SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20019
         (587 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

L31785-1|AAA65937.1|  579|Homo sapiens orphan nuclear hormone re...    57   4e-08
D16815-1|BAA20088.1|  579|Homo sapiens EAR-1r protein.                 55   2e-07
CR457434-1|CAG33715.1|  579|Homo sapiens NR1D2 protein.                55   2e-07
BC045613-1|AAH45613.1|  579|Homo sapiens nuclear receptor subfam...    55   2e-07
AB209091-1|BAD92328.1|  549|Homo sapiens Orphan nuclear receptor...    51   3e-06
X72631-1|CAB53540.1|  614|Homo sapiens Rev-ErbAalpha protein pro...    50   5e-06
M24898-1|AAA52335.1|  614|Homo sapiens triiodothyronine receptor...    50   5e-06
BC056148-1|AAH56148.1|  614|Homo sapiens nuclear receptor subfam...    50   5e-06
BC047875-1|AAH47875.1|  614|Homo sapiens nuclear receptor subfam...    50   5e-06
U22662-1|AAA85856.1|  447|Homo sapiens nuclear orphan receptor L...    44   5e-04
BT019411-1|AAV38218.1|  447|Homo sapiens nuclear receptor subfam...    44   5e-04
BC041172-1|AAH41172.1|  402|Homo sapiens NR1H3 protein protein.        44   5e-04
L14611-1|AAA02963.1|  468|Homo sapiens transcription factor prot...    40   0.009
U04899-1|AAA62660.1|  548|Homo sapiens RORalpha3 protein.              39   0.011
U04898-1|AAA62659.1|  556|Homo sapiens RORalpha2 protein.              39   0.011
U04897-1|AAA62658.1|  523|Homo sapiens RORalpha1 protein.              39   0.011
BC100990-1|AAI00991.1|  468|Homo sapiens RAR-related orphan rece...    39   0.011
BC100989-1|AAI00990.1|  468|Homo sapiens RAR-related orphan rece...    39   0.011
BC100988-1|AAI00989.1|  468|Homo sapiens RAR-related orphan rece...    39   0.011
BC100987-1|AAI00988.1|  468|Homo sapiens RAR-related orphan rece...    39   0.011
BC008831-1|AAH08831.1|  523|Homo sapiens RAR-related orphan rece...    39   0.011
U14534-1|AAA58594.1|  455|Homo sapiens orphan receptor protein.        38   0.026
U07132-1|AAA61783.1|  461|Homo sapiens Ner-I protein.                  38   0.026
CR456706-1|CAG32987.1|  461|Homo sapiens NR1H2 protein.                38   0.026
BC074500-1|AAH74500.1|  461|Homo sapiens nuclear receptor subfam...    38   0.026
BC047750-1|AAH47750.1|  461|Homo sapiens nuclear receptor subfam...    38   0.026
BC033500-1|AAH33500.1|  461|Homo sapiens nuclear receptor subfam...    38   0.026
BC007790-1|AAH07790.1|  461|Homo sapiens nuclear receptor subfam...    38   0.026
Y08639-1|CAA69929.1|  459|Homo sapiens nuclear orphan receptor R...    33   0.57 
BC093774-1|AAH93774.1|  459|Homo sapiens RAR-related orphan rece...    33   0.57 
BC093772-1|AAH93772.1|  459|Homo sapiens RAR-related orphan rece...    33   0.57 
BC051830-1|AAH51830.1|  459|Homo sapiens RAR-related orphan rece...    33   0.57 
AL355674-1|CAD13280.2|  459|Homo sapiens RAR-related orphan rece...    33   0.57 
AL137018-1|CAD13276.2|  459|Homo sapiens RAR-related orphan rece...    33   0.57 
M24900-1|AAA52332.1|  136|Homo sapiens triiodothyronine receptor...    33   0.75 
Y00479-1|CAA68539.1|  490|Homo sapiens protein ( H.sapiens mRNA ...    31   2.3  
X55005-1|CAA38749.1|  410|Homo sapiens thyriod hormone receptor ...    31   2.3  
M24899-1|AAA35783.1|  490|Homo sapiens triiodothyronine receptor...    31   2.3  
M24748-2|AAA66021.1|  410|Homo sapiens thyroid receptor alpha-1 ...    31   2.3  
J03239-1|AAA61176.1|  490|Homo sapiens thyroid hormone receptor ...    31   2.3  
CR541915-1|CAG46713.1|  410|Homo sapiens THRA protein.                 31   2.3  
BC035137-1|AAH35137.1|  451|Homo sapiens THRA protein protein.         31   2.3  
BC008851-1|AAH08851.1|  410|Homo sapiens THRA protein protein.         31   2.3  
BC002728-1|AAH02728.1|  490|Homo sapiens thyroid hormone recepto...    31   2.3  
BC000261-1|AAH00261.1|  490|Homo sapiens thyroid hormone recepto...    31   2.3  
AB209346-1|BAD92583.1|  397|Homo sapiens thyroid hormone recepto...    31   2.3  
AF006010-1|AAD01259.2| 2799|Homo sapiens progestin induced prote...    30   5.3  
AB020703-1|BAA74919.3| 2820|Homo sapiens KIAA0896 protein protein.     30   5.3  
U95000-1|AAF88143.1| 2798|Homo sapiens hyd protein protein.            30   7.0  
AK001542-1|BAA91748.1|  659|Homo sapiens protein ( Homo sapiens ...    30   7.0  
Z83856-4|CAI18778.1| 1594|Homo sapiens DEP domain containing 5 p...    29   9.2  
Z83856-3|CAI18779.1| 1572|Homo sapiens DEP domain containing 5 p...    29   9.2  
Z83856-2|CAI18777.1| 1552|Homo sapiens DEP domain containing 5 p...    29   9.2  
Z82190-4|CAI19699.1| 1594|Homo sapiens DEP domain containing 5 p...    29   9.2  
Z82190-3|CAI19698.1| 1572|Homo sapiens DEP domain containing 5 p...    29   9.2  
Z82190-2|CAI19697.1| 1552|Homo sapiens DEP domain containing 5 p...    29   9.2  
BC146766-1|AAI46767.1| 1572|Homo sapiens DEP domain containing 5...    29   9.2  
BC057797-1|AAH57797.1|  559|Homo sapiens DEP domain containing 5...    29   9.2  
AL022331-6|CAI17976.1| 1594|Homo sapiens DEP domain containing 5...    29   9.2  
AL022331-5|CAI17975.1| 1572|Homo sapiens DEP domain containing 5...    29   9.2  
AL022331-4|CAI17974.1| 1552|Homo sapiens DEP domain containing 5...    29   9.2  
AL022331-3|CAI17973.1|  559|Homo sapiens DEP domain containing 5...    29   9.2  
AJ704764-1|CAG28924.1| 1572|Homo sapiens DEP domain containing 5...    29   9.2  
AJ698951-1|CAG27890.1| 1503|Homo sapiens DEPDC5 protein variant ...    29   9.2  
AJ698950-1|CAG27889.1| 1594|Homo sapiens DEPDC5 protein variant ...    29   9.2  
AB014545-1|BAA31620.2| 1578|Homo sapiens KIAA0645 protein protein.     29   9.2  

>L31785-1|AAA65937.1|  579|Homo sapiens orphan nuclear hormone
           receptor BD73 protein.
          Length = 579

 Score = 57.2 bits (132), Expect = 4e-08
 Identities = 47/167 (28%), Positives = 81/167 (48%), Gaps = 11/167 (6%)
 Frame = +2

Query: 98  CPTYSQPTLACPLNPAPELQSEK-------EFSQRFAHVIRGVIDFAGLIPGFQLLTQ-D 253
           C T  +  L CP++ +P +   K       EFS  F   ++ V++FA  IPGF+ L+Q D
Sbjct: 373 CNTGGRMHLVCPMSKSPYVDPHKSGHEIWEEFSMSFTPAVKEVVEFAKRIPGFRDLSQHD 432

Query: 254 EIHAAQKWSVRCI-VRATHLYV*RSS**YHLSQWATDEERLHPERCQCKFLVDSTFKFAE 430
           +++  +  +   + VR   L+  +      LS      + LH        L++S F+F+E
Sbjct: 433 QVNLLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLH--SMGAGDLLNSMFEFSE 490

Query: 431 RMNSMNLTDAEIGLFW--XXXXXXRIGLLRNIELVERMHSRLRRACK 565
           ++N++ L+D E+ LF         R G  +N+  VE +   L RA +
Sbjct: 491 KLNALQLSDEEMSLFTAVVLVSADRSGNRKNVNSVEALQETLIRALR 537



 Score = 32.7 bits (71), Expect = 0.99
 Identities = 15/40 (37%), Positives = 23/40 (57%)
 Frame = +3

Query: 264 LLKSGLFDALFVRLICMFDAPLNSIICLNGQLMKRDSIQS 383
           LLK+G F+ L VR   +FDA   ++  L+G+    D + S
Sbjct: 436 LLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLHS 475


>D16815-1|BAA20088.1|  579|Homo sapiens EAR-1r protein.
          Length = 579

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 47/167 (28%), Positives = 81/167 (48%), Gaps = 11/167 (6%)
 Frame = +2

Query: 98  CPTYSQPTLACPLNPAPELQSEK-------EFSQRFAHVIRGVIDFAGLIPGFQLLTQ-D 253
           C T  +  L CP++ +P +   K       EFS  F   ++ V++FA  IPGF+ L+Q D
Sbjct: 374 CNTGGRMHLVCPMSKSPYVDPHKSGHEIWEEFSMSFTPAVKEVVEFAKRIPGFRDLSQHD 433

Query: 254 EIHAAQKWSVRCI-VRATHLYV*RSS**YHLSQWATDEERLHPERCQCKFLVDSTFKFAE 430
           +++  +  +   + VR   L+  +      LS      + LH        L++S F+F+E
Sbjct: 434 QVNLLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLH--SMGAGDLLNSMFEFSE 491

Query: 431 RMNSMNLTDAEIGLFW--XXXXXXRIGLLRNIELVERMHSRLRRACK 565
           ++N++ L+D E+ LF         R G + N+  VE +   L RA +
Sbjct: 492 KLNALQLSDEEMSLFTAVVLVSADRSG-IENVNSVEALQETLIRALR 537



 Score = 32.7 bits (71), Expect = 0.99
 Identities = 15/40 (37%), Positives = 23/40 (57%)
 Frame = +3

Query: 264 LLKSGLFDALFVRLICMFDAPLNSIICLNGQLMKRDSIQS 383
           LLK+G F+ L VR   +FDA   ++  L+G+    D + S
Sbjct: 437 LLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLHS 476


>CR457434-1|CAG33715.1|  579|Homo sapiens NR1D2 protein.
          Length = 579

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 47/167 (28%), Positives = 81/167 (48%), Gaps = 11/167 (6%)
 Frame = +2

Query: 98  CPTYSQPTLACPLNPAPELQSEK-------EFSQRFAHVIRGVIDFAGLIPGFQLLTQ-D 253
           C T  +  L CP++ +P +   K       EFS  F   ++ V++FA  IPGF+ L+Q D
Sbjct: 374 CNTGGRMHLVCPMSKSPYVDPHKSGHEIWEEFSMSFTPAVKEVVEFAKRIPGFRDLSQHD 433

Query: 254 EIHAAQKWSVRCI-VRATHLYV*RSS**YHLSQWATDEERLHPERCQCKFLVDSTFKFAE 430
           +++  +  +   + VR   L+  +      LS      + LH        L++S F+F+E
Sbjct: 434 QVNLLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLH--SMGAGDLLNSMFEFSE 491

Query: 431 RMNSMNLTDAEIGLFW--XXXXXXRIGLLRNIELVERMHSRLRRACK 565
           ++N++ L+D E+ LF         R G + N+  VE +   L RA +
Sbjct: 492 KLNALQLSDEEMSLFTAVVLVSADRSG-IENVNSVEALQETLIRALR 537



 Score = 32.7 bits (71), Expect = 0.99
 Identities = 15/40 (37%), Positives = 23/40 (57%)
 Frame = +3

Query: 264 LLKSGLFDALFVRLICMFDAPLNSIICLNGQLMKRDSIQS 383
           LLK+G F+ L VR   +FDA   ++  L+G+    D + S
Sbjct: 437 LLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLHS 476


>BC045613-1|AAH45613.1|  579|Homo sapiens nuclear receptor subfamily
           1, group D, member 2 protein.
          Length = 579

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 47/167 (28%), Positives = 81/167 (48%), Gaps = 11/167 (6%)
 Frame = +2

Query: 98  CPTYSQPTLACPLNPAPELQSEK-------EFSQRFAHVIRGVIDFAGLIPGFQLLTQ-D 253
           C T  +  L CP++ +P +   K       EFS  F   ++ V++FA  IPGF+ L+Q D
Sbjct: 374 CNTGGRMHLVCPMSKSPYVDPHKSGHEIWEEFSMSFTPAVKEVVEFAKRIPGFRDLSQHD 433

Query: 254 EIHAAQKWSVRCI-VRATHLYV*RSS**YHLSQWATDEERLHPERCQCKFLVDSTFKFAE 430
           +++  +  +   + VR   L+  +      LS      + LH        L++S F+F+E
Sbjct: 434 QVNLLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLH--SMGAGDLLNSMFEFSE 491

Query: 431 RMNSMNLTDAEIGLFW--XXXXXXRIGLLRNIELVERMHSRLRRACK 565
           ++N++ L+D E+ LF         R G + N+  VE +   L RA +
Sbjct: 492 KLNALQLSDEEMSLFTAVVLVSADRSG-IENVNSVEALQETLIRALR 537



 Score = 32.7 bits (71), Expect = 0.99
 Identities = 15/40 (37%), Positives = 23/40 (57%)
 Frame = +3

Query: 264 LLKSGLFDALFVRLICMFDAPLNSIICLNGQLMKRDSIQS 383
           LLK+G F+ L VR   +FDA   ++  L+G+    D + S
Sbjct: 437 LLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLHS 476


>AB209091-1|BAD92328.1|  549|Homo sapiens Orphan nuclear receptor
           NR1D2 variant protein.
          Length = 549

 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 44/159 (27%), Positives = 78/159 (49%), Gaps = 11/159 (6%)
 Frame = +2

Query: 122 LACPLNPAPELQSEK-------EFSQRFAHVIRGVIDFAGLIPGFQLLTQ-DEIHAAQKW 277
           + CP++ +P +   K       EFS  F   ++ V++FA  IPGF+ L+Q D+++  +  
Sbjct: 352 VVCPMSKSPYVDPHKSGHEIWEEFSMSFTPAVKEVVEFAKRIPGFRDLSQHDQVNLLKAG 411

Query: 278 SVRCI-VRATHLYV*RSS**YHLSQWATDEERLHPERCQCKFLVDSTFKFAERMNSMNLT 454
           +   + VR   L+  +      LS      + LH        L++S F+F+E++N++ L+
Sbjct: 412 TFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLH--SMGAGDLLNSMFEFSEKLNALQLS 469

Query: 455 DAEIGLFW--XXXXXXRIGLLRNIELVERMHSRLRRACK 565
           D E+ LF         R G + N+  VE +   L RA +
Sbjct: 470 DEEMSLFTAVVLVSADRSG-IENVNSVEALQETLIRALR 507



 Score = 32.7 bits (71), Expect = 0.99
 Identities = 15/40 (37%), Positives = 23/40 (57%)
 Frame = +3

Query: 264 LLKSGLFDALFVRLICMFDAPLNSIICLNGQLMKRDSIQS 383
           LLK+G F+ L VR   +FDA   ++  L+G+    D + S
Sbjct: 407 LLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLHS 446


>X72631-1|CAB53540.1|  614|Homo sapiens Rev-ErbAalpha protein
           protein.
          Length = 614

 Score = 50.4 bits (115), Expect = 5e-06
 Identities = 47/159 (29%), Positives = 77/159 (48%), Gaps = 11/159 (6%)
 Frame = +2

Query: 122 LACPLNPAPELQSEK-------EFSQRFAHVIRGVIDFAGLIPGFQLLTQ-DEIHAAQKW 277
           LACP+N  P  +S +       +FS  F   +R V++FA  IPGF+ L+Q D++   +  
Sbjct: 416 LACPMNMYPHGRSGRTVQEIWEDFSMSFTPAVREVVEFAKHIPGFRDLSQHDQVTLLKAG 475

Query: 278 SVRCI-VRATHLYV*RSS**YHLSQWATDEERLHPERCQCKFLVDSTFKFAERMNSMNLT 454
           +   + VR   L+  +      LS+     + L         L+ + F F+E++NS+ LT
Sbjct: 476 TFEVLMVRFASLFNVKDQTVMFLSRTTYSLQELGA--MGMGDLLSAMFDFSEKLNSLALT 533

Query: 455 DAEIGLFW--XXXXXXRIGLLRNIELVERMHSRLRRACK 565
           + E+GLF         R G + N   VE++   L RA +
Sbjct: 534 EEELGLFTAVVLVSADRSG-MENSASVEQLQETLLRALR 571


>M24898-1|AAA52335.1|  614|Homo sapiens triiodothyronine receptor
           protein.
          Length = 614

 Score = 50.4 bits (115), Expect = 5e-06
 Identities = 47/159 (29%), Positives = 77/159 (48%), Gaps = 11/159 (6%)
 Frame = +2

Query: 122 LACPLNPAPELQSEK-------EFSQRFAHVIRGVIDFAGLIPGFQLLTQ-DEIHAAQKW 277
           LACP+N  P  +S +       +FS  F   +R V++FA  IPGF+ L+Q D++   +  
Sbjct: 416 LACPMNMYPHGRSGRTVQEIWEDFSMSFTPAVREVVEFAKHIPGFRDLSQHDQVTLLKAG 475

Query: 278 SVRCI-VRATHLYV*RSS**YHLSQWATDEERLHPERCQCKFLVDSTFKFAERMNSMNLT 454
           +   + VR   L+  +      LS+     + L         L+ + F F+E++NS+ LT
Sbjct: 476 TFEVLMVRFASLFNVKDQTVMFLSRTTYSLQELGA--MGMGDLLSAMFDFSEKLNSLALT 533

Query: 455 DAEIGLFW--XXXXXXRIGLLRNIELVERMHSRLRRACK 565
           + E+GLF         R G + N   VE++   L RA +
Sbjct: 534 EEELGLFTAVVLVSADRSG-MENSASVEQLQETLLRALR 571


>BC056148-1|AAH56148.1|  614|Homo sapiens nuclear receptor subfamily
           1, group D, member 1 protein.
          Length = 614

 Score = 50.4 bits (115), Expect = 5e-06
 Identities = 47/159 (29%), Positives = 77/159 (48%), Gaps = 11/159 (6%)
 Frame = +2

Query: 122 LACPLNPAPELQSEK-------EFSQRFAHVIRGVIDFAGLIPGFQLLTQ-DEIHAAQKW 277
           LACP+N  P  +S +       +FS  F   +R V++FA  IPGF+ L+Q D++   +  
Sbjct: 416 LACPMNMYPHGRSGRTVQEIWEDFSMSFTPAVREVVEFAKHIPGFRDLSQHDQVTLLKAG 475

Query: 278 SVRCI-VRATHLYV*RSS**YHLSQWATDEERLHPERCQCKFLVDSTFKFAERMNSMNLT 454
           +   + VR   L+  +      LS+     + L         L+ + F F+E++NS+ LT
Sbjct: 476 TFEVLMVRFASLFNVKDQTVMFLSRTTYSLQELGA--MGMGDLLSAMFDFSEKLNSLALT 533

Query: 455 DAEIGLFW--XXXXXXRIGLLRNIELVERMHSRLRRACK 565
           + E+GLF         R G + N   VE++   L RA +
Sbjct: 534 EEELGLFTAVVLVSADRSG-MENSASVEQLQETLLRALR 571


>BC047875-1|AAH47875.1|  614|Homo sapiens nuclear receptor subfamily
           1, group D, member 1 protein.
          Length = 614

 Score = 50.4 bits (115), Expect = 5e-06
 Identities = 47/159 (29%), Positives = 77/159 (48%), Gaps = 11/159 (6%)
 Frame = +2

Query: 122 LACPLNPAPELQSEK-------EFSQRFAHVIRGVIDFAGLIPGFQLLTQ-DEIHAAQKW 277
           LACP+N  P  +S +       +FS  F   +R V++FA  IPGF+ L+Q D++   +  
Sbjct: 416 LACPMNMYPHGRSGRTVQEIWEDFSMSFTPAVREVVEFAKHIPGFRDLSQHDQVTLLKAG 475

Query: 278 SVRCI-VRATHLYV*RSS**YHLSQWATDEERLHPERCQCKFLVDSTFKFAERMNSMNLT 454
           +   + VR   L+  +      LS+     + L         L+ + F F+E++NS+ LT
Sbjct: 476 TFEVLMVRFASLFNVKDQTVMFLSRTTYSLQELGA--MGMGDLLSAMFDFSEKLNSLALT 533

Query: 455 DAEIGLFW--XXXXXXRIGLLRNIELVERMHSRLRRACK 565
           + E+GLF         R G + N   VE++   L RA +
Sbjct: 534 EEELGLFTAVVLVSADRSG-MENSASVEQLQETLLRALR 571


>U22662-1|AAA85856.1|  447|Homo sapiens nuclear orphan receptor
           LXR-alpha protein.
          Length = 447

 Score = 43.6 bits (98), Expect = 5e-04
 Identities = 36/132 (27%), Positives = 61/132 (46%), Gaps = 9/132 (6%)
 Frame = +2

Query: 104 TYSQPTLACPLNPAPELQSEKEFSQRFAHV-------IRGVIDFAGLIPGF-QLLTQDEI 259
           ++S      P   AP+  S +   QRFAH        ++ ++DFA  +PGF QL  +D+I
Sbjct: 228 SFSDRLRVTPWPMAPDPHSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQI 287

Query: 260 HAAQKWSVRCIVRAT-HLYV*RSS**YHLSQWATDEERLHPERCQCKFLVDSTFKFAERM 436
              +  ++  ++  T   Y   S     L  ++ + E       Q +F ++  F+F+  M
Sbjct: 288 ALLKTSAIEVMLLETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEF-INPIFEFSRAM 346

Query: 437 NSMNLTDAEIGL 472
           N + L DAE  L
Sbjct: 347 NELQLNDAEFAL 358


>BT019411-1|AAV38218.1|  447|Homo sapiens nuclear receptor subfamily
           1, group H, member 3 protein.
          Length = 447

 Score = 43.6 bits (98), Expect = 5e-04
 Identities = 36/132 (27%), Positives = 61/132 (46%), Gaps = 9/132 (6%)
 Frame = +2

Query: 104 TYSQPTLACPLNPAPELQSEKEFSQRFAHV-------IRGVIDFAGLIPGF-QLLTQDEI 259
           ++S      P   AP+  S +   QRFAH        ++ ++DFA  +PGF QL  +D+I
Sbjct: 228 SFSDRLRVTPWPMAPDPHSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQI 287

Query: 260 HAAQKWSVRCIVRAT-HLYV*RSS**YHLSQWATDEERLHPERCQCKFLVDSTFKFAERM 436
              +  ++  ++  T   Y   S     L  ++ + E       Q +F ++  F+F+  M
Sbjct: 288 ALLKTSAIEVMLLETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEF-INPIFEFSRAM 346

Query: 437 NSMNLTDAEIGL 472
           N + L DAE  L
Sbjct: 347 NELQLNDAEFAL 358


>BC041172-1|AAH41172.1|  402|Homo sapiens NR1H3 protein protein.
          Length = 402

 Score = 43.6 bits (98), Expect = 5e-04
 Identities = 36/132 (27%), Positives = 61/132 (46%), Gaps = 9/132 (6%)
 Frame = +2

Query: 104 TYSQPTLACPLNPAPELQSEKEFSQRFAHV-------IRGVIDFAGLIPGF-QLLTQDEI 259
           ++S      P   AP+  S +   QRFAH        ++ ++DFA  +PGF QL  +D+I
Sbjct: 183 SFSDRLRVTPWPMAPDPHSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQI 242

Query: 260 HAAQKWSVRCIVRAT-HLYV*RSS**YHLSQWATDEERLHPERCQCKFLVDSTFKFAERM 436
              +  ++  ++  T   Y   S     L  ++ + E       Q +F ++  F+F+  M
Sbjct: 243 ALLKTSAIEVMLLETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEF-INPIFEFSRAM 301

Query: 437 NSMNLTDAEIGL 472
           N + L DAE  L
Sbjct: 302 NELQLNDAEFAL 313


>L14611-1|AAA02963.1|  468|Homo sapiens transcription factor
           protein.
          Length = 468

 Score = 39.5 bits (88), Expect = 0.009
 Identities = 36/157 (22%), Positives = 76/157 (48%), Gaps = 2/157 (1%)
 Frame = +2

Query: 11  LLARVVRAHLDTCEFTRDRVASMRARARDCPTYSQPTLACPLNPAPELQSEKEFSQRFAH 190
           L   + ++HL+TC++ R+ +  +  +     T+ Q  +    N   E+  +   + +   
Sbjct: 221 LAQNISKSHLETCQYLREELQQITWQ-----TFLQEEIENYQNKQREVMWQL-CAIKITE 274

Query: 191 VIRGVIDFAGLIPGFQLLTQ-DEIHAAQKWSVRCI-VRATHLYV*RSS**YHLSQWATDE 364
            I+ V++FA  I GF  L Q D+I   +  S+  + +R    +  +++  Y   ++A+ +
Sbjct: 275 AIQYVVEFAKRIDGFMELCQNDQIVLLKAGSLEVVFIRVCRAFDSQNNTVYFDGKYASPD 334

Query: 365 ERLHPERCQCKFLVDSTFKFAERMNSMNLTDAEIGLF 475
                +   C+  +   F+F + + SM+LT+ EI LF
Sbjct: 335 VF---KSLGCEDFISFVFEFGKSLCSMHLTEDEIALF 368


>U04899-1|AAA62660.1|  548|Homo sapiens RORalpha3 protein.
          Length = 548

 Score = 39.1 bits (87), Expect = 0.011
 Identities = 36/157 (22%), Positives = 76/157 (48%), Gaps = 2/157 (1%)
 Frame = +2

Query: 11  LLARVVRAHLDTCEFTRDRVASMRARARDCPTYSQPTLACPLNPAPELQSEKEFSQRFAH 190
           L   + ++HL+TC++ R+ +  +  +     T+ Q  +    N   E+  +   + +   
Sbjct: 301 LAQNISKSHLETCQYLREELQQITWQ-----TFLQEEIENYQNKQREVMWQL-CAIKITE 354

Query: 191 VIRGVIDFAGLIPGFQLLTQ-DEIHAAQKWSVRCI-VRATHLYV*RSS**YHLSQWATDE 364
            I+ V++FA  I GF  L Q D+I   +  S+  + +R    +  +++  Y   ++A+ +
Sbjct: 355 AIQYVVEFAKRIDGFMELCQNDQIVLLKAGSLEVVFIRMCRAFDSQNNTVYFDGKYASPD 414

Query: 365 ERLHPERCQCKFLVDSTFKFAERMNSMNLTDAEIGLF 475
                +   C+  +   F+F + + SM+LT+ EI LF
Sbjct: 415 VF---KSLGCEDFISFVFEFGKSLCSMHLTEDEIALF 448


>U04898-1|AAA62659.1|  556|Homo sapiens RORalpha2 protein.
          Length = 556

 Score = 39.1 bits (87), Expect = 0.011
 Identities = 36/157 (22%), Positives = 76/157 (48%), Gaps = 2/157 (1%)
 Frame = +2

Query: 11  LLARVVRAHLDTCEFTRDRVASMRARARDCPTYSQPTLACPLNPAPELQSEKEFSQRFAH 190
           L   + ++HL+TC++ R+ +  +  +     T+ Q  +    N   E+  +   + +   
Sbjct: 309 LAQNISKSHLETCQYLREELQQITWQ-----TFLQEEIENYQNKQREVMWQL-CAIKITE 362

Query: 191 VIRGVIDFAGLIPGFQLLTQ-DEIHAAQKWSVRCI-VRATHLYV*RSS**YHLSQWATDE 364
            I+ V++FA  I GF  L Q D+I   +  S+  + +R    +  +++  Y   ++A+ +
Sbjct: 363 AIQYVVEFAKRIDGFMELCQNDQIVLLKAGSLEVVFIRMCRAFDSQNNTVYFDGKYASPD 422

Query: 365 ERLHPERCQCKFLVDSTFKFAERMNSMNLTDAEIGLF 475
                +   C+  +   F+F + + SM+LT+ EI LF
Sbjct: 423 VF---KSLGCEDFISFVFEFGKSLCSMHLTEDEIALF 456


>U04897-1|AAA62658.1|  523|Homo sapiens RORalpha1 protein.
          Length = 523

 Score = 39.1 bits (87), Expect = 0.011
 Identities = 36/157 (22%), Positives = 76/157 (48%), Gaps = 2/157 (1%)
 Frame = +2

Query: 11  LLARVVRAHLDTCEFTRDRVASMRARARDCPTYSQPTLACPLNPAPELQSEKEFSQRFAH 190
           L   + ++HL+TC++ R+ +  +  +     T+ Q  +    N   E+  +   + +   
Sbjct: 276 LAQNISKSHLETCQYLREELQQITWQ-----TFLQEEIENYQNKQREVMWQL-CAIKITE 329

Query: 191 VIRGVIDFAGLIPGFQLLTQ-DEIHAAQKWSVRCI-VRATHLYV*RSS**YHLSQWATDE 364
            I+ V++FA  I GF  L Q D+I   +  S+  + +R    +  +++  Y   ++A+ +
Sbjct: 330 AIQYVVEFAKRIDGFMELCQNDQIVLLKAGSLEVVFIRMCRAFDSQNNTVYFDGKYASPD 389

Query: 365 ERLHPERCQCKFLVDSTFKFAERMNSMNLTDAEIGLF 475
                +   C+  +   F+F + + SM+LT+ EI LF
Sbjct: 390 VF---KSLGCEDFISFVFEFGKSLCSMHLTEDEIALF 423


>BC100990-1|AAI00991.1|  468|Homo sapiens RAR-related orphan
           receptor A protein.
          Length = 468

 Score = 39.1 bits (87), Expect = 0.011
 Identities = 36/157 (22%), Positives = 76/157 (48%), Gaps = 2/157 (1%)
 Frame = +2

Query: 11  LLARVVRAHLDTCEFTRDRVASMRARARDCPTYSQPTLACPLNPAPELQSEKEFSQRFAH 190
           L   + ++HL+TC++ R+ +  +  +     T+ Q  +    N   E+  +   + +   
Sbjct: 221 LAQNISKSHLETCQYLREELQQITWQ-----TFLQEEIENYQNKQREVMWQL-CAIKITE 274

Query: 191 VIRGVIDFAGLIPGFQLLTQ-DEIHAAQKWSVRCI-VRATHLYV*RSS**YHLSQWATDE 364
            I+ V++FA  I GF  L Q D+I   +  S+  + +R    +  +++  Y   ++A+ +
Sbjct: 275 AIQYVVEFAKRIDGFMELCQNDQIVLLKAGSLEVVFIRMCRAFDSQNNTVYFDGKYASPD 334

Query: 365 ERLHPERCQCKFLVDSTFKFAERMNSMNLTDAEIGLF 475
                +   C+  +   F+F + + SM+LT+ EI LF
Sbjct: 335 VF---KSLGCEDFISFVFEFGKSLCSMHLTEDEIALF 368


>BC100989-1|AAI00990.1|  468|Homo sapiens RAR-related orphan
           receptor A protein.
          Length = 468

 Score = 39.1 bits (87), Expect = 0.011
 Identities = 36/157 (22%), Positives = 76/157 (48%), Gaps = 2/157 (1%)
 Frame = +2

Query: 11  LLARVVRAHLDTCEFTRDRVASMRARARDCPTYSQPTLACPLNPAPELQSEKEFSQRFAH 190
           L   + ++HL+TC++ R+ +  +  +     T+ Q  +    N   E+  +   + +   
Sbjct: 221 LAQNISKSHLETCQYLREELQQITWQ-----TFLQEEIENYQNKQREVMWQL-CAIKITE 274

Query: 191 VIRGVIDFAGLIPGFQLLTQ-DEIHAAQKWSVRCI-VRATHLYV*RSS**YHLSQWATDE 364
            I+ V++FA  I GF  L Q D+I   +  S+  + +R    +  +++  Y   ++A+ +
Sbjct: 275 AIQYVVEFAKRIDGFMELCQNDQIVLLKAGSLEVVFIRMCRAFDSQNNTVYFDGKYASPD 334

Query: 365 ERLHPERCQCKFLVDSTFKFAERMNSMNLTDAEIGLF 475
                +   C+  +   F+F + + SM+LT+ EI LF
Sbjct: 335 VF---KSLGCEDFISFVFEFGKSLCSMHLTEDEIALF 368


>BC100988-1|AAI00989.1|  468|Homo sapiens RAR-related orphan
           receptor A protein.
          Length = 468

 Score = 39.1 bits (87), Expect = 0.011
 Identities = 36/157 (22%), Positives = 76/157 (48%), Gaps = 2/157 (1%)
 Frame = +2

Query: 11  LLARVVRAHLDTCEFTRDRVASMRARARDCPTYSQPTLACPLNPAPELQSEKEFSQRFAH 190
           L   + ++HL+TC++ R+ +  +  +     T+ Q  +    N   E+  +   + +   
Sbjct: 221 LAQNISKSHLETCQYLREELQQITWQ-----TFLQEEIENYQNKQREVMWQL-CAIKITE 274

Query: 191 VIRGVIDFAGLIPGFQLLTQ-DEIHAAQKWSVRCI-VRATHLYV*RSS**YHLSQWATDE 364
            I+ V++FA  I GF  L Q D+I   +  S+  + +R    +  +++  Y   ++A+ +
Sbjct: 275 AIQYVVEFAKRIDGFMELCQNDQIVLLKAGSLEVVFIRMCRAFDSQNNTVYFDGKYASPD 334

Query: 365 ERLHPERCQCKFLVDSTFKFAERMNSMNLTDAEIGLF 475
                +   C+  +   F+F + + SM+LT+ EI LF
Sbjct: 335 VF---KSLGCEDFISFVFEFGKSLCSMHLTEDEIALF 368


>BC100987-1|AAI00988.1|  468|Homo sapiens RAR-related orphan
           receptor A protein.
          Length = 468

 Score = 39.1 bits (87), Expect = 0.011
 Identities = 36/157 (22%), Positives = 76/157 (48%), Gaps = 2/157 (1%)
 Frame = +2

Query: 11  LLARVVRAHLDTCEFTRDRVASMRARARDCPTYSQPTLACPLNPAPELQSEKEFSQRFAH 190
           L   + ++HL+TC++ R+ +  +  +     T+ Q  +    N   E+  +   + +   
Sbjct: 221 LAQNISKSHLETCQYLREELQQITWQ-----TFLQEEIENYQNKQREVMWQL-CAIKITE 274

Query: 191 VIRGVIDFAGLIPGFQLLTQ-DEIHAAQKWSVRCI-VRATHLYV*RSS**YHLSQWATDE 364
            I+ V++FA  I GF  L Q D+I   +  S+  + +R    +  +++  Y   ++A+ +
Sbjct: 275 AIQYVVEFAKRIDGFMELCQNDQIVLLKAGSLEVVFIRMCRAFDSQNNTVYFDGKYASPD 334

Query: 365 ERLHPERCQCKFLVDSTFKFAERMNSMNLTDAEIGLF 475
                +   C+  +   F+F + + SM+LT+ EI LF
Sbjct: 335 VF---KSLGCEDFISFVFEFGKSLCSMHLTEDEIALF 368


>BC008831-1|AAH08831.1|  523|Homo sapiens RAR-related orphan
           receptor A protein.
          Length = 523

 Score = 39.1 bits (87), Expect = 0.011
 Identities = 36/157 (22%), Positives = 76/157 (48%), Gaps = 2/157 (1%)
 Frame = +2

Query: 11  LLARVVRAHLDTCEFTRDRVASMRARARDCPTYSQPTLACPLNPAPELQSEKEFSQRFAH 190
           L   + ++HL+TC++ R+ +  +  +     T+ Q  +    N   E+  +   + +   
Sbjct: 276 LAQNISKSHLETCQYLREELQQITWQ-----TFLQEEIENYQNKQREVMWQL-CAIKITE 329

Query: 191 VIRGVIDFAGLIPGFQLLTQ-DEIHAAQKWSVRCI-VRATHLYV*RSS**YHLSQWATDE 364
            I+ V++FA  I GF  L Q D+I   +  S+  + +R    +  +++  Y   ++A+ +
Sbjct: 330 AIQYVVEFAKRIDGFMELCQNDQIVLLKAGSLEVVFIRMCRAFDSQNNTVYFDGKYASPD 389

Query: 365 ERLHPERCQCKFLVDSTFKFAERMNSMNLTDAEIGLF 475
                +   C+  +   F+F + + SM+LT+ EI LF
Sbjct: 390 VF---KSLGCEDFISFVFEFGKSLCSMHLTEDEIALF 423


>U14534-1|AAA58594.1|  455|Homo sapiens orphan receptor protein.
          Length = 455

 Score = 37.9 bits (84), Expect = 0.026
 Identities = 32/123 (26%), Positives = 58/123 (47%), Gaps = 9/123 (7%)
 Frame = +2

Query: 131 PLNPAPELQSEKEFSQRFAHV-------IRGVIDFAGLIPGF-QLLTQDEIHAAQKWSVR 286
           PL   P+ +  ++  QRFAH        ++ ++DFA  +PGF QL  +D+I   +  ++ 
Sbjct: 247 PLGADPQSRDARQ--QRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQIALLKASTIE 304

Query: 287 CIVRAT-HLYV*RSS**YHLSQWATDEERLHPERCQCKFLVDSTFKFAERMNSMNLTDAE 463
            ++  T   Y   +     L  +   ++  H    Q +F ++  F+F+  M  + L DAE
Sbjct: 305 IMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEF-INPIFEFSRAMRRLGLDDAE 363

Query: 464 IGL 472
             L
Sbjct: 364 YAL 366


>U07132-1|AAA61783.1|  461|Homo sapiens Ner-I protein.
          Length = 461

 Score = 37.9 bits (84), Expect = 0.026
 Identities = 32/123 (26%), Positives = 58/123 (47%), Gaps = 9/123 (7%)
 Frame = +2

Query: 131 PLNPAPELQSEKEFSQRFAHV-------IRGVIDFAGLIPGF-QLLTQDEIHAAQKWSVR 286
           PL   P+ +  ++  QRFAH        ++ ++DFA  +PGF QL  +D+I   +  ++ 
Sbjct: 253 PLGADPQSRDARQ--QRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQIALLKASTIE 310

Query: 287 CIVRAT-HLYV*RSS**YHLSQWATDEERLHPERCQCKFLVDSTFKFAERMNSMNLTDAE 463
            ++  T   Y   +     L  +   ++  H    Q +F ++  F+F+  M  + L DAE
Sbjct: 311 IMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEF-INPIFEFSRAMRRLGLDDAE 369

Query: 464 IGL 472
             L
Sbjct: 370 YAL 372


>CR456706-1|CAG32987.1|  461|Homo sapiens NR1H2 protein.
          Length = 461

 Score = 37.9 bits (84), Expect = 0.026
 Identities = 32/123 (26%), Positives = 58/123 (47%), Gaps = 9/123 (7%)
 Frame = +2

Query: 131 PLNPAPELQSEKEFSQRFAHV-------IRGVIDFAGLIPGF-QLLTQDEIHAAQKWSVR 286
           PL   P+ +  ++  QRFAH        ++ ++DFA  +PGF QL  +D+I   +  ++ 
Sbjct: 253 PLGADPQSRDARQ--QRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQIALLKASTIE 310

Query: 287 CIVRAT-HLYV*RSS**YHLSQWATDEERLHPERCQCKFLVDSTFKFAERMNSMNLTDAE 463
            ++  T   Y   +     L  +   ++  H    Q +F ++  F+F+  M  + L DAE
Sbjct: 311 IMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEF-INPIFEFSRAMRRLGLDDAE 369

Query: 464 IGL 472
             L
Sbjct: 370 YAL 372


>BC074500-1|AAH74500.1|  461|Homo sapiens nuclear receptor subfamily
           1, group H, member 2 protein.
          Length = 461

 Score = 37.9 bits (84), Expect = 0.026
 Identities = 32/123 (26%), Positives = 58/123 (47%), Gaps = 9/123 (7%)
 Frame = +2

Query: 131 PLNPAPELQSEKEFSQRFAHV-------IRGVIDFAGLIPGF-QLLTQDEIHAAQKWSVR 286
           PL   P+ +  ++  QRFAH        ++ ++DFA  +PGF QL  +D+I   +  ++ 
Sbjct: 253 PLGADPQSRDARQ--QRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQIALLKASTIE 310

Query: 287 CIVRAT-HLYV*RSS**YHLSQWATDEERLHPERCQCKFLVDSTFKFAERMNSMNLTDAE 463
            ++  T   Y   +     L  +   ++  H    Q +F ++  F+F+  M  + L DAE
Sbjct: 311 IMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEF-INPIFEFSRAMRRLGLDDAE 369

Query: 464 IGL 472
             L
Sbjct: 370 YAL 372


>BC047750-1|AAH47750.1|  461|Homo sapiens nuclear receptor subfamily
           1, group H, member 2 protein.
          Length = 461

 Score = 37.9 bits (84), Expect = 0.026
 Identities = 32/123 (26%), Positives = 58/123 (47%), Gaps = 9/123 (7%)
 Frame = +2

Query: 131 PLNPAPELQSEKEFSQRFAHV-------IRGVIDFAGLIPGF-QLLTQDEIHAAQKWSVR 286
           PL   P+ +  ++  QRFAH        ++ ++DFA  +PGF QL  +D+I   +  ++ 
Sbjct: 253 PLGADPQSRDARQ--QRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQIALLKASTIE 310

Query: 287 CIVRAT-HLYV*RSS**YHLSQWATDEERLHPERCQCKFLVDSTFKFAERMNSMNLTDAE 463
            ++  T   Y   +     L  +   ++  H    Q +F ++  F+F+  M  + L DAE
Sbjct: 311 IMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEF-INPIFEFSRAMRRLGLDDAE 369

Query: 464 IGL 472
             L
Sbjct: 370 YAL 372


>BC033500-1|AAH33500.1|  461|Homo sapiens nuclear receptor subfamily
           1, group H, member 2 protein.
          Length = 461

 Score = 37.9 bits (84), Expect = 0.026
 Identities = 32/123 (26%), Positives = 58/123 (47%), Gaps = 9/123 (7%)
 Frame = +2

Query: 131 PLNPAPELQSEKEFSQRFAHV-------IRGVIDFAGLIPGF-QLLTQDEIHAAQKWSVR 286
           PL   P+ +  ++  QRFAH        ++ ++DFA  +PGF QL  +D+I   +  ++ 
Sbjct: 253 PLGADPQSRDARQ--QRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQIALLKASTIE 310

Query: 287 CIVRAT-HLYV*RSS**YHLSQWATDEERLHPERCQCKFLVDSTFKFAERMNSMNLTDAE 463
            ++  T   Y   +     L  +   ++  H    Q +F ++  F+F+  M  + L DAE
Sbjct: 311 IMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEF-INPIFEFSRAMRRLGLDDAE 369

Query: 464 IGL 472
             L
Sbjct: 370 YAL 372


>BC007790-1|AAH07790.1|  461|Homo sapiens nuclear receptor subfamily
           1, group H, member 2 protein.
          Length = 461

 Score = 37.9 bits (84), Expect = 0.026
 Identities = 32/123 (26%), Positives = 58/123 (47%), Gaps = 9/123 (7%)
 Frame = +2

Query: 131 PLNPAPELQSEKEFSQRFAHV-------IRGVIDFAGLIPGF-QLLTQDEIHAAQKWSVR 286
           PL   P+ +  ++  QRFAH        ++ ++DFA  +PGF QL  +D+I   +  ++ 
Sbjct: 253 PLGADPQSRDARQ--QRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQIALLKASTIE 310

Query: 287 CIVRAT-HLYV*RSS**YHLSQWATDEERLHPERCQCKFLVDSTFKFAERMNSMNLTDAE 463
            ++  T   Y   +     L  +   ++  H    Q +F ++  F+F+  M  + L DAE
Sbjct: 311 IMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEF-INPIFEFSRAMRRLGLDDAE 369

Query: 464 IGL 472
             L
Sbjct: 370 YAL 372


>Y08639-1|CAA69929.1|  459|Homo sapiens nuclear orphan receptor
           ROR-beta protein.
          Length = 459

 Score = 33.5 bits (73), Expect = 0.57
 Identities = 36/158 (22%), Positives = 74/158 (46%), Gaps = 2/158 (1%)
 Frame = +2

Query: 8   RLLARVVRAHLDTCEFTRDRVASMRARARDCPTYSQPTLACPLNPAPELQSEKEFSQRFA 187
           R+   ++++HL+TC++T + +  +   A    TY +  +    + + E   + + + +  
Sbjct: 214 RIAQNIIKSHLETCQYTMEELHQL---AWQTHTYEE--IKAYQSKSREALWQ-QCAIQIT 267

Query: 188 HVIRGVIDFAGLIPGFQLLTQ-DEIHAAQKWSVRCI-VRATHLYV*RSS**YHLSQWATD 361
           H I+ V++FA  I GF  L Q D+I   +   +  + VR    +   ++      ++   
Sbjct: 268 HAIQYVVEFAKRITGFMELCQNDQILLLKSGCLEVVLVRMCRAFNPLNNTVLFEGKYGGM 327

Query: 362 EERLHPERCQCKFLVDSTFKFAERMNSMNLTDAEIGLF 475
           +     +      LV+  F FA+ + S+ LT+ EI LF
Sbjct: 328 QMF---KALGSDDLVNEAFDFAKNLCSLQLTEEEIALF 362


>BC093774-1|AAH93774.1|  459|Homo sapiens RAR-related orphan
           receptor B protein.
          Length = 459

 Score = 33.5 bits (73), Expect = 0.57
 Identities = 36/158 (22%), Positives = 74/158 (46%), Gaps = 2/158 (1%)
 Frame = +2

Query: 8   RLLARVVRAHLDTCEFTRDRVASMRARARDCPTYSQPTLACPLNPAPELQSEKEFSQRFA 187
           R+   ++++HL+TC++T + +  +   A    TY +  +    + + E   + + + +  
Sbjct: 214 RIAQNIIKSHLETCQYTMEELHQL---AWQTHTYEE--IKAYQSKSREALWQ-QCAIQIT 267

Query: 188 HVIRGVIDFAGLIPGFQLLTQ-DEIHAAQKWSVRCI-VRATHLYV*RSS**YHLSQWATD 361
           H I+ V++FA  I GF  L Q D+I   +   +  + VR    +   ++      ++   
Sbjct: 268 HAIQYVVEFAKRITGFMELCQNDQILLLKSGCLEVVLVRMCRAFNPLNNTVLFEGKYGGM 327

Query: 362 EERLHPERCQCKFLVDSTFKFAERMNSMNLTDAEIGLF 475
           +     +      LV+  F FA+ + S+ LT+ EI LF
Sbjct: 328 QMF---KALGSDDLVNEAFDFAKNLCSLQLTEEEIALF 362


>BC093772-1|AAH93772.1|  459|Homo sapiens RAR-related orphan
           receptor B protein.
          Length = 459

 Score = 33.5 bits (73), Expect = 0.57
 Identities = 36/158 (22%), Positives = 74/158 (46%), Gaps = 2/158 (1%)
 Frame = +2

Query: 8   RLLARVVRAHLDTCEFTRDRVASMRARARDCPTYSQPTLACPLNPAPELQSEKEFSQRFA 187
           R+   ++++HL+TC++T + +  +   A    TY +  +    + + E   + + + +  
Sbjct: 214 RIAQNIIKSHLETCQYTMEELHQL---AWQTHTYEE--IKAYQSKSREALWQ-QCAIQIT 267

Query: 188 HVIRGVIDFAGLIPGFQLLTQ-DEIHAAQKWSVRCI-VRATHLYV*RSS**YHLSQWATD 361
           H I+ V++FA  I GF  L Q D+I   +   +  + VR    +   ++      ++   
Sbjct: 268 HAIQYVVEFAKRITGFMELCQNDQILLLKSGCLEVVLVRMCRAFNPLNNTVLFEGKYGGM 327

Query: 362 EERLHPERCQCKFLVDSTFKFAERMNSMNLTDAEIGLF 475
           +     +      LV+  F FA+ + S+ LT+ EI LF
Sbjct: 328 QMF---KALGSDDLVNEAFDFAKNLCSLQLTEEEIALF 362


>BC051830-1|AAH51830.1|  459|Homo sapiens RAR-related orphan
           receptor B protein.
          Length = 459

 Score = 33.5 bits (73), Expect = 0.57
 Identities = 36/158 (22%), Positives = 74/158 (46%), Gaps = 2/158 (1%)
 Frame = +2

Query: 8   RLLARVVRAHLDTCEFTRDRVASMRARARDCPTYSQPTLACPLNPAPELQSEKEFSQRFA 187
           R+   ++++HL+TC++T + +  +   A    TY +  +    + + E   + + + +  
Sbjct: 214 RIAQNIIKSHLETCQYTMEELHQL---AWQTHTYEE--IKAYQSKSREALWQ-QCAIQIT 267

Query: 188 HVIRGVIDFAGLIPGFQLLTQ-DEIHAAQKWSVRCI-VRATHLYV*RSS**YHLSQWATD 361
           H I+ V++FA  I GF  L Q D+I   +   +  + VR    +   ++      ++   
Sbjct: 268 HAIQYVVEFAKRITGFMELCQNDQILLLKSGCLEVVLVRMCRAFNPLNNTVLFEGKYGGM 327

Query: 362 EERLHPERCQCKFLVDSTFKFAERMNSMNLTDAEIGLF 475
           +     +      LV+  F FA+ + S+ LT+ EI LF
Sbjct: 328 QMF---KALGSDDLVNEAFDFAKNLCSLQLTEEEIALF 362


>AL355674-1|CAD13280.2|  459|Homo sapiens RAR-related orphan
           receptor B protein.
          Length = 459

 Score = 33.5 bits (73), Expect = 0.57
 Identities = 36/158 (22%), Positives = 74/158 (46%), Gaps = 2/158 (1%)
 Frame = +2

Query: 8   RLLARVVRAHLDTCEFTRDRVASMRARARDCPTYSQPTLACPLNPAPELQSEKEFSQRFA 187
           R+   ++++HL+TC++T + +  +   A    TY +  +    + + E   + + + +  
Sbjct: 214 RIAQNIIKSHLETCQYTMEELHQL---AWQTHTYEE--IKAYQSKSREALWQ-QCAIQIT 267

Query: 188 HVIRGVIDFAGLIPGFQLLTQ-DEIHAAQKWSVRCI-VRATHLYV*RSS**YHLSQWATD 361
           H I+ V++FA  I GF  L Q D+I   +   +  + VR    +   ++      ++   
Sbjct: 268 HAIQYVVEFAKRITGFMELCQNDQILLLKSGCLEVVLVRMCRAFNPLNNTVLFEGKYGGM 327

Query: 362 EERLHPERCQCKFLVDSTFKFAERMNSMNLTDAEIGLF 475
           +     +      LV+  F FA+ + S+ LT+ EI LF
Sbjct: 328 QMF---KALGSDDLVNEAFDFAKNLCSLQLTEEEIALF 362


>AL137018-1|CAD13276.2|  459|Homo sapiens RAR-related orphan
           receptor B protein.
          Length = 459

 Score = 33.5 bits (73), Expect = 0.57
 Identities = 36/158 (22%), Positives = 74/158 (46%), Gaps = 2/158 (1%)
 Frame = +2

Query: 8   RLLARVVRAHLDTCEFTRDRVASMRARARDCPTYSQPTLACPLNPAPELQSEKEFSQRFA 187
           R+   ++++HL+TC++T + +  +   A    TY +  +    + + E   + + + +  
Sbjct: 214 RIAQNIIKSHLETCQYTMEELHQL---AWQTHTYEE--IKAYQSKSREALWQ-QCAIQIT 267

Query: 188 HVIRGVIDFAGLIPGFQLLTQ-DEIHAAQKWSVRCI-VRATHLYV*RSS**YHLSQWATD 361
           H I+ V++FA  I GF  L Q D+I   +   +  + VR    +   ++      ++   
Sbjct: 268 HAIQYVVEFAKRITGFMELCQNDQILLLKSGCLEVVLVRMCRAFNPLNNTVLFEGKYGGM 327

Query: 362 EERLHPERCQCKFLVDSTFKFAERMNSMNLTDAEIGLF 475
           +     +      LV+  F FA+ + S+ LT+ EI LF
Sbjct: 328 QMF---KALGSDDLVNEAFDFAKNLCSLQLTEEEIALF 362


>M24900-1|AAA52332.1|  136|Homo sapiens triiodothyronine receptor
           protein.
          Length = 136

 Score = 33.1 bits (72), Expect = 0.75
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 2/57 (3%)
 Frame = +2

Query: 401 LVDSTFKFAERMNSMNLTDAEIGLFW--XXXXXXRIGLLRNIELVERMHSRLRRACK 565
           L+ + F F+E++NS+ LT+ E+GLF         R G + N   VE++   L RA +
Sbjct: 38  LLSAMFDFSEKLNSLALTEEELGLFTAVVLVSADRSG-MENSASVEQLQETLLRALR 93


>Y00479-1|CAA68539.1|  490|Homo sapiens protein ( H.sapiens mRNA for
           thyroid hormone receptor. ).
          Length = 490

 Score = 31.5 bits (68), Expect = 2.3
 Identities = 29/121 (23%), Positives = 56/121 (46%), Gaps = 2/121 (1%)
 Frame = +2

Query: 116 PTLACPLNPAPELQSEKEFSQRFAHVIRGVIDFAGLIPGF-QLLTQDEIHAAQKWSVRCI 292
           P ++ P     +L++  EF++     I  V+DFA  +P F +L  +D+I   +   +  +
Sbjct: 200 PIVSMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFSELPCEDQIILLKGCCMEIM 259

Query: 293 -VRATHLYV*RSS**YHLSQWATDEERLHPERCQCKFLVDSTFKFAERMNSMNLTDAEIG 469
            +RA   Y   S       + A   E+L  +      + D+ F+  + +++ NL D E+ 
Sbjct: 260 SLRAAVRYDPESDTLTLSGEMAVKREQL--KNGGLGVVSDAIFELGKSLSAFNLDDTEVA 317

Query: 470 L 472
           L
Sbjct: 318 L 318


>X55005-1|CAA38749.1|  410|Homo sapiens thyriod hormone receptor
           alpha 1, THRA1 protein.
          Length = 410

 Score = 31.5 bits (68), Expect = 2.3
 Identities = 29/121 (23%), Positives = 56/121 (46%), Gaps = 2/121 (1%)
 Frame = +2

Query: 116 PTLACPLNPAPELQSEKEFSQRFAHVIRGVIDFAGLIPGF-QLLTQDEIHAAQKWSVRCI 292
           P ++ P     +L++  EF++     I  V+DFA  +P F +L  +D+I   +   +  +
Sbjct: 200 PIVSMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFSELPCEDQIILLKGCCMEIM 259

Query: 293 -VRATHLYV*RSS**YHLSQWATDEERLHPERCQCKFLVDSTFKFAERMNSMNLTDAEIG 469
            +RA   Y   S       + A   E+L  +      + D+ F+  + +++ NL D E+ 
Sbjct: 260 SLRAAVRYDPESDTLTLSGEMAVKREQL--KNGGLGVVSDAIFELGKSLSAFNLDDTEVA 317

Query: 470 L 472
           L
Sbjct: 318 L 318


>M24899-1|AAA35783.1|  490|Homo sapiens triiodothyronine receptor
           protein.
          Length = 490

 Score = 31.5 bits (68), Expect = 2.3
 Identities = 29/121 (23%), Positives = 56/121 (46%), Gaps = 2/121 (1%)
 Frame = +2

Query: 116 PTLACPLNPAPELQSEKEFSQRFAHVIRGVIDFAGLIPGF-QLLTQDEIHAAQKWSVRCI 292
           P ++ P     +L++  EF++     I  V+DFA  +P F +L  +D+I   +   +  +
Sbjct: 200 PIVSMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFSELPCEDQIILLKGCCMEIM 259

Query: 293 -VRATHLYV*RSS**YHLSQWATDEERLHPERCQCKFLVDSTFKFAERMNSMNLTDAEIG 469
            +RA   Y   S       + A   E+L  +      + D+ F+  + +++ NL D E+ 
Sbjct: 260 SLRAAVRYDPESDTLTLSGEMAVKREQL--KNGGLGVVSDAIFELGKSLSAFNLDDTEVA 317

Query: 470 L 472
           L
Sbjct: 318 L 318


>M24748-2|AAA66021.1|  410|Homo sapiens thyroid receptor alpha-1
           protein.
          Length = 410

 Score = 31.5 bits (68), Expect = 2.3
 Identities = 29/121 (23%), Positives = 56/121 (46%), Gaps = 2/121 (1%)
 Frame = +2

Query: 116 PTLACPLNPAPELQSEKEFSQRFAHVIRGVIDFAGLIPGF-QLLTQDEIHAAQKWSVRCI 292
           P ++ P     +L++  EF++     I  V+DFA  +P F +L  +D+I   +   +  +
Sbjct: 200 PIVSMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFSELPCEDQIILLKGCCMEIM 259

Query: 293 -VRATHLYV*RSS**YHLSQWATDEERLHPERCQCKFLVDSTFKFAERMNSMNLTDAEIG 469
            +RA   Y   S       + A   E+L  +      + D+ F+  + +++ NL D E+ 
Sbjct: 260 SLRAAVRYDPESDTLTLSGEMAVKREQL--KNGGLGVVSDAIFELGKSLSAFNLDDTEVA 317

Query: 470 L 472
           L
Sbjct: 318 L 318


>J03239-1|AAA61176.1|  490|Homo sapiens thyroid hormone receptor
           protein.
          Length = 490

 Score = 31.5 bits (68), Expect = 2.3
 Identities = 29/121 (23%), Positives = 56/121 (46%), Gaps = 2/121 (1%)
 Frame = +2

Query: 116 PTLACPLNPAPELQSEKEFSQRFAHVIRGVIDFAGLIPGF-QLLTQDEIHAAQKWSVRCI 292
           P ++ P     +L++  EF++     I  V+DFA  +P F +L  +D+I   +   +  +
Sbjct: 200 PIVSMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFSELPCEDQIILLKGCCMEIM 259

Query: 293 -VRATHLYV*RSS**YHLSQWATDEERLHPERCQCKFLVDSTFKFAERMNSMNLTDAEIG 469
            +RA   Y   S       + A   E+L  +      + D+ F+  + +++ NL D E+ 
Sbjct: 260 SLRAAVRYDPESDTLTLSGEMAVKREQL--KNGGLGVVSDAIFELGKSLSAFNLDDTEVA 317

Query: 470 L 472
           L
Sbjct: 318 L 318


>CR541915-1|CAG46713.1|  410|Homo sapiens THRA protein.
          Length = 410

 Score = 31.5 bits (68), Expect = 2.3
 Identities = 29/121 (23%), Positives = 56/121 (46%), Gaps = 2/121 (1%)
 Frame = +2

Query: 116 PTLACPLNPAPELQSEKEFSQRFAHVIRGVIDFAGLIPGF-QLLTQDEIHAAQKWSVRCI 292
           P ++ P     +L++  EF++     I  V+DFA  +P F +L  +D+I   +   +  +
Sbjct: 200 PIVSMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFSELPCEDQIILLKGCCMEIM 259

Query: 293 -VRATHLYV*RSS**YHLSQWATDEERLHPERCQCKFLVDSTFKFAERMNSMNLTDAEIG 469
            +RA   Y   S       + A   E+L  +      + D+ F+  + +++ NL D E+ 
Sbjct: 260 SLRAAVRYDPESDTLTLSGEMAVKREQL--KNGGLGVVSDAIFELGKSLSAFNLDDTEVA 317

Query: 470 L 472
           L
Sbjct: 318 L 318


>BC035137-1|AAH35137.1|  451|Homo sapiens THRA protein protein.
          Length = 451

 Score = 31.5 bits (68), Expect = 2.3
 Identities = 29/121 (23%), Positives = 56/121 (46%), Gaps = 2/121 (1%)
 Frame = +2

Query: 116 PTLACPLNPAPELQSEKEFSQRFAHVIRGVIDFAGLIPGF-QLLTQDEIHAAQKWSVRCI 292
           P ++ P     +L++  EF++     I  V+DFA  +P F +L  +D+I   +   +  +
Sbjct: 200 PIVSMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFSELPCEDQIILLKGCCMEIM 259

Query: 293 -VRATHLYV*RSS**YHLSQWATDEERLHPERCQCKFLVDSTFKFAERMNSMNLTDAEIG 469
            +RA   Y   S       + A   E+L  +      + D+ F+  + +++ NL D E+ 
Sbjct: 260 SLRAAVRYDPESDTLTLSGEMAVKREQL--KNGGLGVVSDAIFELGKSLSAFNLDDTEVA 317

Query: 470 L 472
           L
Sbjct: 318 L 318


>BC008851-1|AAH08851.1|  410|Homo sapiens THRA protein protein.
          Length = 410

 Score = 31.5 bits (68), Expect = 2.3
 Identities = 29/121 (23%), Positives = 56/121 (46%), Gaps = 2/121 (1%)
 Frame = +2

Query: 116 PTLACPLNPAPELQSEKEFSQRFAHVIRGVIDFAGLIPGF-QLLTQDEIHAAQKWSVRCI 292
           P ++ P     +L++  EF++     I  V+DFA  +P F +L  +D+I   +   +  +
Sbjct: 200 PIVSMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFSELPCEDQIILLKGCCMEIM 259

Query: 293 -VRATHLYV*RSS**YHLSQWATDEERLHPERCQCKFLVDSTFKFAERMNSMNLTDAEIG 469
            +RA   Y   S       + A   E+L  +      + D+ F+  + +++ NL D E+ 
Sbjct: 260 SLRAAVRYDPESDTLTLSGEMAVKREQL--KNGGLGVVSDAIFELGKSLSAFNLDDTEVA 317

Query: 470 L 472
           L
Sbjct: 318 L 318


>BC002728-1|AAH02728.1|  490|Homo sapiens thyroid hormone receptor,
           alpha (erythroblastic leukemia viral (v-erb-a) oncoge
           protein.
          Length = 490

 Score = 31.5 bits (68), Expect = 2.3
 Identities = 29/121 (23%), Positives = 56/121 (46%), Gaps = 2/121 (1%)
 Frame = +2

Query: 116 PTLACPLNPAPELQSEKEFSQRFAHVIRGVIDFAGLIPGF-QLLTQDEIHAAQKWSVRCI 292
           P ++ P     +L++  EF++     I  V+DFA  +P F +L  +D+I   +   +  +
Sbjct: 200 PIVSMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFSELPCEDQIILLKGCCMEIM 259

Query: 293 -VRATHLYV*RSS**YHLSQWATDEERLHPERCQCKFLVDSTFKFAERMNSMNLTDAEIG 469
            +RA   Y   S       + A   E+L  +      + D+ F+  + +++ NL D E+ 
Sbjct: 260 SLRAAVRYDPESDTLTLSGEMAVKREQL--KNGGLGVVSDAIFELGKSLSAFNLDDTEVA 317

Query: 470 L 472
           L
Sbjct: 318 L 318


>BC000261-1|AAH00261.1|  490|Homo sapiens thyroid hormone receptor,
           alpha (erythroblastic leukemia viral (v-erb-a) oncoge
           protein.
          Length = 490

 Score = 31.5 bits (68), Expect = 2.3
 Identities = 29/121 (23%), Positives = 56/121 (46%), Gaps = 2/121 (1%)
 Frame = +2

Query: 116 PTLACPLNPAPELQSEKEFSQRFAHVIRGVIDFAGLIPGF-QLLTQDEIHAAQKWSVRCI 292
           P ++ P     +L++  EF++     I  V+DFA  +P F +L  +D+I   +   +  +
Sbjct: 200 PIVSMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFSELPCEDQIILLKGCCMEIM 259

Query: 293 -VRATHLYV*RSS**YHLSQWATDEERLHPERCQCKFLVDSTFKFAERMNSMNLTDAEIG 469
            +RA   Y   S       + A   E+L  +      + D+ F+  + +++ NL D E+ 
Sbjct: 260 SLRAAVRYDPESDTLTLSGEMAVKREQL--KNGGLGVVSDAIFELGKSLSAFNLDDTEVA 317

Query: 470 L 472
           L
Sbjct: 318 L 318


>AB209346-1|BAD92583.1|  397|Homo sapiens thyroid hormone receptor,
           alpha isoform 1 variant protein.
          Length = 397

 Score = 31.5 bits (68), Expect = 2.3
 Identities = 29/121 (23%), Positives = 56/121 (46%), Gaps = 2/121 (1%)
 Frame = +2

Query: 116 PTLACPLNPAPELQSEKEFSQRFAHVIRGVIDFAGLIPGF-QLLTQDEIHAAQKWSVRCI 292
           P ++ P     +L++  EF++     I  V+DFA  +P F +L  +D+I   +   +  +
Sbjct: 187 PIVSMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFSELPCEDQIILLKGCCMEIM 246

Query: 293 -VRATHLYV*RSS**YHLSQWATDEERLHPERCQCKFLVDSTFKFAERMNSMNLTDAEIG 469
            +RA   Y   S       + A   E+L  +      + D+ F+  + +++ NL D E+ 
Sbjct: 247 SLRAAVRYDPESDTLTLSGEMAVKREQL--KNGGLGVVSDAIFELGKSLSAFNLDDTEVA 304

Query: 470 L 472
           L
Sbjct: 305 L 305


>AF006010-1|AAD01259.2| 2799|Homo sapiens progestin induced protein
            protein.
          Length = 2799

 Score = 30.3 bits (65), Expect = 5.3
 Identities = 16/46 (34%), Positives = 24/46 (52%)
 Frame = +2

Query: 137  NPAPELQSEKEFSQRFAHVIRGVIDFAGLIPGFQLLTQDEIHAAQK 274
            N +  L S    ++ ++ VIR + D  GLIP +  L   +I AA K
Sbjct: 1773 NASSYLTSASSLARAYSIVIRQISDLMGLIPKYNHLVYSQIPAAVK 1818


>AB020703-1|BAA74919.3| 2820|Homo sapiens KIAA0896 protein protein.
          Length = 2820

 Score = 30.3 bits (65), Expect = 5.3
 Identities = 16/46 (34%), Positives = 24/46 (52%)
 Frame = +2

Query: 137  NPAPELQSEKEFSQRFAHVIRGVIDFAGLIPGFQLLTQDEIHAAQK 274
            N +  L S    ++ ++ VIR + D  GLIP +  L   +I AA K
Sbjct: 1795 NASSYLTSASSLARAYSIVIRQISDLMGLIPKYNHLVYSQIPAAVK 1840


>U95000-1|AAF88143.1| 2798|Homo sapiens hyd protein protein.
          Length = 2798

 Score = 29.9 bits (64), Expect = 7.0
 Identities = 16/46 (34%), Positives = 24/46 (52%)
 Frame = +2

Query: 137  NPAPELQSEKEFSQRFAHVIRGVIDFAGLIPGFQLLTQDEIHAAQK 274
            N +  L S    ++ ++ VIR + D  GLIP +  L   +I AA K
Sbjct: 1772 NASSYLTSASSLARAYSIVIRQISDLMGLIPKYNHLVYPQIPAAVK 1817


>AK001542-1|BAA91748.1|  659|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10680 fis, clone NT2RP2006573, weakly similar to
           2',3'-CYCLIC NUCLEOTIDE 3'-PHOSPHODIESTERASE (EC
           3.1.4.37). ).
          Length = 659

 Score = 29.9 bits (64), Expect = 7.0
 Identities = 18/61 (29%), Positives = 32/61 (52%), Gaps = 3/61 (4%)
 Frame = -3

Query: 585 PVLCNDSLQARLSRECILSTSSMFRSRPIRSDEDY---SQKSPISASVKFMEFIRSANLK 415
           P++ + S+  ++ R  + + S   RS   R DED     +++ +S S+K +EF    NL 
Sbjct: 580 PIIMSSSVPEKIERIELCAYSCEDRSTSPRDDEDIISEKEENILSLSLKHLEFTEEKNLD 639

Query: 414 V 412
           V
Sbjct: 640 V 640


>Z83856-4|CAI18778.1| 1594|Homo sapiens DEP domain containing 5
           protein.
          Length = 1594

 Score = 29.5 bits (63), Expect = 9.2
 Identities = 14/42 (33%), Positives = 20/42 (47%)
 Frame = +2

Query: 38  LDTCEFTRDRVASMRARARDCPTYSQPTLACPLNPAPELQSE 163
           L TC   R+R +  R  A  C   S P+L     P  E++S+
Sbjct: 478 LTTCRSVRERESHSRKSASSCDVSSSPSLPSRTLPTEEVRSQ 519


>Z83856-3|CAI18779.1| 1572|Homo sapiens DEP domain containing 5
           protein.
          Length = 1572

 Score = 29.5 bits (63), Expect = 9.2
 Identities = 14/42 (33%), Positives = 20/42 (47%)
 Frame = +2

Query: 38  LDTCEFTRDRVASMRARARDCPTYSQPTLACPLNPAPELQSE 163
           L TC   R+R +  R  A  C   S P+L     P  E++S+
Sbjct: 478 LTTCRSVRERESHSRKSASSCDVSSSPSLPSRTLPTEEVRSQ 519


>Z83856-2|CAI18777.1| 1552|Homo sapiens DEP domain containing 5
           protein.
          Length = 1552

 Score = 29.5 bits (63), Expect = 9.2
 Identities = 14/42 (33%), Positives = 20/42 (47%)
 Frame = +2

Query: 38  LDTCEFTRDRVASMRARARDCPTYSQPTLACPLNPAPELQSE 163
           L TC   R+R +  R  A  C   S P+L     P  E++S+
Sbjct: 478 LTTCRSVRERESHSRKSASSCDVSSSPSLPSRTLPTEEVRSQ 519


>Z82190-4|CAI19699.1| 1594|Homo sapiens DEP domain containing 5
           protein.
          Length = 1594

 Score = 29.5 bits (63), Expect = 9.2
 Identities = 14/42 (33%), Positives = 20/42 (47%)
 Frame = +2

Query: 38  LDTCEFTRDRVASMRARARDCPTYSQPTLACPLNPAPELQSE 163
           L TC   R+R +  R  A  C   S P+L     P  E++S+
Sbjct: 478 LTTCRSVRERESHSRKSASSCDVSSSPSLPSRTLPTEEVRSQ 519


>Z82190-3|CAI19698.1| 1572|Homo sapiens DEP domain containing 5
           protein.
          Length = 1572

 Score = 29.5 bits (63), Expect = 9.2
 Identities = 14/42 (33%), Positives = 20/42 (47%)
 Frame = +2

Query: 38  LDTCEFTRDRVASMRARARDCPTYSQPTLACPLNPAPELQSE 163
           L TC   R+R +  R  A  C   S P+L     P  E++S+
Sbjct: 478 LTTCRSVRERESHSRKSASSCDVSSSPSLPSRTLPTEEVRSQ 519


>Z82190-2|CAI19697.1| 1552|Homo sapiens DEP domain containing 5
           protein.
          Length = 1552

 Score = 29.5 bits (63), Expect = 9.2
 Identities = 14/42 (33%), Positives = 20/42 (47%)
 Frame = +2

Query: 38  LDTCEFTRDRVASMRARARDCPTYSQPTLACPLNPAPELQSE 163
           L TC   R+R +  R  A  C   S P+L     P  E++S+
Sbjct: 478 LTTCRSVRERESHSRKSASSCDVSSSPSLPSRTLPTEEVRSQ 519


>BC146766-1|AAI46767.1| 1572|Homo sapiens DEP domain containing 5
           protein.
          Length = 1572

 Score = 29.5 bits (63), Expect = 9.2
 Identities = 14/42 (33%), Positives = 20/42 (47%)
 Frame = +2

Query: 38  LDTCEFTRDRVASMRARARDCPTYSQPTLACPLNPAPELQSE 163
           L TC   R+R +  R  A  C   S P+L     P  E++S+
Sbjct: 478 LTTCRSVRERESHSRKSASSCDVSSSPSLPSRTLPTEEVRSQ 519


>BC057797-1|AAH57797.1|  559|Homo sapiens DEP domain containing 5
           protein.
          Length = 559

 Score = 29.5 bits (63), Expect = 9.2
 Identities = 14/42 (33%), Positives = 20/42 (47%)
 Frame = +2

Query: 38  LDTCEFTRDRVASMRARARDCPTYSQPTLACPLNPAPELQSE 163
           L TC   R+R +  R  A  C   S P+L     P  E++S+
Sbjct: 478 LTTCRSVRERESHSRKSASSCDVSSSPSLPSRTLPTEEVRSQ 519


>AL022331-6|CAI17976.1| 1594|Homo sapiens DEP domain containing 5
           protein.
          Length = 1594

 Score = 29.5 bits (63), Expect = 9.2
 Identities = 14/42 (33%), Positives = 20/42 (47%)
 Frame = +2

Query: 38  LDTCEFTRDRVASMRARARDCPTYSQPTLACPLNPAPELQSE 163
           L TC   R+R +  R  A  C   S P+L     P  E++S+
Sbjct: 478 LTTCRSVRERESHSRKSASSCDVSSSPSLPSRTLPTEEVRSQ 519


>AL022331-5|CAI17975.1| 1572|Homo sapiens DEP domain containing 5
           protein.
          Length = 1572

 Score = 29.5 bits (63), Expect = 9.2
 Identities = 14/42 (33%), Positives = 20/42 (47%)
 Frame = +2

Query: 38  LDTCEFTRDRVASMRARARDCPTYSQPTLACPLNPAPELQSE 163
           L TC   R+R +  R  A  C   S P+L     P  E++S+
Sbjct: 478 LTTCRSVRERESHSRKSASSCDVSSSPSLPSRTLPTEEVRSQ 519


>AL022331-4|CAI17974.1| 1552|Homo sapiens DEP domain containing 5
           protein.
          Length = 1552

 Score = 29.5 bits (63), Expect = 9.2
 Identities = 14/42 (33%), Positives = 20/42 (47%)
 Frame = +2

Query: 38  LDTCEFTRDRVASMRARARDCPTYSQPTLACPLNPAPELQSE 163
           L TC   R+R +  R  A  C   S P+L     P  E++S+
Sbjct: 478 LTTCRSVRERESHSRKSASSCDVSSSPSLPSRTLPTEEVRSQ 519


>AL022331-3|CAI17973.1|  559|Homo sapiens DEP domain containing 5
           protein.
          Length = 559

 Score = 29.5 bits (63), Expect = 9.2
 Identities = 14/42 (33%), Positives = 20/42 (47%)
 Frame = +2

Query: 38  LDTCEFTRDRVASMRARARDCPTYSQPTLACPLNPAPELQSE 163
           L TC   R+R +  R  A  C   S P+L     P  E++S+
Sbjct: 478 LTTCRSVRERESHSRKSASSCDVSSSPSLPSRTLPTEEVRSQ 519


>AJ704764-1|CAG28924.1| 1572|Homo sapiens DEP domain containing 5
           variant 1 (DEPDC5_v1) protein.
          Length = 1572

 Score = 29.5 bits (63), Expect = 9.2
 Identities = 14/42 (33%), Positives = 20/42 (47%)
 Frame = +2

Query: 38  LDTCEFTRDRVASMRARARDCPTYSQPTLACPLNPAPELQSE 163
           L TC   R+R +  R  A  C   S P+L     P  E++S+
Sbjct: 478 LTTCRSVRERESHSRKSASSCDVSSSPSLPSRTLPTEEVRSQ 519


>AJ698951-1|CAG27890.1| 1503|Homo sapiens DEPDC5 protein variant 3
           protein.
          Length = 1503

 Score = 29.5 bits (63), Expect = 9.2
 Identities = 14/42 (33%), Positives = 20/42 (47%)
 Frame = +2

Query: 38  LDTCEFTRDRVASMRARARDCPTYSQPTLACPLNPAPELQSE 163
           L TC   R+R +  R  A  C   S P+L     P  E++S+
Sbjct: 478 LTTCRSVRERESHSRKSASSCDVSSSPSLPSRTLPTEEVRSQ 519


>AJ698950-1|CAG27889.1| 1594|Homo sapiens DEPDC5 protein variant 1
           protein.
          Length = 1594

 Score = 29.5 bits (63), Expect = 9.2
 Identities = 14/42 (33%), Positives = 20/42 (47%)
 Frame = +2

Query: 38  LDTCEFTRDRVASMRARARDCPTYSQPTLACPLNPAPELQSE 163
           L TC   R+R +  R  A  C   S P+L     P  E++S+
Sbjct: 478 LTTCRSVRERESHSRKSASSCDVSSSPSLPSRTLPTEEVRSQ 519


>AB014545-1|BAA31620.2| 1578|Homo sapiens KIAA0645 protein protein.
          Length = 1578

 Score = 29.5 bits (63), Expect = 9.2
 Identities = 14/42 (33%), Positives = 20/42 (47%)
 Frame = +2

Query: 38  LDTCEFTRDRVASMRARARDCPTYSQPTLACPLNPAPELQSE 163
           L TC   R+R +  R  A  C   S P+L     P  E++S+
Sbjct: 484 LTTCRSVRERESHSRKSASSCDVSSSPSLPSRTLPTEEVRSQ 525


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 84,179,233
Number of Sequences: 237096
Number of extensions: 1706161
Number of successful extensions: 12148
Number of sequences better than 10.0: 66
Number of HSP's better than 10.0 without gapping: 11797
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12112
length of database: 76,859,062
effective HSP length: 86
effective length of database: 56,468,806
effective search space used: 6155099854
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -