SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20015
         (627 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CR533500-1|CAG38531.1|  237|Homo sapiens DKFZP566E144 protein.         79   1e-14
BC107887-1|AAI07888.1|  237|Homo sapiens REXO2 protein protein.        78   2e-14
BC105026-1|AAI05027.1|  237|Homo sapiens REX2, RNA exonuclease 2...    78   2e-14
BC105024-1|AAI05025.1|  237|Homo sapiens small fragment nuclease...    78   2e-14
AK223200-1|BAD96920.1|  237|Homo sapiens small fragment nuclease...    78   2e-14
AF151872-1|AAD34109.1|  205|Homo sapiens CGI-114 protein protein.      78   2e-14
BC003502-1|AAH03502.1|   79|Homo sapiens REXO2 protein protein.        66   1e-10
BC021711-1|AAH21711.1|  367|Homo sapiens apolipoprotein B mRNA e...    34   0.36 
AL137800-10|CAI19483.1|  367|Homo sapiens apolipoprotein B mRNA ...    34   0.36 
AK098557-1|BAC05332.1|  367|Homo sapiens protein ( Homo sapiens ...    34   0.36 
AK124803-1|BAC85953.1|  180|Homo sapiens protein ( Homo sapiens ...    31   4.4  

>CR533500-1|CAG38531.1|  237|Homo sapiens DKFZP566E144 protein.
          Length = 237

 Score = 79.4 bits (187), Expect = 1e-14
 Identities = 33/67 (49%), Positives = 50/67 (74%)
 Frame = +3

Query: 345 IAQRIVWMDLEMTGLDIENDHIMEIACLVTDAQLNVVATGPDIVINLPEVTLNKIITGVR 524
           +AQR+VW+DLEMTGLDIE D I+E+ACL+TD+ LN++A GP+++I  P+  L+ +    +
Sbjct: 39  MAQRMVWVDLEMTGLDIEKDQIIEMACLITDSDLNILAEGPNLIIKQPDELLDSMSDWCK 98

Query: 525 SNTARQG 545
            +  R G
Sbjct: 99  EHHGRSG 105



 Score = 37.9 bits (84), Expect = 0.029
 Identities = 16/35 (45%), Positives = 23/35 (65%)
 Frame = +2

Query: 509 NNWCKVQHGETGLTEACLKSDTSLAEAERIILKFV 613
           ++WCK  HG +GLT+A  +S  +L +AE   L FV
Sbjct: 94  SDWCKEHHGRSGLTKAVKESTITLQQAEYEFLSFV 128


>BC107887-1|AAI07888.1|  237|Homo sapiens REXO2 protein protein.
          Length = 237

 Score = 78.2 bits (184), Expect = 2e-14
 Identities = 32/67 (47%), Positives = 50/67 (74%)
 Frame = +3

Query: 345 IAQRIVWMDLEMTGLDIENDHIMEIACLVTDAQLNVVATGPDIVINLPEVTLNKIITGVR 524
           +AQR+VW+DLEMTGLDIE D I+E+ACL+TD+ LN++A GP+++I  P+  L+ +    +
Sbjct: 39  MAQRMVWVDLEMTGLDIEKDQIIEMACLITDSDLNILAEGPNLIIKQPDELLDSMSDWCK 98

Query: 525 SNTARQG 545
            +  + G
Sbjct: 99  EHHGKSG 105



 Score = 38.3 bits (85), Expect = 0.022
 Identities = 16/35 (45%), Positives = 24/35 (68%)
 Frame = +2

Query: 509 NNWCKVQHGETGLTEACLKSDTSLAEAERIILKFV 613
           ++WCK  HG++GLT+A  +S  +L +AE   L FV
Sbjct: 94  SDWCKEHHGKSGLTKAVKESTITLQQAEYEFLSFV 128


>BC105026-1|AAI05027.1|  237|Homo sapiens REX2, RNA exonuclease 2
           homolog (S. cerevisiae) protein.
          Length = 237

 Score = 78.2 bits (184), Expect = 2e-14
 Identities = 32/67 (47%), Positives = 50/67 (74%)
 Frame = +3

Query: 345 IAQRIVWMDLEMTGLDIENDHIMEIACLVTDAQLNVVATGPDIVINLPEVTLNKIITGVR 524
           +AQR+VW+DLEMTGLDIE D I+E+ACL+TD+ LN++A GP+++I  P+  L+ +    +
Sbjct: 39  MAQRMVWVDLEMTGLDIEKDQIIEMACLITDSDLNILAEGPNLIIKQPDELLDSMSDWCK 98

Query: 525 SNTARQG 545
            +  + G
Sbjct: 99  EHHGKSG 105



 Score = 38.3 bits (85), Expect = 0.022
 Identities = 16/35 (45%), Positives = 24/35 (68%)
 Frame = +2

Query: 509 NNWCKVQHGETGLTEACLKSDTSLAEAERIILKFV 613
           ++WCK  HG++GLT+A  +S  +L +AE   L FV
Sbjct: 94  SDWCKEHHGKSGLTKAVKESTITLQQAEYEFLSFV 128


>BC105024-1|AAI05025.1|  237|Homo sapiens small fragment nuclease
           protein.
          Length = 237

 Score = 78.2 bits (184), Expect = 2e-14
 Identities = 32/67 (47%), Positives = 50/67 (74%)
 Frame = +3

Query: 345 IAQRIVWMDLEMTGLDIENDHIMEIACLVTDAQLNVVATGPDIVINLPEVTLNKIITGVR 524
           +AQR+VW+DLEMTGLDIE D I+E+ACL+TD+ LN++A GP+++I  P+  L+ +    +
Sbjct: 39  MAQRMVWVDLEMTGLDIEKDQIIEMACLITDSDLNILAEGPNLIIKQPDELLDSMSDWCK 98

Query: 525 SNTARQG 545
            +  + G
Sbjct: 99  EHHGKSG 105



 Score = 38.3 bits (85), Expect = 0.022
 Identities = 16/35 (45%), Positives = 24/35 (68%)
 Frame = +2

Query: 509 NNWCKVQHGETGLTEACLKSDTSLAEAERIILKFV 613
           ++WCK  HG++GLT+A  +S  +L +AE   L FV
Sbjct: 94  SDWCKEHHGKSGLTKAVKESTITLQQAEYEFLSFV 128


>AK223200-1|BAD96920.1|  237|Homo sapiens small fragment nuclease
           variant protein.
          Length = 237

 Score = 78.2 bits (184), Expect = 2e-14
 Identities = 32/67 (47%), Positives = 50/67 (74%)
 Frame = +3

Query: 345 IAQRIVWMDLEMTGLDIENDHIMEIACLVTDAQLNVVATGPDIVINLPEVTLNKIITGVR 524
           +AQR+VW+DLEMTGLDIE D I+E+ACL+TD+ LN++A GP+++I  P+  L+ +    +
Sbjct: 39  MAQRMVWVDLEMTGLDIEKDQIIEMACLITDSDLNILAEGPNLIIKQPDELLDSMSDWCK 98

Query: 525 SNTARQG 545
            +  + G
Sbjct: 99  EHHGKSG 105



 Score = 38.3 bits (85), Expect = 0.022
 Identities = 16/35 (45%), Positives = 24/35 (68%)
 Frame = +2

Query: 509 NNWCKVQHGETGLTEACLKSDTSLAEAERIILKFV 613
           ++WCK  HG++GLT+A  +S  +L +AE   L FV
Sbjct: 94  SDWCKEHHGKSGLTKAVKESTITLQQAEYEFLSFV 128


>AF151872-1|AAD34109.1|  205|Homo sapiens CGI-114 protein protein.
          Length = 205

 Score = 78.2 bits (184), Expect = 2e-14
 Identities = 32/67 (47%), Positives = 50/67 (74%)
 Frame = +3

Query: 345 IAQRIVWMDLEMTGLDIENDHIMEIACLVTDAQLNVVATGPDIVINLPEVTLNKIITGVR 524
           +AQR+VW+DLEMTGLDIE D I+E+ACL+TD+ LN++A GP+++I  P+  L+ +    +
Sbjct: 7   MAQRMVWVDLEMTGLDIEKDQIIEMACLITDSDLNILAEGPNLIIKQPDELLDSMSDWCK 66

Query: 525 SNTARQG 545
            +  + G
Sbjct: 67  EHHGKSG 73



 Score = 38.3 bits (85), Expect = 0.022
 Identities = 16/35 (45%), Positives = 24/35 (68%)
 Frame = +2

Query: 509 NNWCKVQHGETGLTEACLKSDTSLAEAERIILKFV 613
           ++WCK  HG++GLT+A  +S  +L +AE   L FV
Sbjct: 62  SDWCKEHHGKSGLTKAVKESTITLQQAEYEFLSFV 96


>BC003502-1|AAH03502.1|   79|Homo sapiens REXO2 protein protein.
          Length = 79

 Score = 66.1 bits (154), Expect = 1e-10
 Identities = 27/40 (67%), Positives = 36/40 (90%)
 Frame = +3

Query: 345 IAQRIVWMDLEMTGLDIENDHIMEIACLVTDAQLNVVATG 464
           +AQR+VW+DLEMTGLDIE D I+E+ACL+TD+ LN++A G
Sbjct: 39  MAQRMVWVDLEMTGLDIEKDQIIEMACLITDSDLNILAEG 78


>BC021711-1|AAH21711.1|  367|Homo sapiens apolipoprotein B mRNA
           editing enzyme, catalytic polypeptide-like 4 (putative)
           protein.
          Length = 367

 Score = 34.3 bits (75), Expect = 0.36
 Identities = 20/50 (40%), Positives = 29/50 (58%)
 Frame = -3

Query: 190 SLHKKNEINSCTTLHYIHTISEIYLHQYYLY*SNYNHDQVY*IALYINNT 41
           SL +K   +SCT  +YIH  S ++    YL  + YN+D +  I LY NN+
Sbjct: 77  SLVQKGHASSCTG-NYIHPESMLFEMNGYLDSAIYNNDSIRHIILYSNNS 125


>AL137800-10|CAI19483.1|  367|Homo sapiens apolipoprotein B mRNA
           editing enzyme, catalytic polypeptide-like 4 (putative)
           protein.
          Length = 367

 Score = 34.3 bits (75), Expect = 0.36
 Identities = 20/50 (40%), Positives = 29/50 (58%)
 Frame = -3

Query: 190 SLHKKNEINSCTTLHYIHTISEIYLHQYYLY*SNYNHDQVY*IALYINNT 41
           SL +K   +SCT  +YIH  S ++    YL  + YN+D +  I LY NN+
Sbjct: 77  SLVQKGHASSCTG-NYIHPESMLFEMNGYLDSAIYNNDSIRHIILYSNNS 125


>AK098557-1|BAC05332.1|  367|Homo sapiens protein ( Homo sapiens
           cDNA FLJ25691 fis, clone TST04456. ).
          Length = 367

 Score = 34.3 bits (75), Expect = 0.36
 Identities = 20/50 (40%), Positives = 29/50 (58%)
 Frame = -3

Query: 190 SLHKKNEINSCTTLHYIHTISEIYLHQYYLY*SNYNHDQVY*IALYINNT 41
           SL +K   +SCT  +YIH  S ++    YL  + YN+D +  I LY NN+
Sbjct: 77  SLVQKGHASSCTG-NYIHPESMLFEMNGYLDSAIYNNDSIRHIILYSNNS 125


>AK124803-1|BAC85953.1|  180|Homo sapiens protein ( Homo sapiens
           cDNA FLJ42813 fis, clone BRCAN2012355. ).
          Length = 180

 Score = 30.7 bits (66), Expect = 4.4
 Identities = 16/54 (29%), Positives = 31/54 (57%), Gaps = 1/54 (1%)
 Frame = -3

Query: 187 LHKKNEINSCTTLH-YIHTISEIYLHQYYLY*SNYNHDQVY*IALYINNTLLYI 29
           +H    IN   +++ YI+T  +IY++ Y LY   Y +   Y I + I+ +++Y+
Sbjct: 107 IHICVHINMYVSIYVYIYTCIQIYIYMYTLYVCTYTYMCTY-IHICIHTSIIYV 159


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 78,360,688
Number of Sequences: 237096
Number of extensions: 1532936
Number of successful extensions: 9998
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 9959
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9998
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 6804036910
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -