SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20018
         (688 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

L42542-1|AAB00103.1|  655|Homo sapiens RLIP76 protein protein.         58   4e-08
BC013126-1|AAH13126.1|  655|Homo sapiens ralA binding protein 1 ...    58   4e-08
AB209924-1|BAD93161.1|  462|Homo sapiens ralA binding protein 1 ...    44   4e-04
AL137287-1|CAB70679.1| 1397|Homo sapiens hypothetical protein pr...    39   0.015
AK001923-1|BAA91979.1|  526|Homo sapiens protein ( Homo sapiens ...    39   0.015
AF117888-1|AAD49195.1| 2548|Homo sapiens myosin-IXa protein.           39   0.015
BC063126-1|AAH63126.1|  202|Homo sapiens FAM13A1 protein protein.      38   0.034
AY517554-1|AAT44527.1|  407|Homo sapiens hypothetical rhabdomyos...    38   0.044
Z23024-1|CAA80560.1|  439|Homo sapiens rhoGAP protein protein.         37   0.077
U62794-1|AAB66594.1|  223|Homo sapiens CDC42 GAP-related protein...    37   0.077
U02570-1|AAA16142.1|  462|Homo sapiens CDC42 GTPase-activating p...    37   0.077
BC056887-1|AAH56887.1|  915|Homo sapiens chromosome 5 open readi...    37   0.077
BC048965-1|AAH48965.1|  887|Homo sapiens C5orf5 protein protein.       37   0.077
BC018118-1|AAH18118.1|  439|Homo sapiens Rho GTPase activating p...    37   0.077
AF251038-1|AAF63764.1|  915|Homo sapiens GAP-like protein protein.     36   0.10 
BC150257-1|AAI50258.1| 1499|Homo sapiens GRLF1 protein protein.        35   0.24 
AF159851-1|AAF80386.1| 1514|Homo sapiens Rho GAP p190-A protein.       35   0.24 
AB051509-1|BAB21813.2| 1499|Homo sapiens KIAA1722 protein protein.     35   0.24 
BC065274-1|AAH65274.1|  545|Homo sapiens ARHGAP28 protein protein.     35   0.31 
BC033668-1|AAH33668.1|  390|Homo sapiens ARHGAP28 protein protein.     35   0.31 
AK001174-1|BAA91533.1|  383|Homo sapiens protein ( Homo sapiens ...    35   0.31 
AB037735-1|BAA92552.1|  681|Homo sapiens KIAA1314 protein protein.     35   0.31 
BC098580-1|AAH98580.1|  653|Homo sapiens Rho GTPase activating p...    34   0.41 
BC047918-1|AAH47918.1|  246|Homo sapiens ARHGAP24 protein protein.     34   0.41 
AK091196-1|BAC03606.1|  748|Homo sapiens protein ( Homo sapiens ...    34   0.41 
BX537846-1|CAD97855.1|  243|Homo sapiens hypothetical protein pr...    33   1.3  
BC053688-1|AAH53688.1|  890|Homo sapiens Rho GTPase activating p...    33   1.3  
AL591806-11|CAI15374.1|  890|Homo sapiens Rho GTPase activating ...    33   1.3  
AL591806-10|CAI15373.1|  577|Homo sapiens Rho GTPase activating ...    33   1.3  
AK160366-1|BAD18709.1| 1110|Homo sapiens FLJ00267 protein protein.     33   1.3  
EF560749-1|ABQ59059.1|  698|Homo sapiens ARHGAP22 protein protein.     32   2.2  
BC132874-1|AAI32875.1| 1071|Homo sapiens SLIT-ROBO Rho GTPase ac...    32   2.2  
BC132872-1|AAI32873.1| 1071|Homo sapiens SLIT-ROBO Rho GTPase ac...    32   2.2  
BC126444-1|AAI26445.1|  714|Homo sapiens ARHGAP22 protein protein.     32   2.2  
AY324801-1|AAP85632.1|  698|Homo sapiens Rho GTPase activating p...    32   2.2  
AL161736-3|CAH73675.1|  450|Homo sapiens SLIT-ROBO Rho GTPase ac...    32   2.2  
AL161736-2|CAH73674.1|  984|Homo sapiens SLIT-ROBO Rho GTPase ac...    32   2.2  
AK127586-1|BAC87044.1|  608|Homo sapiens protein ( Homo sapiens ...    32   2.2  
AB037725-1|BAA92542.1| 1051|Homo sapiens KIAA1304 protein protein.     32   2.2  
AB007925-1|BAA32301.1| 1095|Homo sapiens KIAA0456 protein protein.     32   2.2  
AF464189-1|AAN57784.1| 1075|Homo sapiens WAVE-associated Rac GTP...    31   2.9  
AF177665-1|AAD55087.1|  562|Homo sapiens rho GTPase-activating p...    31   2.9  
AF177663-1|AAD53166.1|  771|Homo sapiens GTPase-activating prote...    31   2.9  
AF117067-1|AAF43261.1|  974|Homo sapiens rho-type GTPase-activat...    31   2.9  
AF022212-1|AAC98540.2|  690|Homo sapiens Rho GTPase activating p...    31   2.9  
AF012272-1|AAC98539.2|  765|Homo sapiens Rho GTPase activating p...    31   2.9  
AB208792-1|BAD92029.1|  729|Homo sapiens Rho GTPase activating p...    31   2.9  
AB007871-1|BAA24841.2| 1061|Homo sapiens KIAA0411 protein.             31   2.9  
Z82203-1|CAI42695.1|  802|Homo sapiens oligophrenin 1 protein.         31   3.8  
BC128055-1|AAI28056.1|  786|Homo sapiens Rho GTPase activating p...    31   3.8  
BC126899-1|AAI26900.1|  785|Homo sapiens ARHGAP10 protein protein.     31   3.8  
BC109030-1|AAI09031.1|  782|Homo sapiens ARHGAP10 protein protein.     31   3.8  
BC109029-1|AAI09030.1|  782|Homo sapiens ARHGAP10 protein protein.     31   3.8  
BC047914-1|AAH47914.1|  367|Homo sapiens ARHGAP10 protein protein.     31   3.8  
BC011920-1|AAH11920.2|  629|Homo sapiens ARHGAP10 protein protein.     31   3.8  
AL834360-1|CAD39024.1|  333|Homo sapiens hypothetical protein pr...    31   3.8  
AL672138-1|CAI41508.1|  802|Homo sapiens oligophrenin 1 protein.       31   3.8  
AL158201-3|CAI40982.1|  802|Homo sapiens oligophrenin 1 protein.       31   3.8  
AL157700-1|CAD18899.2|  802|Homo sapiens oligophrenin 1 protein.       31   3.8  
AJ248245-1|CAB96181.1|  802|Homo sapiens oligophrenin-1 protein.       31   3.8  
AJ001189-1|CAA04579.1|  802|Homo sapiens oligophrenin 1 protein.       31   3.8  
AB102656-1|BAC81125.1|  802|Homo sapiens oligophrenin 1 protein.       31   3.8  
AB050785-1|BAB61771.1|  786|Homo sapiens Graf2 protein.                31   3.8  
U17032-1|AAA95963.1| 1499|Homo sapiens p190-B protein.                 31   5.1  
D87717-1|BAA13442.2| 1086|Homo sapiens KIAA0013 protein.               31   5.1  
BC105788-1|AAI05789.1|  267|Homo sapiens Rho GTPase activating p...    31   5.1  
BC063444-1|AAH63444.1|  501|Homo sapiens Rho GTPase activating p...    31   5.1  
BC039563-1|AAH39563.1| 1023|Homo sapiens Rho GTPase activating p...    31   5.1  
BC029926-1|AAH29926.1|  668|Homo sapiens SYDE1 protein protein.        31   5.1  
AK123686-1|BAC85676.1|  735|Homo sapiens protein ( Homo sapiens ...    31   5.1  
AF427144-1|AAN07095.1| 1099|Homo sapiens MEGAP transcript varian...    31   5.1  
AC004794-2|AAC18917.1|  512|Homo sapiens F02569_2 protein.             31   5.1  
D29642-1|BAA06125.2|  666|Homo sapiens KIAA0053 protein.               30   6.7  
BC050059-1|AAH50059.1| 1502|Homo sapiens ARHGAP5 protein protein.      30   6.7  
AL392104-9|CAI40181.1|  113|Homo sapiens Rho GTPase activating p...    30   6.7  
AC097495-2|AAY15074.1|  558|Homo sapiens unknown protein.              30   6.7  
AB209751-1|BAD92988.1| 1138|Homo sapiens Rho GTPase activating p...    30   6.7  
BC128586-1|AAI28587.1|  748|Homo sapiens SNX26 protein protein.        30   8.9  
AK127255-1|BAC86902.1| 1007|Homo sapiens protein ( Homo sapiens ...    30   8.9  
AC002398-4|AAB81198.1|  903|Homo sapiens F25965_3 protein.             30   8.9  

>L42542-1|AAB00103.1|  655|Homo sapiens RLIP76 protein protein.
          Length = 655

 Score = 57.6 bits (133), Expect = 4e-08
 Identities = 25/60 (41%), Positives = 38/60 (63%)
 Frame = +3

Query: 279 PIFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF 458
           PIFG+PL  +VER+  +D   LP V R+ IDY++ +G+K + IYR    K K  +L+  +
Sbjct: 188 PIFGIPLADAVERTMMYDGIRLPAVFRECIDYVEKYGMKCEGIYRVSGIKSKVDELKAAY 247



 Score = 31.9 bits (69), Expect = 2.2
 Identities = 12/26 (46%), Positives = 22/26 (84%)
 Frame = +2

Query: 509 AMLKAFISELPESILTQELHGQFEQA 586
           ++LK ++ +LPE++LT+EL  +FE+A
Sbjct: 265 SLLKQYLRDLPENLLTKELMPRFEEA 290


>BC013126-1|AAH13126.1|  655|Homo sapiens ralA binding protein 1
           protein.
          Length = 655

 Score = 57.6 bits (133), Expect = 4e-08
 Identities = 25/60 (41%), Positives = 38/60 (63%)
 Frame = +3

Query: 279 PIFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF 458
           PIFG+PL  +VER+  +D   LP V R+ IDY++ +G+K + IYR    K K  +L+  +
Sbjct: 188 PIFGIPLADAVERTMMYDGIRLPAVFRECIDYVEKYGMKCEGIYRVSGIKSKVDELKAAY 247



 Score = 31.9 bits (69), Expect = 2.2
 Identities = 12/26 (46%), Positives = 22/26 (84%)
 Frame = +2

Query: 509 AMLKAFISELPESILTQELHGQFEQA 586
           ++LK ++ +LPE++LT+EL  +FE+A
Sbjct: 265 SLLKQYLRDLPENLLTKELMPRFEEA 290


>AB209924-1|BAD93161.1|  462|Homo sapiens ralA binding protein 1
           variant protein.
          Length = 462

 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 20/54 (37%), Positives = 32/54 (59%)
 Frame = +3

Query: 297 LQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF 458
           L  +VER+  +D   LP V R+ IDY++ +G+K + IYR    K K  +L+  +
Sbjct: 1   LADAVERTMMYDGIRLPAVFRECIDYVEKYGMKCEGIYRVSGIKSKVDELKAAY 54



 Score = 31.9 bits (69), Expect = 2.2
 Identities = 12/26 (46%), Positives = 22/26 (84%)
 Frame = +2

Query: 509 AMLKAFISELPESILTQELHGQFEQA 586
           ++LK ++ +LPE++LT+EL  +FE+A
Sbjct: 72  SLLKQYLRDLPENLLTKELMPRFEEA 97


>AL137287-1|CAB70679.1| 1397|Homo sapiens hypothetical protein
            protein.
          Length = 1397

 Score = 39.1 bits (87), Expect = 0.015
 Identities = 24/57 (42%), Positives = 34/57 (59%), Gaps = 2/57 (3%)
 Frame = +3

Query: 300  QQSVERSRC-HDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRK-LFTD 464
            Q  VE SR   +D  +PLVV   I+Y++ HGL ++ IYR      K ++LR+ L TD
Sbjct: 909  QFGVELSRLTSEDRTVPLVVEKLINYIEMHGLYTEGIYRKSGSTNKIKELRQGLDTD 965


>AK001923-1|BAA91979.1|  526|Homo sapiens protein ( Homo sapiens
           cDNA FLJ11061 fis, clone PLACE1004777, weakly similar to
           N-CHIMAERIN. ).
          Length = 526

 Score = 39.1 bits (87), Expect = 0.015
 Identities = 24/57 (42%), Positives = 34/57 (59%), Gaps = 2/57 (3%)
 Frame = +3

Query: 300 QQSVERSRC-HDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRK-LFTD 464
           Q  VE SR   +D  +PLVV   I+Y++ HGL ++ IYR      K ++LR+ L TD
Sbjct: 38  QFGVELSRLTSEDRTVPLVVEKLINYIEMHGLYTEGIYRKSGSTNKIKELRQGLDTD 94


>AF117888-1|AAD49195.1| 2548|Homo sapiens myosin-IXa protein.
          Length = 2548

 Score = 39.1 bits (87), Expect = 0.015
 Identities = 24/57 (42%), Positives = 34/57 (59%), Gaps = 2/57 (3%)
 Frame = +3

Query: 300  QQSVERSRC-HDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRK-LFTD 464
            Q  VE SR   +D  +PLVV   I+Y++ HGL ++ IYR      K ++LR+ L TD
Sbjct: 2060 QFGVELSRLTSEDRTVPLVVEKLINYIEMHGLYTEGIYRKSGSTNKIKELRQGLDTD 2116


>BC063126-1|AAH63126.1|  202|Homo sapiens FAM13A1 protein protein.
          Length = 202

 Score = 37.9 bits (84), Expect = 0.034
 Identities = 22/64 (34%), Positives = 36/64 (56%)
 Frame = +3

Query: 282 IFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLFT 461
           +FGV LQ+ +ER    ++ G+P VV + ++YL  HGL  + ++R   +    +QLR  F 
Sbjct: 40  LFGVSLQE-LERQGLTEN-GIPAVVWNIVEYLTQHGLTQEGLFRVNGNVKVVEQLRLKFE 97

Query: 462 DRGP 473
              P
Sbjct: 98  SGVP 101


>AY517554-1|AAT44527.1|  407|Homo sapiens hypothetical
           rhabdomyosarcoma antigen MU-RMS-40.2A protein.
          Length = 407

 Score = 37.5 bits (83), Expect = 0.044
 Identities = 16/44 (36%), Positives = 26/44 (59%)
 Frame = +3

Query: 327 HDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF 458
           +D   LP V R+ IDY++ +G+K + IYR    K K  +L+  +
Sbjct: 3   YDGIRLPAVFRECIDYVEKYGMKCEGIYRVSGIKSKVDELKAAY 46



 Score = 31.9 bits (69), Expect = 2.2
 Identities = 12/26 (46%), Positives = 22/26 (84%)
 Frame = +2

Query: 509 AMLKAFISELPESILTQELHGQFEQA 586
           ++LK ++ +LPE++LT+EL  +FE+A
Sbjct: 64  SLLKQYLRDLPENLLTKELMPRFEEA 89


>Z23024-1|CAA80560.1|  439|Homo sapiens rhoGAP protein protein.
          Length = 439

 Score = 36.7 bits (81), Expect = 0.077
 Identities = 17/43 (39%), Positives = 29/43 (67%)
 Frame = +3

Query: 285 FGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYR 413
           FGV LQ   E++   +   +P+V+R+++ YLQAH L ++ I+R
Sbjct: 242 FGVSLQHLQEKNP--EQEPIPIVLRETVAYLQAHALTTEGIFR 282


>U62794-1|AAB66594.1|  223|Homo sapiens CDC42 GAP-related protein
           protein.
          Length = 223

 Score = 36.7 bits (81), Expect = 0.077
 Identities = 17/43 (39%), Positives = 29/43 (67%)
 Frame = +3

Query: 285 FGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYR 413
           FGV LQ   E++   +   +P+V+R+++ YLQAH L ++ I+R
Sbjct: 138 FGVSLQHLQEKNP--EQEPIPIVLRETVAYLQAHALTTEGIFR 178


>U02570-1|AAA16142.1|  462|Homo sapiens CDC42 GTPase-activating
           protein protein.
          Length = 462

 Score = 36.7 bits (81), Expect = 0.077
 Identities = 17/43 (39%), Positives = 29/43 (67%)
 Frame = +3

Query: 285 FGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYR 413
           FGV LQ   E++   +   +P+V+R+++ YLQAH L ++ I+R
Sbjct: 265 FGVSLQHLQEKNP--EQEPIPIVLRETVAYLQAHALTTEGIFR 305


>BC056887-1|AAH56887.1|  915|Homo sapiens chromosome 5 open reading
           frame 5 protein.
          Length = 915

 Score = 36.7 bits (81), Expect = 0.077
 Identities = 18/64 (28%), Positives = 36/64 (56%), Gaps = 1/64 (1%)
 Frame = +3

Query: 270 VALPIFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAH-GLKSKDIYRTEPDKIKFQQL 446
           +A  IFG+PL +  +    H D  +P +VR  +DY++ H GL+ + +++   +    + L
Sbjct: 16  LANKIFGIPLDELQQGG--HPDNEVPFIVRHVVDYIEEHGGLEQQGLFQVNGNAETVEWL 73

Query: 447 RKLF 458
           R+ +
Sbjct: 74  RQRY 77


>BC048965-1|AAH48965.1|  887|Homo sapiens C5orf5 protein protein.
          Length = 887

 Score = 36.7 bits (81), Expect = 0.077
 Identities = 18/64 (28%), Positives = 36/64 (56%), Gaps = 1/64 (1%)
 Frame = +3

Query: 270 VALPIFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAH-GLKSKDIYRTEPDKIKFQQL 446
           +A  IFG+PL +  +    H D  +P +VR  +DY++ H GL+ + +++   +    + L
Sbjct: 16  LANKIFGIPLDELQQGG--HPDNEVPFIVRHVVDYIEEHGGLEQQGLFQVNGNAETVEWL 73

Query: 447 RKLF 458
           R+ +
Sbjct: 74  RQRY 77


>BC018118-1|AAH18118.1|  439|Homo sapiens Rho GTPase activating
           protein 1 protein.
          Length = 439

 Score = 36.7 bits (81), Expect = 0.077
 Identities = 17/43 (39%), Positives = 29/43 (67%)
 Frame = +3

Query: 285 FGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYR 413
           FGV LQ   E++   +   +P+V+R+++ YLQAH L ++ I+R
Sbjct: 242 FGVSLQHLQEKNP--EQEPIPIVLRETVAYLQAHALTTEGIFR 282


>AF251038-1|AAF63764.1|  915|Homo sapiens GAP-like protein protein.
          Length = 915

 Score = 36.3 bits (80), Expect = 0.10
 Identities = 18/64 (28%), Positives = 36/64 (56%), Gaps = 1/64 (1%)
 Frame = +3

Query: 270 VALPIFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAH-GLKSKDIYRTEPDKIKFQQL 446
           +A  IFG+PL +  +    H D  +P +VR  +DY++ H GL+ + +++   +    + L
Sbjct: 16  LANKIFGIPLDELQQGG--HPDIEVPFIVRHVVDYIEEHGGLEQQGLFQVNGNAETVEWL 73

Query: 447 RKLF 458
           R+ +
Sbjct: 74  RQRY 77


>BC150257-1|AAI50258.1| 1499|Homo sapiens GRLF1 protein protein.
          Length = 1499

 Score = 35.1 bits (77), Expect = 0.24
 Identities = 18/58 (31%), Positives = 32/58 (55%)
 Frame = +3

Query: 285  FGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF 458
            FGVPL   V   +      +P+ +   I+Y++A GL ++ IYR   +K + + L++ F
Sbjct: 1247 FGVPLTTVVTPEK-----PIPIFIERCIEYIEATGLSTEGIYRVSGNKSEMESLQRQF 1299


>AF159851-1|AAF80386.1| 1514|Homo sapiens Rho GAP p190-A protein.
          Length = 1514

 Score = 35.1 bits (77), Expect = 0.24
 Identities = 18/58 (31%), Positives = 32/58 (55%)
 Frame = +3

Query: 285  FGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF 458
            FGVPL   V   +      +P+ +   I+Y++A GL ++ IYR   +K + + L++ F
Sbjct: 1248 FGVPLTTVVTPEK-----PIPIFIERCIEYIEATGLSTEGIYRVSGNKSEIESLQRQF 1300


>AB051509-1|BAB21813.2| 1499|Homo sapiens KIAA1722 protein protein.
          Length = 1499

 Score = 35.1 bits (77), Expect = 0.24
 Identities = 18/58 (31%), Positives = 32/58 (55%)
 Frame = +3

Query: 285  FGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF 458
            FGVPL   V   +      +P+ +   I+Y++A GL ++ IYR   +K + + L++ F
Sbjct: 1247 FGVPLTTVVTPEK-----PIPIFIERCIEYIEATGLSTEGIYRVSGNKSEMESLQRQF 1299


>BC065274-1|AAH65274.1|  545|Homo sapiens ARHGAP28 protein protein.
          Length = 545

 Score = 34.7 bits (76), Expect = 0.31
 Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 1/72 (1%)
 Frame = +3

Query: 282 IFGVPLQQSVERSRCHDD-TGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF 458
           IFGVPL   ++  R  D    +PLV++   + ++  GL+S+ I+R      K +Q R+  
Sbjct: 200 IFGVPLTVLLDGDRKKDPGVKVPLVLQKFFEKVEESGLESEGIFRLSGCTAKVKQYREEL 259

Query: 459 TDRGPTFPYHWD 494
             +     + WD
Sbjct: 260 DAKFNADKFKWD 271


>BC033668-1|AAH33668.1|  390|Homo sapiens ARHGAP28 protein protein.
          Length = 390

 Score = 34.7 bits (76), Expect = 0.31
 Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 1/72 (1%)
 Frame = +3

Query: 282 IFGVPLQQSVERSRCHDD-TGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF 458
           IFGVPL   ++  R  D    +PLV++   + ++  GL+S+ I+R      K +Q R+  
Sbjct: 38  IFGVPLTVLLDGDRKKDPGVKVPLVLQKFFEKVEESGLESEGIFRLSGCTAKVKQYREEL 97

Query: 459 TDRGPTFPYHWD 494
             +     + WD
Sbjct: 98  DAKFNADKFKWD 109


>AK001174-1|BAA91533.1|  383|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10312 fis, clone NT2RM2000363, weakly similar to
           BREAKPOINT CLUSTER REGION PROTEIN. ).
          Length = 383

 Score = 34.7 bits (76), Expect = 0.31
 Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 1/72 (1%)
 Frame = +3

Query: 282 IFGVPLQQSVERSRCHDD-TGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF 458
           IFGVPL   ++  R  D    +PLV++   + ++  GL+S+ I+R      K +Q R+  
Sbjct: 38  IFGVPLTVLLDGDRKKDPGVKVPLVLQKFFEKVEESGLESEGIFRLSGCTAKVKQYREEL 97

Query: 459 TDRGPTFPYHWD 494
             +     + WD
Sbjct: 98  DAKFNADKFKWD 109


>AB037735-1|BAA92552.1|  681|Homo sapiens KIAA1314 protein protein.
          Length = 681

 Score = 34.7 bits (76), Expect = 0.31
 Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 1/72 (1%)
 Frame = +3

Query: 282 IFGVPLQQSVERSRCHDD-TGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF 458
           IFGVPL   ++  R  D    +PLV++   + ++  GL+S+ I+R      K +Q R+  
Sbjct: 336 IFGVPLTVLLDGDRKKDPGVKVPLVLQKFFEKVEESGLESEGIFRLSGCTAKVKQYREEL 395

Query: 459 TDRGPTFPYHWD 494
             +     + WD
Sbjct: 396 DAKFNADKFKWD 407


>BC098580-1|AAH98580.1|  653|Homo sapiens Rho GTPase activating
           protein 24 protein.
          Length = 653

 Score = 34.3 bits (75), Expect = 0.41
 Identities = 18/73 (24%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +3

Query: 282 IFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF- 458
           IFG  L+ +V   + + +   P++V   +D+++  GLK + ++R        ++L+  F 
Sbjct: 37  IFGQKLEDTVRYEKRYGNRLAPMLVEQCVDFIRQRGLKEEGLFRLPGQANLVKELQDAFD 96

Query: 459 TDRGPTFPYHWDV 497
               P+F  + DV
Sbjct: 97  CGEKPSFDSNTDV 109


>BC047918-1|AAH47918.1|  246|Homo sapiens ARHGAP24 protein protein.
          Length = 246

 Score = 34.3 bits (75), Expect = 0.41
 Identities = 18/73 (24%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +3

Query: 282 IFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF- 458
           IFG  L+ +V   + + +   P++V   +D+++  GLK + ++R        ++L+  F 
Sbjct: 132 IFGQKLEDTVRYEKRYGNRLAPMLVEQCVDFIRQRGLKEEGLFRLPGQANLVKELQDAFD 191

Query: 459 TDRGPTFPYHWDV 497
               P+F  + DV
Sbjct: 192 CGEKPSFDSNTDV 204


>AK091196-1|BAC03606.1|  748|Homo sapiens protein ( Homo sapiens
           cDNA FLJ33877 fis, clone CTONG2007072, weakly similar to
           N-CHIMAERIN. ).
          Length = 748

 Score = 34.3 bits (75), Expect = 0.41
 Identities = 18/73 (24%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +3

Query: 282 IFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF- 458
           IFG  L+ +V   + + +   P++V   +D+++  GLK + ++R        ++L+  F 
Sbjct: 132 IFGQKLEDAVRYEKRYGNRLAPMLVEQCVDFIRQRGLKEEGLFRLPGQANLVKELQDAFD 191

Query: 459 TDRGPTFPYHWDV 497
               P+F  + DV
Sbjct: 192 CGEKPSFDSNTDV 204


>BX537846-1|CAD97855.1|  243|Homo sapiens hypothetical protein
           protein.
          Length = 243

 Score = 32.7 bits (71), Expect = 1.3
 Identities = 14/38 (36%), Positives = 24/38 (63%), Gaps = 1/38 (2%)
 Frame = +2

Query: 500 CRLAMLKAFISELPESILTQELHGQFEQATAI-AEPQR 610
           C  ++ KA+  ELP+ +LT  L+ +F +A  +  EP+R
Sbjct: 89  CVSSLCKAYFRELPDPLLTYRLYDKFAEAVGVQLEPER 126


>BC053688-1|AAH53688.1|  890|Homo sapiens Rho GTPase activating
           protein 30 protein.
          Length = 890

 Score = 32.7 bits (71), Expect = 1.3
 Identities = 14/38 (36%), Positives = 24/38 (63%), Gaps = 1/38 (2%)
 Frame = +2

Query: 500 CRLAMLKAFISELPESILTQELHGQFEQATAI-AEPQR 610
           C  ++ KA+  ELP+ +LT  L+ +F +A  +  EP+R
Sbjct: 89  CVSSLCKAYFRELPDPLLTYRLYDKFAEAVGVQLEPER 126


>AL591806-11|CAI15374.1|  890|Homo sapiens Rho GTPase activating
           protein 30 protein.
          Length = 890

 Score = 32.7 bits (71), Expect = 1.3
 Identities = 14/38 (36%), Positives = 24/38 (63%), Gaps = 1/38 (2%)
 Frame = +2

Query: 500 CRLAMLKAFISELPESILTQELHGQFEQATAI-AEPQR 610
           C  ++ KA+  ELP+ +LT  L+ +F +A  +  EP+R
Sbjct: 89  CVSSLCKAYFRELPDPLLTYRLYDKFAEAVGVQLEPER 126


>AL591806-10|CAI15373.1|  577|Homo sapiens Rho GTPase activating
           protein 30 protein.
          Length = 577

 Score = 32.7 bits (71), Expect = 1.3
 Identities = 14/38 (36%), Positives = 24/38 (63%), Gaps = 1/38 (2%)
 Frame = +2

Query: 500 CRLAMLKAFISELPESILTQELHGQFEQATAI-AEPQR 610
           C  ++ KA+  ELP+ +LT  L+ +F +A  +  EP+R
Sbjct: 89  CVSSLCKAYFRELPDPLLTYRLYDKFAEAVGVQLEPER 126


>AK160366-1|BAD18709.1| 1110|Homo sapiens FLJ00267 protein protein.
          Length = 1110

 Score = 32.7 bits (71), Expect = 1.3
 Identities = 14/38 (36%), Positives = 24/38 (63%), Gaps = 1/38 (2%)
 Frame = +2

Query: 500 CRLAMLKAFISELPESILTQELHGQFEQATAI-AEPQR 610
           C  ++ KA+  ELP+ +LT  L+ +F +A  +  EP+R
Sbjct: 98  CVSSLCKAYFRELPDPLLTYRLYDKFAEAVGVQLEPER 135


>EF560749-1|ABQ59059.1|  698|Homo sapiens ARHGAP22 protein protein.
          Length = 698

 Score = 31.9 bits (69), Expect = 2.2
 Identities = 13/44 (29%), Positives = 25/44 (56%)
 Frame = +3

Query: 282 IFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYR 413
           IFG  L+++V   R +     PL+V   +D+++  GL  + ++R
Sbjct: 152 IFGQRLEETVHHERKYGPRLAPLLVEQCVDFIRERGLTEEGLFR 195


>BC132874-1|AAI32875.1| 1071|Homo sapiens SLIT-ROBO Rho GTPase
           activating protein 2 protein.
          Length = 1071

 Score = 31.9 bits (69), Expect = 2.2
 Identities = 13/43 (30%), Positives = 25/43 (58%)
 Frame = +3

Query: 342 LPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLFTDRG 470
           +PLVV   I ++  HGL+ + I+R    +++   ++  F +RG
Sbjct: 504 IPLVVESCIRFISRHGLQHEGIFRVSGSQVEVNDIKNAF-ERG 545


>BC132872-1|AAI32873.1| 1071|Homo sapiens SLIT-ROBO Rho GTPase
           activating protein 2 protein.
          Length = 1071

 Score = 31.9 bits (69), Expect = 2.2
 Identities = 13/43 (30%), Positives = 25/43 (58%)
 Frame = +3

Query: 342 LPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLFTDRG 470
           +PLVV   I ++  HGL+ + I+R    +++   ++  F +RG
Sbjct: 504 IPLVVESCIRFISRHGLQHEGIFRVSGSQVEVNDIKNAF-ERG 545


>BC126444-1|AAI26445.1|  714|Homo sapiens ARHGAP22 protein protein.
          Length = 714

 Score = 31.9 bits (69), Expect = 2.2
 Identities = 13/44 (29%), Positives = 25/44 (56%)
 Frame = +3

Query: 282 IFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYR 413
           IFG  L+++V   R +     PL+V   +D+++  GL  + ++R
Sbjct: 168 IFGQRLEETVHHERKYGPRLAPLLVEQCVDFIRERGLTEEGLFR 211


>AY324801-1|AAP85632.1|  698|Homo sapiens Rho GTPase activating
           protein 2 protein.
          Length = 698

 Score = 31.9 bits (69), Expect = 2.2
 Identities = 13/44 (29%), Positives = 25/44 (56%)
 Frame = +3

Query: 282 IFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYR 413
           IFG  L+++V   R +     PL+V   +D+++  GL  + ++R
Sbjct: 152 IFGQRLEETVHHERKYGPRLAPLLVEQCVDFIRERGLTEEGLFR 195


>AL161736-3|CAH73675.1|  450|Homo sapiens SLIT-ROBO Rho GTPase
           activating protein 2 protein.
          Length = 450

 Score = 31.9 bits (69), Expect = 2.2
 Identities = 13/43 (30%), Positives = 25/43 (58%)
 Frame = +3

Query: 342 LPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLFTDRG 470
           +PLVV   I ++  HGL+ + I+R    +++   ++  F +RG
Sbjct: 118 IPLVVESCIRFISRHGLQHEGIFRVSGSQVEVNDIKNAF-ERG 159


>AL161736-2|CAH73674.1|  984|Homo sapiens SLIT-ROBO Rho GTPase
           activating protein 2 protein.
          Length = 984

 Score = 31.9 bits (69), Expect = 2.2
 Identities = 13/43 (30%), Positives = 25/43 (58%)
 Frame = +3

Query: 342 LPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLFTDRG 470
           +PLVV   I ++  HGL+ + I+R    +++   ++  F +RG
Sbjct: 417 IPLVVESCIRFISRHGLQHEGIFRVSGSQVEVNDIKNAF-ERG 458


>AK127586-1|BAC87044.1|  608|Homo sapiens protein ( Homo sapiens
           cDNA FLJ45681 fis, clone ERLTF2002369. ).
          Length = 608

 Score = 31.9 bits (69), Expect = 2.2
 Identities = 13/44 (29%), Positives = 25/44 (56%)
 Frame = +3

Query: 282 IFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYR 413
           IFG  L+++V   R +     PL+V   +D+++  GL  + ++R
Sbjct: 62  IFGQRLEETVHHERKYGPRLAPLLVEQCVDFIRERGLTEEGLFR 105


>AB037725-1|BAA92542.1| 1051|Homo sapiens KIAA1304 protein protein.
          Length = 1051

 Score = 31.9 bits (69), Expect = 2.2
 Identities = 14/50 (28%), Positives = 29/50 (58%), Gaps = 2/50 (4%)
 Frame = +3

Query: 327 HDDTG--LPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLFTDRG 470
           H D+G  +PL+V   I ++  +GL+ + I+R    +++   ++  F +RG
Sbjct: 478 HQDSGQVIPLIVESCIRFINLYGLQHQGIFRVSGSQVEVNDIKNSF-ERG 526


>AB007925-1|BAA32301.1| 1095|Homo sapiens KIAA0456 protein protein.
          Length = 1095

 Score = 31.9 bits (69), Expect = 2.2
 Identities = 13/43 (30%), Positives = 25/43 (58%)
 Frame = +3

Query: 342 LPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLFTDRG 470
           +PLVV   I ++  HGL+ + I+R    +++   ++  F +RG
Sbjct: 528 IPLVVESCIRFISRHGLQHEGIFRVSGSQVEVNDIKNAF-ERG 569


>AF464189-1|AAN57784.1| 1075|Homo sapiens WAVE-associated Rac GTPase
           activating protein protein.
          Length = 1075

 Score = 31.5 bits (68), Expect = 2.9
 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 1/53 (1%)
 Frame = +3

Query: 315 RSRCHDD-TGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLFTDRG 470
           R+R  D    +PLVV   I Y+  +GL+ + I+R    +++   ++  F +RG
Sbjct: 485 RTRNQDSGQAIPLVVESCIRYINLYGLQQQGIFRVPGSQVEVNDIKNSF-ERG 536


>AF177665-1|AAD55087.1|  562|Homo sapiens rho GTPase-activating
           protein 6 isoform 5 protein.
          Length = 562

 Score = 31.5 bits (68), Expect = 2.9
 Identities = 16/43 (37%), Positives = 26/43 (60%)
 Frame = +3

Query: 342 LPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLFTDRG 470
           +P +V     +L+ HGL++  I+R    K + +QLR+ F DRG
Sbjct: 207 VPRLVDSCCQHLEKHGLQTVGIFRVGSSKKRVRQLREEF-DRG 248


>AF177663-1|AAD53166.1|  771|Homo sapiens GTPase-activating protein
           6 isoform 4 protein.
          Length = 771

 Score = 31.5 bits (68), Expect = 2.9
 Identities = 16/43 (37%), Positives = 26/43 (60%)
 Frame = +3

Query: 342 LPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLFTDRG 470
           +P +V     +L+ HGL++  I+R    K + +QLR+ F DRG
Sbjct: 207 VPRLVDSCCQHLEKHGLQTVGIFRVGSSKKRVRQLREEF-DRG 248


>AF117067-1|AAF43261.1|  974|Homo sapiens rho-type GTPase-activating
           protein isoform 3 protein.
          Length = 974

 Score = 31.5 bits (68), Expect = 2.9
 Identities = 16/43 (37%), Positives = 26/43 (60%)
 Frame = +3

Query: 342 LPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLFTDRG 470
           +P +V     +L+ HGL++  I+R    K + +QLR+ F DRG
Sbjct: 410 VPRLVDSCCQHLEKHGLQTVGIFRVGSSKKRVRQLREEF-DRG 451


>AF022212-1|AAC98540.2|  690|Homo sapiens Rho GTPase activating
           protein 6 isoform 2 protein.
          Length = 690

 Score = 31.5 bits (68), Expect = 2.9
 Identities = 16/43 (37%), Positives = 26/43 (60%)
 Frame = +3

Query: 342 LPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLFTDRG 470
           +P +V     +L+ HGL++  I+R    K + +QLR+ F DRG
Sbjct: 442 VPRLVDSCCQHLEKHGLQTVGIFRVGSSKKRVRQLREEF-DRG 483


>AF012272-1|AAC98539.2|  765|Homo sapiens Rho GTPase activating
           protein 6 isoform 3 protein.
          Length = 765

 Score = 31.5 bits (68), Expect = 2.9
 Identities = 16/43 (37%), Positives = 26/43 (60%)
 Frame = +3

Query: 342 LPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLFTDRG 470
           +P +V     +L+ HGL++  I+R    K + +QLR+ F DRG
Sbjct: 410 VPRLVDSCCQHLEKHGLQTVGIFRVGSSKKRVRQLREEF-DRG 451


>AB208792-1|BAD92029.1|  729|Homo sapiens Rho GTPase activating
           protein 6 isoform 1 variant protein.
          Length = 729

 Score = 31.5 bits (68), Expect = 2.9
 Identities = 16/43 (37%), Positives = 26/43 (60%)
 Frame = +3

Query: 342 LPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLFTDRG 470
           +P +V     +L+ HGL++  I+R    K + +QLR+ F DRG
Sbjct: 481 VPRLVDSCCQHLEKHGLQTVGIFRVGSSKKRVRQLREEF-DRG 522


>AB007871-1|BAA24841.2| 1061|Homo sapiens KIAA0411 protein.
          Length = 1061

 Score = 31.5 bits (68), Expect = 2.9
 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 1/53 (1%)
 Frame = +3

Query: 315 RSRCHDD-TGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLFTDRG 470
           R+R  D    +PLVV   I Y+  +GL+ + I+R    +++   ++  F +RG
Sbjct: 471 RTRNQDSGQAIPLVVESCIRYINLYGLQQQGIFRVPGSQVEVNDIKNSF-ERG 522


>Z82203-1|CAI42695.1|  802|Homo sapiens oligophrenin 1 protein.
          Length = 802

 Score = 31.1 bits (67), Expect = 3.8
 Identities = 18/62 (29%), Positives = 32/62 (51%)
 Frame = +3

Query: 279 PIFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF 458
           PI+  P+ +  E     ++ G   V R  I+ ++  G+K++ +YRT    I+ Q+L   F
Sbjct: 368 PIYHSPITKQQEMEL--NEVGFKFV-RKCINIIETKGIKTEGLYRTVGSNIQVQKLLNAF 424

Query: 459 TD 464
            D
Sbjct: 425 FD 426


>BC128055-1|AAI28056.1|  786|Homo sapiens Rho GTPase activating
           protein 10 protein.
          Length = 786

 Score = 31.1 bits (67), Expect = 3.8
 Identities = 12/41 (29%), Positives = 20/41 (48%)
 Frame = +2

Query: 515 LKAFISELPESILTQELHGQFEQATAIAEPQREATMTNLII 637
           LK ++  LPE ++T ELHG F        P+      + ++
Sbjct: 459 LKQYLRSLPEPLMTYELHGDFIVPAKSGSPESRVNAIHFLV 499


>BC126899-1|AAI26900.1|  785|Homo sapiens ARHGAP10 protein protein.
          Length = 785

 Score = 31.1 bits (67), Expect = 3.8
 Identities = 12/41 (29%), Positives = 20/41 (48%)
 Frame = +2

Query: 515 LKAFISELPESILTQELHGQFEQATAIAEPQREATMTNLII 637
           LK ++  LPE ++T ELHG F        P+      + ++
Sbjct: 457 LKQYLRSLPEPLMTYELHGDFIVPAKSGSPESRVNAIHFLV 497


>BC109030-1|AAI09031.1|  782|Homo sapiens ARHGAP10 protein protein.
          Length = 782

 Score = 31.1 bits (67), Expect = 3.8
 Identities = 12/41 (29%), Positives = 20/41 (48%)
 Frame = +2

Query: 515 LKAFISELPESILTQELHGQFEQATAIAEPQREATMTNLII 637
           LK ++  LPE ++T ELHG F        P+      + ++
Sbjct: 455 LKQYLRSLPEPLMTYELHGDFIVPAKSGSPESRVNAIHFLV 495


>BC109029-1|AAI09030.1|  782|Homo sapiens ARHGAP10 protein protein.
          Length = 782

 Score = 31.1 bits (67), Expect = 3.8
 Identities = 12/41 (29%), Positives = 20/41 (48%)
 Frame = +2

Query: 515 LKAFISELPESILTQELHGQFEQATAIAEPQREATMTNLII 637
           LK ++  LPE ++T ELHG F        P+      + ++
Sbjct: 455 LKQYLRSLPEPLMTYELHGDFIVPAKSGSPESRVNAIHFLV 495


>BC047914-1|AAH47914.1|  367|Homo sapiens ARHGAP10 protein protein.
          Length = 367

 Score = 31.1 bits (67), Expect = 3.8
 Identities = 12/41 (29%), Positives = 20/41 (48%)
 Frame = +2

Query: 515 LKAFISELPESILTQELHGQFEQATAIAEPQREATMTNLII 637
           LK ++  LPE ++T ELHG F        P+      + ++
Sbjct: 40  LKQYLRSLPEPLMTYELHGDFIVPAKSGSPESRVNAIHFLV 80


>BC011920-1|AAH11920.2|  629|Homo sapiens ARHGAP10 protein protein.
          Length = 629

 Score = 31.1 bits (67), Expect = 3.8
 Identities = 12/41 (29%), Positives = 20/41 (48%)
 Frame = +2

Query: 515 LKAFISELPESILTQELHGQFEQATAIAEPQREATMTNLII 637
           LK ++  LPE ++T ELHG F        P+      + ++
Sbjct: 302 LKQYLRSLPEPLMTYELHGDFIVPAKSGSPESRVNAIHFLV 342


>AL834360-1|CAD39024.1|  333|Homo sapiens hypothetical protein
           protein.
          Length = 333

 Score = 31.1 bits (67), Expect = 3.8
 Identities = 12/41 (29%), Positives = 20/41 (48%)
 Frame = +2

Query: 515 LKAFISELPESILTQELHGQFEQATAIAEPQREATMTNLII 637
           LK ++  LPE ++T ELHG F        P+      + ++
Sbjct: 6   LKQYLRSLPEPLMTYELHGDFIVPAKSGSPESRVNAIHFLV 46


>AL672138-1|CAI41508.1|  802|Homo sapiens oligophrenin 1 protein.
          Length = 802

 Score = 31.1 bits (67), Expect = 3.8
 Identities = 18/62 (29%), Positives = 32/62 (51%)
 Frame = +3

Query: 279 PIFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF 458
           PI+  P+ +  E     ++ G   V R  I+ ++  G+K++ +YRT    I+ Q+L   F
Sbjct: 368 PIYHSPITKQQEMEL--NEVGFKFV-RKCINIIETKGIKTEGLYRTVGSNIQVQKLLNAF 424

Query: 459 TD 464
            D
Sbjct: 425 FD 426


>AL158201-3|CAI40982.1|  802|Homo sapiens oligophrenin 1 protein.
          Length = 802

 Score = 31.1 bits (67), Expect = 3.8
 Identities = 18/62 (29%), Positives = 32/62 (51%)
 Frame = +3

Query: 279 PIFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF 458
           PI+  P+ +  E     ++ G   V R  I+ ++  G+K++ +YRT    I+ Q+L   F
Sbjct: 368 PIYHSPITKQQEMEL--NEVGFKFV-RKCINIIETKGIKTEGLYRTVGSNIQVQKLLNAF 424

Query: 459 TD 464
            D
Sbjct: 425 FD 426


>AL157700-1|CAD18899.2|  802|Homo sapiens oligophrenin 1 protein.
          Length = 802

 Score = 31.1 bits (67), Expect = 3.8
 Identities = 18/62 (29%), Positives = 32/62 (51%)
 Frame = +3

Query: 279 PIFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF 458
           PI+  P+ +  E     ++ G   V R  I+ ++  G+K++ +YRT    I+ Q+L   F
Sbjct: 368 PIYHSPITKQQEMEL--NEVGFKFV-RKCINIIETKGIKTEGLYRTVGSNIQVQKLLNAF 424

Query: 459 TD 464
            D
Sbjct: 425 FD 426


>AJ248245-1|CAB96181.1|  802|Homo sapiens oligophrenin-1 protein.
          Length = 802

 Score = 31.1 bits (67), Expect = 3.8
 Identities = 18/62 (29%), Positives = 32/62 (51%)
 Frame = +3

Query: 279 PIFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF 458
           PI+  P+ +  E     ++ G   V R  I+ ++  G+K++ +YRT    I+ Q+L   F
Sbjct: 368 PIYHSPITKQQEMEL--NEVGFKFV-RKCINIIETKGIKTEGLYRTVGSNIQVQKLLNAF 424

Query: 459 TD 464
            D
Sbjct: 425 FD 426


>AJ001189-1|CAA04579.1|  802|Homo sapiens oligophrenin 1 protein.
          Length = 802

 Score = 31.1 bits (67), Expect = 3.8
 Identities = 18/62 (29%), Positives = 32/62 (51%)
 Frame = +3

Query: 279 PIFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF 458
           PI+  P+ +  E     ++ G   V R  I+ ++  G+K++ +YRT    I+ Q+L   F
Sbjct: 368 PIYHSPITKQQEMEL--NEVGFKFV-RKCINIIETKGIKTEGLYRTVGSNIQVQKLLNAF 424

Query: 459 TD 464
            D
Sbjct: 425 FD 426


>AB102656-1|BAC81125.1|  802|Homo sapiens oligophrenin 1 protein.
          Length = 802

 Score = 31.1 bits (67), Expect = 3.8
 Identities = 18/62 (29%), Positives = 32/62 (51%)
 Frame = +3

Query: 279 PIFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF 458
           PI+  P+ +  E     ++ G   V R  I+ ++  G+K++ +YRT    I+ Q+L   F
Sbjct: 368 PIYHSPITKQQEMEL--NEVGFKFV-RKCINIIETKGIKTEGLYRTVGSNIQVQKLLNAF 424

Query: 459 TD 464
            D
Sbjct: 425 FD 426


>AB050785-1|BAB61771.1|  786|Homo sapiens Graf2 protein.
          Length = 786

 Score = 31.1 bits (67), Expect = 3.8
 Identities = 12/41 (29%), Positives = 20/41 (48%)
 Frame = +2

Query: 515 LKAFISELPESILTQELHGQFEQATAIAEPQREATMTNLII 637
           LK ++  LPE ++T ELHG F        P+      + ++
Sbjct: 459 LKQYLRSLPEPLMTYELHGDFIVPAKSGSPESRVNAIHFLV 499


>U17032-1|AAA95963.1| 1499|Homo sapiens p190-B protein.
          Length = 1499

 Score = 30.7 bits (66), Expect = 5.1
 Identities = 16/58 (27%), Positives = 31/58 (53%)
 Frame = +3

Query: 285  FGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF 458
            FG+PLQ  V   +      +PL V   +++++  GL ++ +YR   +K   + ++K F
Sbjct: 1257 FGMPLQDLVTAEK-----PIPLFVEKCVEFIEDTGLCTERLYRVSGNKTDQENIQKQF 1309


>D87717-1|BAA13442.2| 1086|Homo sapiens KIAA0013 protein.
          Length = 1086

 Score = 30.7 bits (66), Expect = 5.1
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
 Frame = +2

Query: 500 CRLA-MLKAFISELPESILTQELHGQFEQATAIAEPQREATMTNLIISC 643
           C +A +LK F  ELPE IL  +LH    +A  +     E     L++SC
Sbjct: 178 CDIAGLLKQFFRELPEPILPADLHEALLKAQQLG--TEEKNKATLLLSC 224


>BC105788-1|AAI05789.1|  267|Homo sapiens Rho GTPase activating
           protein 11B protein.
          Length = 267

 Score = 30.7 bits (66), Expect = 5.1
 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = +2

Query: 500 CRLA-MLKAFISELPESILTQELHGQFEQATAIAEPQREATMTNLIISC 643
           C +A +LK F  ELPE IL  +LH    +A  +   ++   +  L++SC
Sbjct: 115 CDIAGLLKQFFRELPEPILPADLHEALLKAQQLGTEEKNKAI--LLLSC 161


>BC063444-1|AAH63444.1|  501|Homo sapiens Rho GTPase activating
           protein 11A protein.
          Length = 501

 Score = 30.7 bits (66), Expect = 5.1
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
 Frame = +2

Query: 500 CRLA-MLKAFISELPESILTQELHGQFEQATAIAEPQREATMTNLIISC 643
           C +A +LK F  ELPE IL  +LH    +A  +     E     L++SC
Sbjct: 115 CDIAGLLKQFFRELPEPILPADLHEALLKAQQLG--TEEKNKATLLLSC 161


>BC039563-1|AAH39563.1| 1023|Homo sapiens Rho GTPase activating
           protein 11A protein.
          Length = 1023

 Score = 30.7 bits (66), Expect = 5.1
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
 Frame = +2

Query: 500 CRLA-MLKAFISELPESILTQELHGQFEQATAIAEPQREATMTNLIISC 643
           C +A +LK F  ELPE IL  +LH    +A  +     E     L++SC
Sbjct: 115 CDIAGLLKQFFRELPEPILPADLHEALLKAQQLG--TEEKNKATLLLSC 161


>BC029926-1|AAH29926.1|  668|Homo sapiens SYDE1 protein protein.
          Length = 668

 Score = 30.7 bits (66), Expect = 5.1
 Identities = 17/59 (28%), Positives = 30/59 (50%)
 Frame = +3

Query: 282 IFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF 458
           +FG+PL   VER R      +PL+++  +  ++  GL+   +YR        ++LR  F
Sbjct: 328 VFGLPLPLLVERERPPGQ--VPLIIQKCVGQIERRGLRVVGLYRLCGSAAVKKELRDAF 384


>AK123686-1|BAC85676.1|  735|Homo sapiens protein ( Homo sapiens
           cDNA FLJ41692 fis, clone HCHON2000028, highly  similar
           to Homo sapiens 7h3 protein mRNA. ).
          Length = 735

 Score = 30.7 bits (66), Expect = 5.1
 Identities = 17/59 (28%), Positives = 30/59 (50%)
 Frame = +3

Query: 282 IFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF 458
           +FG+PL   VER R      +PL+++  +  ++  GL+   +YR        ++LR  F
Sbjct: 395 VFGLPLPLLVERERPPGQ--VPLIIQKCVGQIERRGLRVVGLYRLCGSAAVKKELRDAF 451


>AF427144-1|AAN07095.1| 1099|Homo sapiens MEGAP transcript variant a
           protein.
          Length = 1099

 Score = 30.7 bits (66), Expect = 5.1
 Identities = 13/43 (30%), Positives = 25/43 (58%)
 Frame = +3

Query: 342 LPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLFTDRG 470
           +PLVV   I Y+  +GL+ + I+R    +++   ++  F +RG
Sbjct: 519 IPLVVESCIRYINLYGLQQQGIFRVPGSQVEVNDIKNSF-ERG 560


>AC004794-2|AAC18917.1|  512|Homo sapiens F02569_2 protein.
          Length = 512

 Score = 30.7 bits (66), Expect = 5.1
 Identities = 17/59 (28%), Positives = 30/59 (50%)
 Frame = +3

Query: 282 IFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF 458
           +FG+PL   VER R      +PL+++  +  ++  GL+   +YR        ++LR  F
Sbjct: 236 VFGLPLPLLVERERPPGQ--VPLIIQKCVGQIERRGLRVVGLYRLCGSAAVKKELRDAF 292


>D29642-1|BAA06125.2|  666|Homo sapiens KIAA0053 protein.
          Length = 666

 Score = 30.3 bits (65), Expect = 6.7
 Identities = 24/89 (26%), Positives = 38/89 (42%), Gaps = 2/89 (2%)
 Frame = +3

Query: 237 WCSF*RIFTLGVALPIFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRT 416
           W  F R    G    +FG  L ++V   +      +P++V    +++  HG   + I+R 
Sbjct: 163 WVKFLRRVA-GTPCGVFGQRLDETVAYEQKFGPHLVPILVEKCAEFILEHGRNEEGIFRL 221

Query: 417 EPDKIKFQQLRKLFTDRG--PTFPYHWDV 497
                  +QLR  F D G  P+F    DV
Sbjct: 222 PGQDNLVKQLRDAF-DAGERPSFDRDTDV 249


>BC050059-1|AAH50059.1| 1502|Homo sapiens ARHGAP5 protein protein.
          Length = 1502

 Score = 30.3 bits (65), Expect = 6.7
 Identities = 16/58 (27%), Positives = 30/58 (51%)
 Frame = +3

Query: 285  FGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF 458
            FG+PLQ  V   +      +PL V   +++++  GL ++ +YR   +K     ++K F
Sbjct: 1260 FGMPLQDLVTAEK-----PIPLFVEKCVEFIEDTGLCTEGLYRVSGNKTDQDNIQKQF 1312


>AL392104-9|CAI40181.1|  113|Homo sapiens Rho GTPase activating
           protein 21 protein.
          Length = 113

 Score = 30.3 bits (65), Expect = 6.7
 Identities = 15/52 (28%), Positives = 27/52 (51%), Gaps = 1/52 (1%)
 Frame = +2

Query: 509 AMLKAFISELPESILTQELHGQFEQATAIAEP-QREATMTNLIISCRTVTTS 661
           ++LK+F  +LPE + T + +  F +A    +P  R  T+  L +S    T +
Sbjct: 62  SLLKSFFRKLPEPLFTNDKYADFIEANRKEDPLDRLKTLKRLFLSAHLKTVA 113


>AC097495-2|AAY15074.1|  558|Homo sapiens unknown protein.
          Length = 558

 Score = 30.3 bits (65), Expect = 6.7
 Identities = 24/89 (26%), Positives = 38/89 (42%), Gaps = 2/89 (2%)
 Frame = +3

Query: 237 WCSF*RIFTLGVALPIFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRT 416
           W  F R    G    +FG  L ++V   +      +P++V    +++  HG   + I+R 
Sbjct: 55  WVKFLRRVA-GTPCGVFGQRLDETVAYEQKFGPHLVPILVEKCAEFILEHGRNEEGIFRL 113

Query: 417 EPDKIKFQQLRKLFTDRG--PTFPYHWDV 497
                  +QLR  F D G  P+F    DV
Sbjct: 114 PGQDNLVKQLRDAF-DAGERPSFDRDTDV 141


>AB209751-1|BAD92988.1| 1138|Homo sapiens Rho GTPase activating
            protein 5 variant protein.
          Length = 1138

 Score = 30.3 bits (65), Expect = 6.7
 Identities = 16/58 (27%), Positives = 30/58 (51%)
 Frame = +3

Query: 285  FGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF 458
            FG+PLQ  V   +      +PL V   +++++  GL ++ +YR   +K     ++K F
Sbjct: 896  FGMPLQDLVTAEK-----PIPLFVEKCVEFIEDTGLCTEGLYRVSGNKTDQDNIQKQF 948


>BC128586-1|AAI28587.1|  748|Homo sapiens SNX26 protein protein.
          Length = 748

 Score = 29.9 bits (64), Expect = 8.9
 Identities = 13/43 (30%), Positives = 27/43 (62%), Gaps = 1/43 (2%)
 Frame = +2

Query: 509 AMLKAFISELPESILTQELHGQFEQATAI-AEPQREATMTNLI 634
           ++ K +  ELP  +LT +L+G+F +A ++  E +R   + ++I
Sbjct: 387 SLCKLYFRELPNPLLTYQLYGKFSEAMSVPGEEERLVRVHDVI 429


>AK127255-1|BAC86902.1| 1007|Homo sapiens protein ( Homo sapiens
           cDNA FLJ45322 fis, clone BRHIP3006294, moderately
           similar to Mus musculus Cdc42 GTPase-activating protein
           (Cdgap). ).
          Length = 1007

 Score = 29.9 bits (64), Expect = 8.9
 Identities = 13/43 (30%), Positives = 27/43 (62%), Gaps = 1/43 (2%)
 Frame = +2

Query: 509 AMLKAFISELPESILTQELHGQFEQATAI-AEPQREATMTNLI 634
           ++ K +  ELP  +LT +L+G+F +A ++  E +R   + ++I
Sbjct: 251 SLCKLYFRELPNPLLTYQLYGKFSEAMSVPGEEERLVRVHDVI 293


>AC002398-4|AAB81198.1|  903|Homo sapiens F25965_3 protein.
          Length = 903

 Score = 29.9 bits (64), Expect = 8.9
 Identities = 13/43 (30%), Positives = 27/43 (62%), Gaps = 1/43 (2%)
 Frame = +2

Query: 509 AMLKAFISELPESILTQELHGQFEQATAI-AEPQREATMTNLI 634
           ++ K +  ELP  +LT +L+G+F +A ++  E +R   + ++I
Sbjct: 125 SLCKLYFRELPNPLLTYQLYGKFSEAMSVPGEEERLVRVHDVI 167


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 75,662,393
Number of Sequences: 237096
Number of extensions: 1533649
Number of successful extensions: 4133
Number of sequences better than 10.0: 80
Number of HSP's better than 10.0 without gapping: 3800
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4130
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 7839245960
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -