.                  31   2.1  
BC104758-1|AAI04759.1|  465|Homo sapiens trinucleotide repeat co...    31   2.1  
BC068008-1|AAH68008.1|  407|Homo sapiens TNRC4 protein protein.        31   2.1  
AY165003-1|AAN73884.1|  465|Homo sapiens CUG-BP and ETR-3 like f...    31   2.1  
AL589765-5|CAI17168.1|  465|Homo sapiens trinucleotide repeat co...    31   2.1  
AL589765-3|CAI17166.1|  465|Homo sapiens trinucleotide repeat co...    31   2.1  
AF329264-1|AAK07474.1|  462|Homo sapiens CUG-BP and ETR-3 like f...    31   2.1  
AB209264-1|BAD92501.1|  441|Homo sapiens trinucleotide repeat co...    31   2.1  
Z34278-1|CAA84032.1|  279|Homo sapiens mucin protein.                  31   2.8  
BC010738-1|AAH10738.2|  490|Homo sapiens TMEM112 protein protein.      30   4.8  
AK025955-1|BAB15295.1|  458|Homo sapiens protein ( Homo sapiens ...    30   4.8  
AK022743-1|BAB14218.1|  567|Homo sapiens protein ( Homo sapiens ...    30   4.8  
AE006465-5|AAK61259.1|  567|Homo sapiens possible integral membr...    30   4.8  
AB075873-1|BAD38655.1|  563|Homo sapiens putative protein produc...    30   4.8  
U03495-1|AAA21325.1|  450|Homo sapiens transcription factor LSF-...    30   6.4  
U03494-1|AAA21324.1|  502|Homo sapiens transcription factor LSF ...    30   6.4  
BC021925-1|AAH21925.1|  551|Homo sapiens tripartite motif-contai...    30   6.4  
BC003634-1|AAH03634.1|  502|Homo sapiens transcription factor CP...    30   6.4  
AL391121-3|CAI40861.1|  550|Homo sapiens tripartite motif-contai...    30   6.4  
AF281046-1|AAG53087.1|  551|Homo sapiens glioblastoma-expressed ...    30   6.4  
AF220034-1|AAG53488.1|  551|Homo sapiens tripartite motif protei...    30   6.4  
BC117255-1|AAI17256.1| 1048|Homo sapiens Sin3A-associated protei...    29   8.5  
BC023247-1|AAH23247.1|  462|Homo sapiens TOR1AIP1 protein protein.     29   8.5  
BC017453-1|AAH17453.2|  693|Homo sapiens SAP130 protein protein.       29   8.5  
AY220791-1|AAO63591.1| 1048|Homo sapiens SIN3A-associated protei...    29   8.5  
AL353708-2|CAI41051.1|  497|Homo sapiens torsin A interacting pr...    29   8.5  
AL353708-1|CAI41049.1|  671|Homo sapiens torsin A interacting pr...    29   8.5  
AK055979-1|BAB71063.1|  710|Homo sapiens protein ( Homo sapiens ...    29   8.5  
AK023204-1|BAB14461.1|  462|Homo sapiens protein ( Homo sapiens ...    29   8.5  
AK022823-1|BAB14261.1|  613|Homo sapiens protein ( Homo sapiens ...    29   8.5  
AK021613-1|BAB13855.1|  462|Homo sapiens protein ( Homo sapiens ...    29   8.5  
AC012306-2|AAY14878.1|  732|Homo sapiens unknown protein.              29   8.5  

>X79198-1|CAA55790.1| 1938|Homo sapiens host cell factor protein.
          Length = 1938

 Score = 31.9 bits (69), Expect = 1.6
 Identities = 17/51 (33%), Positives = 22/51 (43%)
 Frame = +3

Query: 330 PAAMSYPGITPAPTAPRGHVTPHGAFGYQSYPYVTPTQSYDTTIEWVPTTP 482
           P+  + P  +PAP A    V P    G    P   P     TTI+ +PT P
Sbjct: 319 PSVPANPPKSPAPAAAAPAVQPLTQVGITLLPQAAPAPPTTTTIQVLPTVP 369


>BC030560-1|AAH30560.1|  551|Homo sapiens HCFC1 protein protein.
          Length = 551

 Score = 31.9 bits (69), Expect = 1.6
 Identities = 17/51 (33%), Positives = 22/51 (43%)
 Frame = +3

Query: 330 PAAMSYPGITPAPTAPRGHVTPHGAFGYQSYPYVTPTQSYDTTIEWVPTTP 482
           P+  + P  +PAP A    V P    G    P   P     TTI+ +PT P
Sbjct: 418 PSVPANPPKSPAPAAAAPAVQPLTQVGITLLPQAAPAPPTTTTIQVLPTVP 468


>BC019887-1|AAH19887.1|  551|Homo sapiens Unknown (protein for
           IMAGE:5142023) protein.
          Length = 551

 Score = 31.9 bits (69), Expect = 1.6
 Identities = 17/51 (33%), Positives = 22/51 (43%)
 Frame = +3

Query: 330 PAAMSYPGITPAPTAPRGHVTPHGAFGYQSYPYVTPTQSYDTTIEWVPTTP 482
           P+  + P  +PAP A    V P    G    P   P     TTI+ +PT P
Sbjct: 418 PSVPANPPKSPAPAAAAPAVQPLTQVGITLLPQAAPAPPTTTTIQVLPTVP 468


>AL353708-3|CAI41052.1|  295|Homo sapiens torsin A interacting
           protein 1 protein.
          Length = 295

 Score = 31.9 bits (69), Expect = 1.6
 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 2/41 (4%)
 Frame = +3

Query: 408 GYQSYP--YVTPTQSYDTTIEWVPTTPQNASILSEKQWWLV 524
           GYQ  P  +   T    T ++ V   PQNAS +   +WWL+
Sbjct: 35  GYQKTPQEWAPQTARIRTRMQKVTGQPQNASFVKRNRWWLL 75


>U80746-1|AAB91444.1|  358|Homo sapiens CAGH4 protein.
          Length = 358

 Score = 31.5 bits (68), Expect = 2.1
 Identities = 15/43 (34%), Positives = 19/43 (44%), Gaps = 2/43 (4%)
 Frame = +3

Query: 330 PAAMSYPGITPAPTAPRGHVTPHGAF--GYQSYPYVTPTQSYD 452
           PAA+   G +P PT P G   P   +  G   YP  +P    D
Sbjct: 167 PAALGVNGYSPVPTQPTGQPAPDALYPNGVHPYPAQSPAAPVD 209


>BC104758-1|AAI04759.1|  465|Homo sapiens trinucleotide repeat
           containing 4 protein.
          Length = 465

 Score = 31.5 bits (68), Expect = 2.1
 Identities = 15/43 (34%), Positives = 19/43 (44%), Gaps = 2/43 (4%)
 Frame = +3

Query: 330 PAAMSYPGITPAPTAPRGHVTPHGAF--GYQSYPYVTPTQSYD 452
           PAA+   G +P PT P G   P   +  G   YP  +P    D
Sbjct: 274 PAALGVNGYSPVPTQPTGQPAPDALYPNGVHPYPAQSPAAPVD 316


>BC068008-1|AAH68008.1|  407|Homo sapiens TNRC4 protein protein.
          Length = 407

 Score = 31.5 bits (68), Expect = 2.1
 Identities = 15/43 (34%), Positives = 19/43 (44%), Gaps = 2/43 (4%)
 Frame = +3

Query: 330 PAAMSYPGITPAPTAPRGHVTPHGAF--GYQSYPYVTPTQSYD 452
           PAA+   G +P PT P G   P   +  G   YP  +P    D
Sbjct: 216 PAALGVNGYSPVPTQPTGQPAPDALYPNGVHPYPAQSPAAPVD 258


>AY165003-1|AAN73884.1|  465|Homo sapiens CUG-BP and ETR-3 like
           factor 3 protein.
          Length = 465

 Score = 31.5 bits (68), Expect = 2.1
 Identities = 15/43 (34%), Positives = 19/43 (44%), Gaps = 2/43 (4%)
 Frame = +3

Query: 330 PAAMSYPGITPAPTAPRGHVTPHGAF--GYQSYPYVTPTQSYD 452
           PAA+   G +P PT P G   P   +  G   YP  +P    D
Sbjct: 274 PAALGVNGYSPVPTQPTGQPAPDALYPNGVHPYPAQSPVAPVD 316


>AL589765-5|CAI17168.1|  465|Homo sapiens trinucleotide repeat
           containing 4 protein.
          Length = 465

 Score = 31.5 bits (68), Expect = 2.1
 Identities = 15/43 (34%), Positives = 19/43 (44%), Gaps = 2/43 (4%)
 Frame = +3

Query: 330 PAAMSYPGITPAPTAPRGHVTPHGAF--GYQSYPYVTPTQSYD 452
           PAA+   G +P PT P G   P   +  G   YP  +P    D
Sbjct: 274 PAALGVNGYSPVPTQPTGQPAPDALYPNGVHPYPAQSPAAPVD 316


>AL589765-3|CAI17166.1|  465|Homo sapiens trinucleotide repeat
           containing 4 protein.
          Length = 465

 Score = 31.5 bits (68), Expect = 2.1
 Identities = 15/43 (34%), Positives = 19/43 (44%), Gaps = 2/43 (4%)
 Frame = +3

Query: 330 PAAMSYPGITPAPTAPRGHVTPHGAF--GYQSYPYVTPTQSYD 452
           PAA+   G +P PT P G   P   +  G   YP  +P    D
Sbjct: 274 PAALGVNGYSPVPTQPTGQPAPDALYPNGVHPYPAQSPAAPVD 316


>AF329264-1|AAK07474.1|  462|Homo sapiens CUG-BP and ETR-3 like
           factor 3 protein.
          Length = 462

 Score = 31.5 bits (68), Expect = 2.1
 Identities = 15/43 (34%), Positives = 19/43 (44%), Gaps = 2/43 (4%)
 Frame = +3

Query: 330 PAAMSYPGITPAPTAPRGHVTPHGAF--GYQSYPYVTPTQSYD 452
           PAA+   G +P PT P G   P   +  G   YP  +P    D
Sbjct: 274 PAALGVNGYSPVPTQPTGQPAPDALYPNGVHPYPAQSPVAPVD 316


>AB209264-1|BAD92501.1|  441|Homo sapiens trinucleotide repeat
           containing 4 variant protein.
          Length = 441

 Score = 31.5 bits (68), Expect = 2.1
 Identities = 15/43 (34%), Positives = 19/43 (44%), Gaps = 2/43 (4%)
 Frame = +3

Query: 330 PAAMSYPGITPAPTAPRGHVTPHGAF--GYQSYPYVTPTQSYD 452
           PAA+   G +P PT P G   P   +  G   YP  +P    D
Sbjct: 250 PAALGVNGYSPVPTQPTGQPAPDALYPNGVHPYPAQSPAAPVD 292


>Z34278-1|CAA84032.1|  279|Homo sapiens mucin protein.
          Length = 279

 Score = 31.1 bits (67), Expect = 2.8
 Identities = 20/54 (37%), Positives = 26/54 (48%)
 Frame = +3

Query: 342 SYPGITPAPTAPRGHVTPHGAFGYQSYPYVTPTQSYDTTIEWVPTTPQNASILS 503
           S PG TP+P  P    T        S P  TP+    T+I  VPTT  N++ +S
Sbjct: 130 SGPGTTPSPV-PTTSTTSAPTTSTTSGPGTTPSAVPTTSITSVPTTSTNSAPIS 182


>BC010738-1|AAH10738.2|  490|Homo sapiens TMEM112 protein protein.
          Length = 490

 Score = 30.3 bits (65), Expect = 4.8
 Identities = 11/27 (40%), Positives = 17/27 (62%)
 Frame = +2

Query: 137 YRNRKCLDIHTETQIIPHPKDQFTHRS 217
           +R+  C+D H ETQ +P+P   + H S
Sbjct: 155 WRDLTCMDFHYETQPMPNPVAYYLHHS 181


>AK025955-1|BAB15295.1|  458|Homo sapiens protein ( Homo sapiens
           cDNA: FLJ22302 fis, clone HRC04795. ).
          Length = 458

 Score = 30.3 bits (65), Expect = 4.8
 Identities = 11/27 (40%), Positives = 17/27 (62%)
 Frame = +2

Query: 137 YRNRKCLDIHTETQIIPHPKDQFTHRS 217
           +R+  C+D H ETQ +P+P   + H S
Sbjct: 123 WRDLTCMDFHYETQPMPNPVAYYLHHS 149


>AK022743-1|BAB14218.1|  567|Homo sapiens protein ( Homo sapiens
           cDNA FLJ12681 fis, clone NT2RM4002446. ).
          Length = 567

 Score = 30.3 bits (65), Expect = 4.8
 Identities = 11/27 (40%), Positives = 17/27 (62%)
 Frame = +2

Query: 137 YRNRKCLDIHTETQIIPHPKDQFTHRS 217
           +R+  C+D H ETQ +P+P   + H S
Sbjct: 232 WRDLTCMDFHYETQPMPNPVAYYLHHS 258


>AE006465-5|AAK61259.1|  567|Homo sapiens possible integral membrane
           protein.
          Length = 567

 Score = 30.3 bits (65), Expect = 4.8
 Identities = 11/27 (40%), Positives = 17/27 (62%)
 Frame = +2

Query: 137 YRNRKCLDIHTETQIIPHPKDQFTHRS 217
           +R+  C+D H ETQ +P+P   + H S
Sbjct: 232 WRDLTCMDFHYETQPMPNPVAYYLHHS 258


>AB075873-1|BAD38655.1|  563|Homo sapiens putative protein product
           of HMFN1876 protein.
          Length = 563

 Score = 30.3 bits (65), Expect = 4.8
 Identities = 11/27 (40%), Positives = 17/27 (62%)
 Frame = +2

Query: 137 YRNRKCLDIHTETQIIPHPKDQFTHRS 217
           +R+  C+D H ETQ +P+P   + H S
Sbjct: 228 WRDLTCMDFHYETQPMPNPVAYYLHHS 254


>U03495-1|AAA21325.1|  450|Homo sapiens transcription factor LSF-ID
           protein.
          Length = 450

 Score = 29.9 bits (64), Expect = 6.4
 Identities = 14/34 (41%), Positives = 22/34 (64%)
 Frame = +3

Query: 12  LNK*RSISLRYLPNRKVGSLNSLFWAVIK*VFRV 113
           LN+ +S  +R L NRK+G L  +   ++K +FRV
Sbjct: 89  LNQGQSYEIRMLDNRKLGELPEINGKLVKSIFRV 122


>U03494-1|AAA21324.1|  502|Homo sapiens transcription factor LSF
           protein.
          Length = 502

 Score = 29.9 bits (64), Expect = 6.4
 Identities = 14/34 (41%), Positives = 22/34 (64%)
 Frame = +3

Query: 12  LNK*RSISLRYLPNRKVGSLNSLFWAVIK*VFRV 113
           LN+ +S  +R L NRK+G L  +   ++K +FRV
Sbjct: 89  LNQGQSYEIRMLDNRKLGELPEINGKLVKSIFRV 122


>BC021925-1|AAH21925.1|  551|Homo sapiens tripartite
           motif-containing 8 protein.
          Length = 551

 Score = 29.9 bits (64), Expect = 6.4
 Identities = 22/80 (27%), Positives = 31/80 (38%), Gaps = 10/80 (12%)
 Frame = +3

Query: 306 PGYSLGQQPAAMSYPG----ITPAPTAPRGHVTPHGAFGYQSYP------YVTPTQSYDT 455
           P  S  QQP    Y G    +          V  HG  G+Q YP      +  P+Q Y  
Sbjct: 447 PNGSAAQQPMLPQYGGRKILVCSVDNCYCSSVANHG--GHQPYPRSGHFPWTVPSQEYSH 504

Query: 456 TIEWVPTTPQNASILSEKQW 515
            +   P+ PQ+   L+ + W
Sbjct: 505 PLPPTPSVPQSLPSLAVRDW 524


>BC003634-1|AAH03634.1|  502|Homo sapiens transcription factor CP2
           protein.
          Length = 502

 Score = 29.9 bits (64), Expect = 6.4
 Identities = 14/34 (41%), Positives = 22/34 (64%)
 Frame = +3

Query: 12  LNK*RSISLRYLPNRKVGSLNSLFWAVIK*VFRV 113
           LN+ +S  +R L NRK+G L  +   ++K +FRV
Sbjct: 89  LNQGQSYEIRMLDNRKLGELPEINGKLVKSIFRV 122


>AL391121-3|CAI40861.1|  550|Homo sapiens tripartite
           motif-containing 8 protein.
          Length = 550

 Score = 29.9 bits (64), Expect = 6.4
 Identities = 22/80 (27%), Positives = 31/80 (38%), Gaps = 10/80 (12%)
 Frame = +3

Query: 306 PGYSLGQQPAAMSYPG----ITPAPTAPRGHVTPHGAFGYQSYP------YVTPTQSYDT 455
           P  S  QQP    Y G    +          V  HG  G+Q YP      +  P+Q Y  
Sbjct: 446 PNGSAAQQPMLPQYGGRKILVCSVDNCYCSSVANHG--GHQPYPRSGHFPWTVPSQEYSH 503

Query: 456 TIEWVPTTPQNASILSEKQW 515
            +   P+ PQ+   L+ + W
Sbjct: 504 PLPPTPSVPQSLPSLAVRDW 523


>AF281046-1|AAG53087.1|  551|Homo sapiens glioblastoma-expressed
           RING finger protein GERP protein.
          Length = 551

 Score = 29.9 bits (64), Expect = 6.4
 Identities = 22/80 (27%), Positives = 31/80 (38%), Gaps = 10/80 (12%)
 Frame = +3

Query: 306 PGYSLGQQPAAMSYPG----ITPAPTAPRGHVTPHGAFGYQSYP------YVTPTQSYDT 455
           P  S  QQP    Y G    +          V  HG  G+Q YP      +  P+Q Y  
Sbjct: 447 PNGSAAQQPMLPQYGGRKILVCSVDNCYCSSVANHG--GHQPYPRSGHFPWTVPSQEYSH 504

Query: 456 TIEWVPTTPQNASILSEKQW 515
            +   P+ PQ+   L+ + W
Sbjct: 505 PLPPTPSVPQSLPSLAVRDW 524


>AF220034-1|AAG53488.1|  551|Homo sapiens tripartite motif protein
           TRIM8 protein.
          Length = 551

 Score = 29.9 bits (64), Expect = 6.4
 Identities = 22/80 (27%), Positives = 31/80 (38%), Gaps = 10/80 (12%)
 Frame = +3

Query: 306 PGYSLGQQPAAMSYPG----ITPAPTAPRGHVTPHGAFGYQSYP------YVTPTQSYDT 455
           P  S  QQP    Y G    +          V  HG  G+Q YP      +  P+Q Y  
Sbjct: 447 PNGSAAQQPMLPQYGGRKILVCSVDNCYCSSVANHG--GHQPYPRSGHFPWTVPSQEYSH 504

Query: 456 TIEWVPTTPQNASILSEKQW 515
            +   P+ PQ+   L+ + W
Sbjct: 505 PLPPTPSVPQSLPSLAVRDW 524


>BC117255-1|AAI17256.1| 1048|Homo sapiens Sin3A-associated protein,
           130kDa protein.
          Length = 1048

 Score = 29.5 bits (63), Expect = 8.5
 Identities = 17/40 (42%), Positives = 19/40 (47%), Gaps = 2/40 (5%)
 Frame = +3

Query: 321 GQQPAAMSYPGITPAPTAPRG--HVTPHGAFGYQSYPYVT 434
           G QPA +  PGI PAP   +G    TP    G Q  P  T
Sbjct: 570 GIQPAPIGTPGIQPAPLGTQGIHSATPINTQGLQPAPMGT 609


>BC023247-1|AAH23247.1|  462|Homo sapiens TOR1AIP1 protein protein.
          Length = 462

 Score = 29.5 bits (63), Expect = 8.5
 Identities = 12/28 (42%), Positives = 16/28 (57%)
 Frame = +3

Query: 441 QSYDTTIEWVPTTPQNASILSEKQWWLV 524
           QS  T+   V   PQNAS +   +WWL+
Sbjct: 193 QSPSTSSRQVTGQPQNASFVKRNRWWLL 220


>BC017453-1|AAH17453.2|  693|Homo sapiens SAP130 protein protein.
          Length = 693

 Score = 29.5 bits (63), Expect = 8.5
 Identities = 17/40 (42%), Positives = 19/40 (47%), Gaps = 2/40 (5%)
 Frame = +3

Query: 321 GQQPAAMSYPGITPAPTAPRG--HVTPHGAFGYQSYPYVT 434
           G QPA +  PGI PAP   +G    TP    G Q  P  T
Sbjct: 215 GIQPAPIGTPGIQPAPLGTQGIHSATPINTQGLQPAPMGT 254


>AY220791-1|AAO63591.1| 1048|Homo sapiens SIN3A-associated protein
           130 protein.
          Length = 1048

 Score = 29.5 bits (63), Expect = 8.5
 Identities = 17/40 (42%), Positives = 19/40 (47%), Gaps = 2/40 (5%)
 Frame = +3

Query: 321 GQQPAAMSYPGITPAPTAPRG--HVTPHGAFGYQSYPYVT 434
           G QPA +  PGI PAP   +G    TP    G Q  P  T
Sbjct: 570 GIQPAPIGTPGIQPAPLGTQGIHSATPINTQGLQPAPMGT 609


>AL353708-2|CAI41051.1|  497|Homo sapiens torsin A interacting
           protein 1 protein.
          Length = 497

 Score = 29.5 bits (63), Expect = 8.5
 Identities = 12/28 (42%), Positives = 16/28 (57%)
 Frame = +3

Query: 441 QSYDTTIEWVPTTPQNASILSEKQWWLV 524
           QS  T+   V   PQNAS +   +WWL+
Sbjct: 228 QSPSTSSRQVTGQPQNASFVKRNRWWLL 255


>AL353708-1|CAI41049.1|  671|Homo sapiens torsin A interacting
           protein 1 protein.
          Length = 671

 Score = 29.5 bits (63), Expect = 8.5
 Identities = 12/28 (42%), Positives = 16/28 (57%)
 Frame = +3

Query: 441 QSYDTTIEWVPTTPQNASILSEKQWWLV 524
           QS  T+   V   PQNAS +   +WWL+
Sbjct: 402 QSPSTSSRQVTGQPQNASFVKRNRWWLL 429


>AK055979-1|BAB71063.1|  710|Homo sapiens protein ( Homo sapiens
           cDNA FLJ31417 fis, clone NT2NE2000327, weakly similar to
           GLUCOAMYLASE S1/S2 PRECURSOR (EC 3.2.1.3). ).
          Length = 710

 Score = 29.5 bits (63), Expect = 8.5
 Identities = 17/40 (42%), Positives = 19/40 (47%), Gaps = 2/40 (5%)
 Frame = +3

Query: 321 GQQPAAMSYPGITPAPTAPRG--HVTPHGAFGYQSYPYVT 434
           G QPA +  PGI PAP   +G    TP    G Q  P  T
Sbjct: 543 GIQPAPIGTPGIQPAPLGTQGIHSATPINTQGLQPAPMGT 582


>AK023204-1|BAB14461.1|  462|Homo sapiens protein ( Homo sapiens
           cDNA FLJ13142 fis, clone NT2RP3003212, moderately
           similar to Rattus norvegicus lamina associated
           polypeptide 1C (LAP1C) mRNA. ).
          Length = 462

 Score = 29.5 bits (63), Expect = 8.5
 Identities = 12/28 (42%), Positives = 16/28 (57%)
 Frame = +3

Query: 441 QSYDTTIEWVPTTPQNASILSEKQWWLV 524
           QS  T+   V   PQNAS +   +WWL+
Sbjct: 193 QSPSTSSRQVTGQPQNASFVKRNRWWLL 220


>AK022823-1|BAB14261.1|  613|Homo sapiens protein ( Homo sapiens
           cDNA FLJ12761 fis, clone NT2RP2001378, weakly similar to
           MUCIN 2 PRECURSOR. ).
          Length = 613

 Score = 29.5 bits (63), Expect = 8.5
 Identities = 17/40 (42%), Positives = 19/40 (47%), Gaps = 2/40 (5%)
 Frame = +3

Query: 321 GQQPAAMSYPGITPAPTAPRG--HVTPHGAFGYQSYPYVT 434
           G QPA +  PGI PAP   +G    TP    G Q  P  T
Sbjct: 100 GIQPAPIGTPGIQPAPLGTQGIHSATPINTQGLQPAPMGT 139


>AK021613-1|BAB13855.1|  462|Homo sapiens protein ( Homo sapiens
           cDNA FLJ11551 fis, clone HEMBA1002999, moderately
           similar to Rattus norvegicus lamina associated
           polypeptide 1C (LAP1C) mRNA. ).
          Length = 462

 Score = 29.5 bits (63), Expect = 8.5
 Identities = 12/28 (42%), Positives = 16/28 (57%)
 Frame = +3

Query: 441 QSYDTTIEWVPTTPQNASILSEKQWWLV 524
           QS  T+   V   PQNAS +   +WWL+
Sbjct: 193 QSPSTSSRQVTGQPQNASFVKRNRWWLL 220


>AC012306-2|AAY14878.1|  732|Homo sapiens unknown protein.
          Length = 732

 Score = 29.5 bits (63), Expect = 8.5
 Identities = 17/40 (42%), Positives = 19/40 (47%), Gaps = 2/40 (5%)
 Frame = +3

Query: 321 GQQPAAMSYPGITPAPTAPRG--HVTPHGAFGYQSYPYVT 434
           G QPA +  PGI PAP   +G    TP    G Q  P  T
Sbjct: 254 GIQPAPIGTPGIQPAPLGTQGIHSATPINTQGLQPAPMGT 293


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 89,386,654
Number of Sequences: 237096
Number of extensions: 2027134
Number of successful extensions: 11279
Number of sequences better than 10.0: 36
Number of HSP's better than 10.0 without gapping: 10721
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11273
length of database: 76,859,062
effective HSP length: 86
effective length of database: 56,468,806
effective search space used: 5646880600
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -