SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20022
         (392 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC061890-1|AAH61890.1|  110|Homo sapiens ribosomal protein L35a ...   129   3e-30
BC017093-1|AAH17093.1|  110|Homo sapiens RPL35A protein protein.      129   3e-30
BC010949-1|AAH10949.1|  110|Homo sapiens ribosomal protein L35a ...   129   3e-30
BC001037-1|AAH01037.1|  110|Homo sapiens ribosomal protein L35a ...   129   3e-30
AY871273-1|AAX11429.1|  110|Homo sapiens cell growth-inhibiting ...   129   3e-30
X52966-1|CAA37138.1|  110|Homo sapiens protein ( Human mRNA for ...   126   2e-29
AL365223-3|CAI15713.1|   96|Homo sapiens ribosomal protein L35a ...    86   4e-17
X94619-1|CAA64325.1|   21|Homo sapiens ribosomal protein L35a pr...    36   0.048
AJ579146-1|CAE45400.1|  120|Homo sapiens immunoglobulin heavy ch...    31   1.8  
BC146825-1|AAI46826.1|  517|Homo sapiens FOXN4 protein protein.        29   4.1  
BC121164-1|AAI21165.1|  595|Homo sapiens C14orf101 protein protein.    29   4.1  
BC121163-1|AAI21164.1|  409|Homo sapiens C14orf101 protein protein.    29   4.1  
AF425597-1|AAL23950.1|  218|Homo sapiens forkhead/winged helix t...    29   4.1  
AF425596-1|AAL23949.1|  448|Homo sapiens forkhead/winged helix t...    29   4.1  
BC098586-1|AAH98586.1|  995|Homo sapiens PHLDB1 protein protein.       29   7.2  
AK074070-1|BAB84896.1| 1326|Homo sapiens FLJ00141 protein protein.     29   7.2  
AB177859-1|BAD66837.1| 1125|Homo sapiens KIAA0638 splice variant...    29   7.2  
AB094090-1|BAC76044.1| 1377|Homo sapiens DLNB07 protein.               29   7.2  
AB014538-1|BAA31613.2| 1384|Homo sapiens KIAA0638 protein protein.     29   7.2  
AJ402448-1|CAC15735.1|   90|Homo sapiens immunoglobulin heavy ch...    28   9.5  

>BC061890-1|AAH61890.1|  110|Homo sapiens ribosomal protein L35a
           protein.
          Length = 110

 Score =  129 bits (312), Expect = 3e-30
 Identities = 64/110 (58%), Positives = 77/110 (70%)
 Frame = +2

Query: 8   RLYAKAVFTGYKRGLRNQHENTALLKVEGAKDRNDAVFYAGKHCVYVYRAKKRTPIPGGP 187
           RL++KA+F GYKRGLRNQ E+TALLK+EG   R++  FY GK C YVY+AK  T  PG  
Sbjct: 4   RLWSKAIFAGYKRGLRNQREHTALLKIEGVYARDETEFYLGKRCAYVYKAKNNTVTPG-- 61

Query: 188 RGKKNQAACYLGQGDPPTWQLWRVRAKFKSNLPAQAMGHRIRVMLYPSRI 337
            GK N+     G+          VRAKF+SNLPA+A+GHRIRVMLYPSRI
Sbjct: 62  -GKPNKTRVIWGKVTRAHGNSGMVRAKFRSNLPAKAIGHRIRVMLYPSRI 110


>BC017093-1|AAH17093.1|  110|Homo sapiens RPL35A protein protein.
          Length = 110

 Score =  129 bits (312), Expect = 3e-30
 Identities = 64/110 (58%), Positives = 77/110 (70%)
 Frame = +2

Query: 8   RLYAKAVFTGYKRGLRNQHENTALLKVEGAKDRNDAVFYAGKHCVYVYRAKKRTPIPGGP 187
           RL++KA+F GYKRGLRNQ E+TALLK+EG   R++  FY GK C YVY+AK  T  PG  
Sbjct: 4   RLWSKAIFAGYKRGLRNQREHTALLKIEGVYARDETEFYLGKRCAYVYKAKNNTVTPG-- 61

Query: 188 RGKKNQAACYLGQGDPPTWQLWRVRAKFKSNLPAQAMGHRIRVMLYPSRI 337
            GK N+     G+          VRAKF+SNLPA+A+GHRIRVMLYPSRI
Sbjct: 62  -GKPNKTRVIWGKVTRAHGNSGMVRAKFRSNLPAKAIGHRIRVMLYPSRI 110


>BC010949-1|AAH10949.1|  110|Homo sapiens ribosomal protein L35a
           protein.
          Length = 110

 Score =  129 bits (312), Expect = 3e-30
 Identities = 64/110 (58%), Positives = 77/110 (70%)
 Frame = +2

Query: 8   RLYAKAVFTGYKRGLRNQHENTALLKVEGAKDRNDAVFYAGKHCVYVYRAKKRTPIPGGP 187
           RL++KA+F GYKRGLRNQ E+TALLK+EG   R++  FY GK C YVY+AK  T  PG  
Sbjct: 4   RLWSKAIFAGYKRGLRNQREHTALLKIEGVYARDETEFYLGKRCAYVYKAKNNTVTPG-- 61

Query: 188 RGKKNQAACYLGQGDPPTWQLWRVRAKFKSNLPAQAMGHRIRVMLYPSRI 337
            GK N+     G+          VRAKF+SNLPA+A+GHRIRVMLYPSRI
Sbjct: 62  -GKPNKTRVIWGKVTRAHGNSGMVRAKFRSNLPAKAIGHRIRVMLYPSRI 110


>BC001037-1|AAH01037.1|  110|Homo sapiens ribosomal protein L35a
           protein.
          Length = 110

 Score =  129 bits (312), Expect = 3e-30
 Identities = 64/110 (58%), Positives = 77/110 (70%)
 Frame = +2

Query: 8   RLYAKAVFTGYKRGLRNQHENTALLKVEGAKDRNDAVFYAGKHCVYVYRAKKRTPIPGGP 187
           RL++KA+F GYKRGLRNQ E+TALLK+EG   R++  FY GK C YVY+AK  T  PG  
Sbjct: 4   RLWSKAIFAGYKRGLRNQREHTALLKIEGVYARDETEFYLGKRCAYVYKAKNNTVTPG-- 61

Query: 188 RGKKNQAACYLGQGDPPTWQLWRVRAKFKSNLPAQAMGHRIRVMLYPSRI 337
            GK N+     G+          VRAKF+SNLPA+A+GHRIRVMLYPSRI
Sbjct: 62  -GKPNKTRVIWGKVTRAHGNSGMVRAKFRSNLPAKAIGHRIRVMLYPSRI 110


>AY871273-1|AAX11429.1|  110|Homo sapiens cell growth-inhibiting
           protein 33 protein.
          Length = 110

 Score =  129 bits (312), Expect = 3e-30
 Identities = 64/110 (58%), Positives = 77/110 (70%)
 Frame = +2

Query: 8   RLYAKAVFTGYKRGLRNQHENTALLKVEGAKDRNDAVFYAGKHCVYVYRAKKRTPIPGGP 187
           RL++KA+F GYKRGLRNQ E+TALLK+EG   R++  FY GK C YVY+AK  T  PG  
Sbjct: 4   RLWSKAIFAGYKRGLRNQREHTALLKIEGVYARDETEFYLGKRCAYVYKAKNNTVTPG-- 61

Query: 188 RGKKNQAACYLGQGDPPTWQLWRVRAKFKSNLPAQAMGHRIRVMLYPSRI 337
            GK N+     G+          VRAKF+SNLPA+A+GHRIRVMLYPSRI
Sbjct: 62  -GKPNKTRVIWGKVTRAHGNSGMVRAKFRSNLPAKAIGHRIRVMLYPSRI 110


>X52966-1|CAA37138.1|  110|Homo sapiens protein ( Human mRNA for
           ribosomal protein L35a. ).
          Length = 110

 Score =  126 bits (305), Expect = 2e-29
 Identities = 63/110 (57%), Positives = 76/110 (69%)
 Frame = +2

Query: 8   RLYAKAVFTGYKRGLRNQHENTALLKVEGAKDRNDAVFYAGKHCVYVYRAKKRTPIPGGP 187
           RL++KA+F GYKRGLRNQ E+TALLK+EG   R++  FY GK C YVY+AK  T  PG  
Sbjct: 4   RLWSKAIFAGYKRGLRNQREHTALLKIEGVYARDETEFYLGKRCAYVYKAKNNTVTPG-- 61

Query: 188 RGKKNQAACYLGQGDPPTWQLWRVRAKFKSNLPAQAMGHRIRVMLYPSRI 337
            GK N+     G+          V AKF+SNLPA+A+GHRIRVMLYPSRI
Sbjct: 62  -GKPNKTRVIWGKVTRAHGNSGMVLAKFRSNLPAKAIGHRIRVMLYPSRI 110


>AL365223-3|CAI15713.1|   96|Homo sapiens ribosomal protein L35a
           pseudogene 3 protein.
          Length = 96

 Score = 85.8 bits (203), Expect = 4e-17
 Identities = 45/96 (46%), Positives = 59/96 (61%)
 Frame = +2

Query: 8   RLYAKAVFTGYKRGLRNQHENTALLKVEGAKDRNDAVFYAGKHCVYVYRAKKRTPIPGGP 187
           RL++K+ F GYKR L+NQ E+TALLK+EG   +++  FY GK C  VY+AK  T IPG  
Sbjct: 3   RLWSKSFFAGYKRSLQNQREHTALLKIEGGYAQDETEFYLGKRCACVYKAKSNTMIPG-- 60

Query: 188 RGKKNQAACYLGQGDPPTWQLWRVRAKFKSNLPAQA 295
             K N++    G+          V AKF SNLPA+A
Sbjct: 61  -SKPNKSRVIWGKVTRAHRNSGMVAAKFHSNLPAKA 95


>X94619-1|CAA64325.1|   21|Homo sapiens ribosomal protein L35a
          protein.
          Length = 21

 Score = 35.9 bits (79), Expect = 0.048
 Identities = 14/18 (77%), Positives = 17/18 (94%)
 Frame = +2

Query: 8  RLYAKAVFTGYKRGLRNQ 61
          RL++KA+F GYKRGLRNQ
Sbjct: 4  RLWSKAIFAGYKRGLRNQ 21


>AJ579146-1|CAE45400.1|  120|Homo sapiens immunoglobulin heavy chain
           variable region protein.
          Length = 120

 Score = 30.7 bits (66), Expect = 1.8
 Identities = 15/48 (31%), Positives = 25/48 (52%)
 Frame = +2

Query: 2   GTRLYAKAVFTGYKRGLRNQHENTALLKVEGAKDRNDAVFYAGKHCVY 145
           G+  YA +V  G     R+  ENT  L++   +  + AV+Y  ++C Y
Sbjct: 56  GSTFYANSV-KGRFTISRDNSENTLYLQMNSLRAEDTAVYYCARYCTY 102


>BC146825-1|AAI46826.1|  517|Homo sapiens FOXN4 protein protein.
          Length = 517

 Score = 29.5 bits (63), Expect = 4.1
 Identities = 12/25 (48%), Positives = 14/25 (56%)
 Frame = -3

Query: 243 HVGGSPCPR*HAAWFFLPRGPPGIG 169
           HVG +P P  H      PRG PG+G
Sbjct: 87  HVGATPSPLLHGPAGMAPRGMPGLG 111


>BC121164-1|AAI21165.1|  595|Homo sapiens C14orf101 protein protein.
          Length = 595

 Score = 29.5 bits (63), Expect = 4.1
 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 1/50 (2%)
 Frame = +2

Query: 173 IPGGPRGKKNQAACYLGQGDPPTWQLWRVRAKFKSNL-PAQAMGHRIRVM 319
           +PGG  G+   AA  LG   PP + L+ + AK    L P  ++ +R+ ++
Sbjct: 48  VPGGDSGELITAAHELGVAHPPGYPLFTLVAKLAITLFPFGSIAYRVNLL 97


>BC121163-1|AAI21164.1|  409|Homo sapiens C14orf101 protein protein.
          Length = 409

 Score = 29.5 bits (63), Expect = 4.1
 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 1/50 (2%)
 Frame = +2

Query: 173 IPGGPRGKKNQAACYLGQGDPPTWQLWRVRAKFKSNL-PAQAMGHRIRVM 319
           +PGG  G+   AA  LG   PP + L+ + AK    L P  ++ +R+ ++
Sbjct: 48  VPGGDSGELITAAHELGVAHPPGYPLFTLVAKLAITLFPFGSIAYRVNLL 97


>AF425597-1|AAL23950.1|  218|Homo sapiens forkhead/winged helix
           transcription factor FOXN4 protein.
          Length = 218

 Score = 29.5 bits (63), Expect = 4.1
 Identities = 12/25 (48%), Positives = 14/25 (56%)
 Frame = -3

Query: 243 HVGGSPCPR*HAAWFFLPRGPPGIG 169
           HVG +P P  H      PRG PG+G
Sbjct: 47  HVGATPSPLLHGPAGMAPRGMPGLG 71


>AF425596-1|AAL23949.1|  448|Homo sapiens forkhead/winged helix
           transcription factor FOXN4 protein.
          Length = 448

 Score = 29.5 bits (63), Expect = 4.1
 Identities = 12/25 (48%), Positives = 14/25 (56%)
 Frame = -3

Query: 243 HVGGSPCPR*HAAWFFLPRGPPGIG 169
           HVG +P P  H      PRG PG+G
Sbjct: 47  HVGATPSPLLHGPAGMAPRGMPGLG 71


>BC098586-1|AAH98586.1|  995|Homo sapiens PHLDB1 protein protein.
          Length = 995

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 26/87 (29%), Positives = 43/87 (49%), Gaps = 7/87 (8%)
 Frame = +3

Query: 66  RTPLSSRLKEQKTVMMQSFMLASIASMCTELRR---GHQFPEVP-VAKKTKLRAIWGKVT 233
           R     RL+EQ+   ++   L +I ++C E  R   G +  E+P + + T   A+ G+  
Sbjct: 594 RRQRQERLREQEMERLERQRLETILNLCAEYSRADGGPEAGELPSIGEATAALALAGR-- 651

Query: 234 RP-HGNSGVSEPSSSL--TSLPRLWDT 305
           RP  G +G S  SS     +  RLW++
Sbjct: 652 RPSRGLAGASGRSSEEPGVATQRLWES 678


>AK074070-1|BAB84896.1| 1326|Homo sapiens FLJ00141 protein protein.
          Length = 1326

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 26/87 (29%), Positives = 43/87 (49%), Gaps = 7/87 (8%)
 Frame = +3

Query: 66  RTPLSSRLKEQKTVMMQSFMLASIASMCTELRR---GHQFPEVP-VAKKTKLRAIWGKVT 233
           R     RL+EQ+   ++   L +I ++C E  R   G +  E+P + + T   A+ G+  
Sbjct: 601 RRQRQERLREQEMERLERQRLETILNLCAEYSRADGGPEAGELPSIGEATAALALAGR-- 658

Query: 234 RP-HGNSGVSEPSSSL--TSLPRLWDT 305
           RP  G +G S  SS     +  RLW++
Sbjct: 659 RPSRGLAGASGRSSEEPGVATQRLWES 685


>AB177859-1|BAD66837.1| 1125|Homo sapiens KIAA0638 splice variant 2
           protein.
          Length = 1125

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 26/87 (29%), Positives = 43/87 (49%), Gaps = 7/87 (8%)
 Frame = +3

Query: 66  RTPLSSRLKEQKTVMMQSFMLASIASMCTELRR---GHQFPEVP-VAKKTKLRAIWGKVT 233
           R     RL+EQ+   ++   L +I ++C E  R   G +  E+P + + T   A+ G+  
Sbjct: 338 RRQRQERLREQEMERLERQRLETILNLCAEYSRADGGPEAGELPSIGEATAALALAGR-- 395

Query: 234 RP-HGNSGVSEPSSSL--TSLPRLWDT 305
           RP  G +G S  SS     +  RLW++
Sbjct: 396 RPSRGLAGASGRSSEEPGVATQRLWES 422


>AB094090-1|BAC76044.1| 1377|Homo sapiens DLNB07 protein.
          Length = 1377

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 26/87 (29%), Positives = 43/87 (49%), Gaps = 7/87 (8%)
 Frame = +3

Query: 66  RTPLSSRLKEQKTVMMQSFMLASIASMCTELRR---GHQFPEVP-VAKKTKLRAIWGKVT 233
           R     RL+EQ+   ++   L +I ++C E  R   G +  E+P + + T   A+ G+  
Sbjct: 594 RRQRQERLREQEMERLERQRLETILNLCAEYSRADGGPEAGELPSIGEATAALALAGR-- 651

Query: 234 RP-HGNSGVSEPSSSL--TSLPRLWDT 305
           RP  G +G S  SS     +  RLW++
Sbjct: 652 RPSRGLAGASGRSSEEPGVATQRLWES 678


>AB014538-1|BAA31613.2| 1384|Homo sapiens KIAA0638 protein protein.
          Length = 1384

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 26/87 (29%), Positives = 43/87 (49%), Gaps = 7/87 (8%)
 Frame = +3

Query: 66  RTPLSSRLKEQKTVMMQSFMLASIASMCTELRR---GHQFPEVP-VAKKTKLRAIWGKVT 233
           R     RL+EQ+   ++   L +I ++C E  R   G +  E+P + + T   A+ G+  
Sbjct: 601 RRQRQERLREQEMERLERQRLETILNLCAEYSRADGGPEAGELPSIGEATAALALAGR-- 658

Query: 234 RP-HGNSGVSEPSSSL--TSLPRLWDT 305
           RP  G +G S  SS     +  RLW++
Sbjct: 659 RPSRGLAGASGRSSEEPGVATQRLWES 685


>AJ402448-1|CAC15735.1|   90|Homo sapiens immunoglobulin heavy chain
           variable region protein.
          Length = 90

 Score = 28.3 bits (60), Expect = 9.5
 Identities = 11/31 (35%), Positives = 18/31 (58%)
 Frame = +2

Query: 53  RNQHENTALLKVEGAKDRNDAVFYAGKHCVY 145
           R+  +NTA L++   K  + AV+Y  +H  Y
Sbjct: 44  RDDSKNTAYLQMNSLKTEDTAVYYCTRHMYY 74


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 61,112,047
Number of Sequences: 237096
Number of extensions: 1477779
Number of successful extensions: 9183
Number of sequences better than 10.0: 20
Number of HSP's better than 10.0 without gapping: 9066
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9166
length of database: 76,859,062
effective HSP length: 82
effective length of database: 57,417,190
effective search space used: 2756025120
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -