SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20021
         (476 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

L05092-1|AAC15856.1|  178|Homo sapiens ribosomal protein L11 pro...   177   2e-44
BC018970-1|AAH18970.1|  177|Homo sapiens ribosomal protein L11 p...   177   2e-44
AL451000-5|CAH71474.1|  174|Homo sapiens ribosomal protein L11 p...   177   2e-44
AL451000-3|CAH71472.1|  178|Homo sapiens ribosomal protein L11 p...   177   2e-44
AF432212-1|AAL99919.1|  176|Homo sapiens CLL-associated antigen ...   177   2e-44
AF101385-1|AAD20460.3|  177|Homo sapiens ribosomal protein L11 p...   177   2e-44
AY871274-1|AAX11430.1|  177|Homo sapiens cell growth-inhibiting ...   175   7e-44
X79234-1|CAA55816.1|  178|Homo sapiens ribosomal protein L11 pro...   169   3e-42
AL451000-4|CAH71473.1|  131|Homo sapiens ribosomal protein L11 p...   161   2e-39
AB007171-1|BAA25831.1|   36|Homo sapiens ribosomal protein L11 p...    64   2e-10

>L05092-1|AAC15856.1|  178|Homo sapiens ribosomal protein L11
           protein.
          Length = 178

 Score =  177 bits (431), Expect = 2e-44
 Identities = 92/142 (64%), Positives = 107/142 (75%), Gaps = 2/142 (1%)
 Frame = +1

Query: 55  EDNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGNSLYFPRLGIQCGLLVSVV 234
           +   +N MR L IRKLCLNICVGESGDRLTRAAKVLEQLTG +  F +            
Sbjct: 5   QGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRR 64

Query: 235 MKRLLSMYSPR-AKAEEIL-RXFKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIG 408
            +++    + R AKAEEIL +  KVREYELR++NFS TGNFGFGIQEHIDLGIKYDPSIG
Sbjct: 65  NEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDPSIG 124

Query: 409 IYGLDFYVVLCRPGFNVAHRRR 474
           IYGLDFYVVL RPGF++A ++R
Sbjct: 125 IYGLDFYVVLGRPGFSIADKKR 146


>BC018970-1|AAH18970.1|  177|Homo sapiens ribosomal protein L11
           protein.
          Length = 177

 Score =  177 bits (431), Expect = 2e-44
 Identities = 92/142 (64%), Positives = 107/142 (75%), Gaps = 2/142 (1%)
 Frame = +1

Query: 55  EDNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGNSLYFPRLGIQCGLLVSVV 234
           +   +N MR L IRKLCLNICVGESGDRLTRAAKVLEQLTG +  F +            
Sbjct: 4   QGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRR 63

Query: 235 MKRLLSMYSPR-AKAEEIL-RXFKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIG 408
            +++    + R AKAEEIL +  KVREYELR++NFS TGNFGFGIQEHIDLGIKYDPSIG
Sbjct: 64  NEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDPSIG 123

Query: 409 IYGLDFYVVLCRPGFNVAHRRR 474
           IYGLDFYVVL RPGF++A ++R
Sbjct: 124 IYGLDFYVVLGRPGFSIADKKR 145


>AL451000-5|CAH71474.1|  174|Homo sapiens ribosomal protein L11
           protein.
          Length = 174

 Score =  177 bits (431), Expect = 2e-44
 Identities = 92/142 (64%), Positives = 107/142 (75%), Gaps = 2/142 (1%)
 Frame = +1

Query: 55  EDNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGNSLYFPRLGIQCGLLVSVV 234
           +   +N MR L IRKLCLNICVGESGDRLTRAAKVLEQLTG +  F +            
Sbjct: 3   QGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRR 62

Query: 235 MKRLLSMYSPR-AKAEEIL-RXFKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIG 408
            +++    + R AKAEEIL +  KVREYELR++NFS TGNFGFGIQEHIDLGIKYDPSIG
Sbjct: 63  NEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDPSIG 122

Query: 409 IYGLDFYVVLCRPGFNVAHRRR 474
           IYGLDFYVVL RPGF++A ++R
Sbjct: 123 IYGLDFYVVLGRPGFSIADKKR 144


>AL451000-3|CAH71472.1|  178|Homo sapiens ribosomal protein L11
           protein.
          Length = 178

 Score =  177 bits (431), Expect = 2e-44
 Identities = 92/142 (64%), Positives = 107/142 (75%), Gaps = 2/142 (1%)
 Frame = +1

Query: 55  EDNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGNSLYFPRLGIQCGLLVSVV 234
           +   +N MR L IRKLCLNICVGESGDRLTRAAKVLEQLTG +  F +            
Sbjct: 5   QGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRR 64

Query: 235 MKRLLSMYSPR-AKAEEIL-RXFKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIG 408
            +++    + R AKAEEIL +  KVREYELR++NFS TGNFGFGIQEHIDLGIKYDPSIG
Sbjct: 65  NEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDPSIG 124

Query: 409 IYGLDFYVVLCRPGFNVAHRRR 474
           IYGLDFYVVL RPGF++A ++R
Sbjct: 125 IYGLDFYVVLGRPGFSIADKKR 146


>AF432212-1|AAL99919.1|  176|Homo sapiens CLL-associated antigen
           KW-12 protein.
          Length = 176

 Score =  177 bits (431), Expect = 2e-44
 Identities = 92/142 (64%), Positives = 107/142 (75%), Gaps = 2/142 (1%)
 Frame = +1

Query: 55  EDNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGNSLYFPRLGIQCGLLVSVV 234
           +   +N MR L IRKLCLNICVGESGDRLTRAAKVLEQLTG +  F +            
Sbjct: 3   QGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRR 62

Query: 235 MKRLLSMYSPR-AKAEEIL-RXFKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIG 408
            +++    + R AKAEEIL +  KVREYELR++NFS TGNFGFGIQEHIDLGIKYDPSIG
Sbjct: 63  NEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDPSIG 122

Query: 409 IYGLDFYVVLCRPGFNVAHRRR 474
           IYGLDFYVVL RPGF++A ++R
Sbjct: 123 IYGLDFYVVLGRPGFSIADKKR 144


>AF101385-1|AAD20460.3|  177|Homo sapiens ribosomal protein L11
           protein.
          Length = 177

 Score =  177 bits (431), Expect = 2e-44
 Identities = 92/142 (64%), Positives = 107/142 (75%), Gaps = 2/142 (1%)
 Frame = +1

Query: 55  EDNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGNSLYFPRLGIQCGLLVSVV 234
           +   +N MR L IRKLCLNICVGESGDRLTRAAKVLEQLTG +  F +            
Sbjct: 4   QGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRR 63

Query: 235 MKRLLSMYSPR-AKAEEIL-RXFKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIG 408
            +++    + R AKAEEIL +  KVREYELR++NFS TGNFGFGIQEHIDLGIKYDPSIG
Sbjct: 64  NEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDPSIG 123

Query: 409 IYGLDFYVVLCRPGFNVAHRRR 474
           IYGLDFYVVL RPGF++A ++R
Sbjct: 124 IYGLDFYVVLGRPGFSIADKKR 145


>AY871274-1|AAX11430.1|  177|Homo sapiens cell growth-inhibiting
           protein 34 protein.
          Length = 177

 Score =  175 bits (426), Expect = 7e-44
 Identities = 91/142 (64%), Positives = 106/142 (74%), Gaps = 2/142 (1%)
 Frame = +1

Query: 55  EDNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGNSLYFPRLGIQCGLLVSVV 234
           +   +N MR L IRKLCLNICVGESGDRL RAAKVLEQLTG +  F +            
Sbjct: 4   QGEKENPMRELRIRKLCLNICVGESGDRLARAAKVLEQLTGQTPVFSKARYTVRSFGIRR 63

Query: 235 MKRLLSMYSPR-AKAEEIL-RXFKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIG 408
            +++    + R AKAEEIL +  KVREYELR++NFS TGNFGFGIQEHIDLGIKYDPSIG
Sbjct: 64  NEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDPSIG 123

Query: 409 IYGLDFYVVLCRPGFNVAHRRR 474
           IYGLDFYVVL RPGF++A ++R
Sbjct: 124 IYGLDFYVVLGRPGFSIADKKR 145


>X79234-1|CAA55816.1|  178|Homo sapiens ribosomal protein L11
           protein.
          Length = 178

 Score =  169 bits (412), Expect = 3e-42
 Identities = 89/142 (62%), Positives = 105/142 (73%), Gaps = 2/142 (1%)
 Frame = +1

Query: 55  EDNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGNSLYFPRLGIQCGLLVSVV 234
           +   +N MR L IRKLCLNICVGESG RLTRAAKVLEQLTG +  F +            
Sbjct: 5   QGEKENPMRELRIRKLCLNICVGESGGRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRR 64

Query: 235 MKRLLSMYSPR-AKAEEIL-RXFKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIG 408
            +++    + R AKAEEIL +  KVRE ELR++NFS TGNFGFGIQEHIDLGI+YDPSIG
Sbjct: 65  NEKIAVHCAVRGAKAEEILEKGLKVRELELRKNNFSDTGNFGFGIQEHIDLGIEYDPSIG 124

Query: 409 IYGLDFYVVLCRPGFNVAHRRR 474
           IYGLDFYVVL RPGF++A ++R
Sbjct: 125 IYGLDFYVVLGRPGFSIADKKR 146


>AL451000-4|CAH71473.1|  131|Homo sapiens ribosomal protein L11
           protein.
          Length = 131

 Score =  161 bits (390), Expect = 2e-39
 Identities = 85/129 (65%), Positives = 96/129 (74%), Gaps = 2/129 (1%)
 Frame = +1

Query: 55  EDNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGNSLYFPRLGIQCGLLVSVV 234
           +   +N MR L IRKLCLNICVGESGDRLTRAAKVLEQLTG +  F +            
Sbjct: 3   QGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRR 62

Query: 235 MKRLLSMYSPR-AKAEEIL-RXFKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIG 408
            +++    + R AKAEEIL +  KVREYELR++NFS TGNFGFGIQEHIDLGIKYDPSIG
Sbjct: 63  NEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDPSIG 122

Query: 409 IYGLDFYVV 435
           IYGLDFYVV
Sbjct: 123 IYGLDFYVV 131


>AB007171-1|BAA25831.1|   36|Homo sapiens ribosomal protein L11
           protein.
          Length = 36

 Score = 64.5 bits (150), Expect = 2e-10
 Identities = 30/36 (83%), Positives = 32/36 (88%)
 Frame = +1

Query: 91  IRKLCLNICVGESGDRLTRAAKVLEQLTGNSLYFPR 198
           IRKLCLNICVGESGDRLTRAAKVLEQLTG +  F +
Sbjct: 1   IRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSK 36


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 67,038,711
Number of Sequences: 237096
Number of extensions: 1376672
Number of successful extensions: 6594
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 6531
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6576
length of database: 76,859,062
effective HSP length: 84
effective length of database: 56,942,998
effective search space used: 4213781852
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -