SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20014
         (597 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U21138-1|AAA63752.1|  192|Homo sapiens ribosomal protein L9 prot...   105   1e-22
U09954-1|AAB01041.1|  192|Homo sapiens ribosomal protein L9 prot...   105   1e-22
U09953-1|AAB01040.1|  192|Homo sapiens ribosomal protein L9 prot...   105   1e-22
D14531-1|BAA03401.1|  192|Homo sapiens rat ribosomal protein L9 ...   105   1e-22
BC100285-1|AAI00286.1|  192|Homo sapiens ribosomal protein L9 pr...   105   1e-22
BC070214-1|AAH70214.1|  192|Homo sapiens RPL9 protein protein.        105   1e-22
BC066318-1|AAH66318.1|  192|Homo sapiens ribosomal protein L9 pr...   105   1e-22
BC031906-1|AAH31906.1|  192|Homo sapiens ribosomal protein L9 pr...   105   1e-22
BC012149-1|AAH12149.1|  192|Homo sapiens RPL9 protein protein.        105   1e-22
BC007967-1|AAH07967.1|  192|Homo sapiens RPL9 protein protein.        105   1e-22
BC004206-1|AAH04206.1|  192|Homo sapiens ribosomal protein L9 pr...   105   1e-22
BC004156-1|AAH04156.1|  192|Homo sapiens ribosomal protein L9 pr...   105   1e-22
BC000483-1|AAH00483.1|  192|Homo sapiens ribosomal protein L9 pr...   105   1e-22
AY376242-1|AAQ82909.1|  192|Homo sapiens ribosomal protein L9 is...   105   1e-22
AB062431-1|BAB93494.1|  192|Homo sapiens ribosomal protein L9 pr...   105   1e-22
BC111370-1|AAI11371.1|  192|Homo sapiens Unknown (protein for MG...   103   4e-22
AK130277-1|BAC85318.1|  134|Homo sapiens protein ( Homo sapiens ...    79   9e-15
AB007169-1|BAA25830.1|   47|Homo sapiens ribosomal protein L9 pr...    47   6e-05
AK126078-1|BAC86427.1|  129|Homo sapiens protein ( Homo sapiens ...    30   7.2  

>U21138-1|AAA63752.1|  192|Homo sapiens ribosomal protein L9
           protein.
          Length = 192

 Score =  105 bits (252), Expect = 1e-22
 Identities = 49/69 (71%), Positives = 56/69 (81%)
 Frame = +3

Query: 252 RNMIKGVTKGFQYKMRAVYAHFPINCVTTEGNSIIEIRNFLGEKYIRRVKMAPGVTVVNS 431
           +NMIKGVT GF+YKMR+VYAHFPIN V  E  S++EIRNFLGEKYIRRV+M PGV    S
Sbjct: 78  QNMIKGVTLGFRYKMRSVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVRMRPGVACSVS 137

Query: 432 PKQKDELII 458
             QKDELI+
Sbjct: 138 QAQKDELIL 146



 Score = 89.8 bits (213), Expect = 6e-18
 Identities = 39/82 (47%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +1

Query: 28  MKQIVANQKVKIPDGLTVHVKSRLVTVKGPRGVLKRNFKHLAVDIRMV--NPRLLKVEKW 201
           MK I++NQ V IP+ + + +K R V VKGPRG L+R+F H+ V++ ++    + L+V+KW
Sbjct: 1   MKTILSNQTVDIPENVDITLKGRTVIVKGPRGTLRRDFNHINVELSLLGKKKKRLRVDKW 60

Query: 202 FGSKKELAAVRTVCSHVET*LK 267
           +G++KELA VRT+CSHV+  +K
Sbjct: 61  WGNRKELATVRTICSHVQNMIK 82



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 21/23 (91%), Positives = 22/23 (95%)
 Frame = +1

Query: 511 TTVKNKDIRKFLDGLYVSEKTTV 579
           TTVKNKDIRKFLDG+YVSEK TV
Sbjct: 165 TTVKNKDIRKFLDGIYVSEKGTV 187


>U09954-1|AAB01041.1|  192|Homo sapiens ribosomal protein L9
           protein.
          Length = 192

 Score =  105 bits (252), Expect = 1e-22
 Identities = 49/69 (71%), Positives = 56/69 (81%)
 Frame = +3

Query: 252 RNMIKGVTKGFQYKMRAVYAHFPINCVTTEGNSIIEIRNFLGEKYIRRVKMAPGVTVVNS 431
           +NMIKGVT GF+YKMR+VYAHFPIN V  E  S++EIRNFLGEKYIRRV+M PGV    S
Sbjct: 78  QNMIKGVTLGFRYKMRSVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVRMRPGVACSVS 137

Query: 432 PKQKDELII 458
             QKDELI+
Sbjct: 138 QAQKDELIL 146



 Score = 90.6 bits (215), Expect = 4e-18
 Identities = 39/82 (47%), Positives = 62/82 (75%), Gaps = 2/82 (2%)
 Frame = +1

Query: 28  MKQIVANQKVKIPDGLTVHVKSRLVTVKGPRGVLKRNFKHLAVDIRMV--NPRLLKVEKW 201
           MK I++NQ V+IP+ + + +K R V VKGPRG L+R+F H+ V++ ++    + L+V+KW
Sbjct: 1   MKTILSNQTVEIPENVDITLKGRTVIVKGPRGTLRRDFNHINVELSLLGKKKKRLRVDKW 60

Query: 202 FGSKKELAAVRTVCSHVET*LK 267
           +G++KELA VRT+CSHV+  +K
Sbjct: 61  WGNRKELATVRTICSHVQNMIK 82



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 21/23 (91%), Positives = 22/23 (95%)
 Frame = +1

Query: 511 TTVKNKDIRKFLDGLYVSEKTTV 579
           TTVKNKDIRKFLDG+YVSEK TV
Sbjct: 165 TTVKNKDIRKFLDGIYVSEKGTV 187


>U09953-1|AAB01040.1|  192|Homo sapiens ribosomal protein L9
           protein.
          Length = 192

 Score =  105 bits (252), Expect = 1e-22
 Identities = 49/69 (71%), Positives = 56/69 (81%)
 Frame = +3

Query: 252 RNMIKGVTKGFQYKMRAVYAHFPINCVTTEGNSIIEIRNFLGEKYIRRVKMAPGVTVVNS 431
           +NMIKGVT GF+YKMR+VYAHFPIN V  E  S++EIRNFLGEKYIRRV+M PGV    S
Sbjct: 78  QNMIKGVTLGFRYKMRSVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVRMRPGVACSVS 137

Query: 432 PKQKDELII 458
             QKDELI+
Sbjct: 138 QAQKDELIL 146



 Score = 90.6 bits (215), Expect = 4e-18
 Identities = 39/82 (47%), Positives = 62/82 (75%), Gaps = 2/82 (2%)
 Frame = +1

Query: 28  MKQIVANQKVKIPDGLTVHVKSRLVTVKGPRGVLKRNFKHLAVDIRMV--NPRLLKVEKW 201
           MK I++NQ V+IP+ + + +K R V VKGPRG L+R+F H+ V++ ++    + L+V+KW
Sbjct: 1   MKTILSNQTVEIPENVDITLKGRTVIVKGPRGTLRRDFNHINVELSLLGKKKKRLRVDKW 60

Query: 202 FGSKKELAAVRTVCSHVET*LK 267
           +G++KELA VRT+CSHV+  +K
Sbjct: 61  WGNRKELATVRTICSHVQNMIK 82



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 21/23 (91%), Positives = 22/23 (95%)
 Frame = +1

Query: 511 TTVKNKDIRKFLDGLYVSEKTTV 579
           TTVKNKDIRKFLDG+YVSEK TV
Sbjct: 165 TTVKNKDIRKFLDGIYVSEKGTV 187


>D14531-1|BAA03401.1|  192|Homo sapiens rat ribosomal protein L9
           homologue protein.
          Length = 192

 Score =  105 bits (252), Expect = 1e-22
 Identities = 49/69 (71%), Positives = 56/69 (81%)
 Frame = +3

Query: 252 RNMIKGVTKGFQYKMRAVYAHFPINCVTTEGNSIIEIRNFLGEKYIRRVKMAPGVTVVNS 431
           +NMIKGVT GF+YKMR+VYAHFPIN V  E  S++EIRNFLGEKYIRRV+M PGV    S
Sbjct: 78  QNMIKGVTLGFRYKMRSVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVRMRPGVACSVS 137

Query: 432 PKQKDELII 458
             QKDELI+
Sbjct: 138 QAQKDELIL 146



 Score = 89.8 bits (213), Expect = 6e-18
 Identities = 39/82 (47%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +1

Query: 28  MKQIVANQKVKIPDGLTVHVKSRLVTVKGPRGVLKRNFKHLAVDIRMV--NPRLLKVEKW 201
           MK I++NQ V IP+ + + +K R V VKGPRG L+R+F H+ V++ ++    + L+V+KW
Sbjct: 1   MKTILSNQTVDIPENVDITLKGRTVIVKGPRGTLRRDFNHINVELSLLGKKKKRLRVDKW 60

Query: 202 FGSKKELAAVRTVCSHVET*LK 267
           +G++KELA VRT+CSHV+  +K
Sbjct: 61  WGNRKELATVRTICSHVQNMIK 82



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 21/23 (91%), Positives = 22/23 (95%)
 Frame = +1

Query: 511 TTVKNKDIRKFLDGLYVSEKTTV 579
           TTVKNKDIRKFLDG+YVSEK TV
Sbjct: 165 TTVKNKDIRKFLDGIYVSEKGTV 187


>BC100285-1|AAI00286.1|  192|Homo sapiens ribosomal protein L9
           protein.
          Length = 192

 Score =  105 bits (252), Expect = 1e-22
 Identities = 49/69 (71%), Positives = 56/69 (81%)
 Frame = +3

Query: 252 RNMIKGVTKGFQYKMRAVYAHFPINCVTTEGNSIIEIRNFLGEKYIRRVKMAPGVTVVNS 431
           +NMIKGVT GF+YKMR+VYAHFPIN V  E  S++EIRNFLGEKYIRRV+M PGV    S
Sbjct: 78  QNMIKGVTLGFRYKMRSVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVRMRPGVACSVS 137

Query: 432 PKQKDELII 458
             QKDELI+
Sbjct: 138 QAQKDELIL 146



 Score = 89.8 bits (213), Expect = 6e-18
 Identities = 39/82 (47%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +1

Query: 28  MKQIVANQKVKIPDGLTVHVKSRLVTVKGPRGVLKRNFKHLAVDIRMV--NPRLLKVEKW 201
           MK I++NQ V IP+ + + +K R V VKGPRG L+R+F H+ V++ ++    + L+V+KW
Sbjct: 1   MKTILSNQTVDIPENVDITLKGRTVIVKGPRGTLRRDFNHINVELSLLGKKKKRLRVDKW 60

Query: 202 FGSKKELAAVRTVCSHVET*LK 267
           +G++KELA VRT+CSHV+  +K
Sbjct: 61  WGNRKELATVRTICSHVQNMIK 82



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 21/23 (91%), Positives = 22/23 (95%)
 Frame = +1

Query: 511 TTVKNKDIRKFLDGLYVSEKTTV 579
           TTVKNKDIRKFLDG+YVSEK TV
Sbjct: 165 TTVKNKDIRKFLDGIYVSEKGTV 187


>BC070214-1|AAH70214.1|  192|Homo sapiens RPL9 protein protein.
          Length = 192

 Score =  105 bits (252), Expect = 1e-22
 Identities = 49/69 (71%), Positives = 56/69 (81%)
 Frame = +3

Query: 252 RNMIKGVTKGFQYKMRAVYAHFPINCVTTEGNSIIEIRNFLGEKYIRRVKMAPGVTVVNS 431
           +NMIKGVT GF+YKMR+VYAHFPIN V  E  S++EIRNFLGEKYIRRV+M PGV    S
Sbjct: 78  QNMIKGVTLGFRYKMRSVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVRMRPGVACSVS 137

Query: 432 PKQKDELII 458
             QKDELI+
Sbjct: 138 QAQKDELIL 146



 Score = 89.8 bits (213), Expect = 6e-18
 Identities = 39/82 (47%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +1

Query: 28  MKQIVANQKVKIPDGLTVHVKSRLVTVKGPRGVLKRNFKHLAVDIRMV--NPRLLKVEKW 201
           MK I++NQ V IP+ + + +K R V VKGPRG L+R+F H+ V++ ++    + L+V+KW
Sbjct: 1   MKTILSNQTVDIPENVDITLKGRTVIVKGPRGTLRRDFNHINVELSLLGKKKKRLRVDKW 60

Query: 202 FGSKKELAAVRTVCSHVET*LK 267
           +G++KELA VRT+CSHV+  +K
Sbjct: 61  WGNRKELATVRTICSHVQNMIK 82



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 21/23 (91%), Positives = 22/23 (95%)
 Frame = +1

Query: 511 TTVKNKDIRKFLDGLYVSEKTTV 579
           TTVKNKDIRKFLDG+YVSEK TV
Sbjct: 165 TTVKNKDIRKFLDGIYVSEKGTV 187


>BC066318-1|AAH66318.1|  192|Homo sapiens ribosomal protein L9
           protein.
          Length = 192

 Score =  105 bits (252), Expect = 1e-22
 Identities = 49/69 (71%), Positives = 56/69 (81%)
 Frame = +3

Query: 252 RNMIKGVTKGFQYKMRAVYAHFPINCVTTEGNSIIEIRNFLGEKYIRRVKMAPGVTVVNS 431
           +NMIKGVT GF+YKMR+VYAHFPIN V  E  S++EIRNFLGEKYIRRV+M PGV    S
Sbjct: 78  QNMIKGVTLGFRYKMRSVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVRMRPGVACSVS 137

Query: 432 PKQKDELII 458
             QKDELI+
Sbjct: 138 QAQKDELIL 146



 Score = 89.8 bits (213), Expect = 6e-18
 Identities = 39/82 (47%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +1

Query: 28  MKQIVANQKVKIPDGLTVHVKSRLVTVKGPRGVLKRNFKHLAVDIRMV--NPRLLKVEKW 201
           MK I++NQ V IP+ + + +K R V VKGPRG L+R+F H+ V++ ++    + L+V+KW
Sbjct: 1   MKTILSNQTVDIPENVDITLKGRTVIVKGPRGTLRRDFNHINVELSLLGKKKKRLRVDKW 60

Query: 202 FGSKKELAAVRTVCSHVET*LK 267
           +G++KELA VRT+CSHV+  +K
Sbjct: 61  WGNRKELATVRTICSHVQNMIK 82



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 21/23 (91%), Positives = 22/23 (95%)
 Frame = +1

Query: 511 TTVKNKDIRKFLDGLYVSEKTTV 579
           TTVKNKDIRKFLDG+YVSEK TV
Sbjct: 165 TTVKNKDIRKFLDGIYVSEKGTV 187


>BC031906-1|AAH31906.1|  192|Homo sapiens ribosomal protein L9
           protein.
          Length = 192

 Score =  105 bits (252), Expect = 1e-22
 Identities = 49/69 (71%), Positives = 56/69 (81%)
 Frame = +3

Query: 252 RNMIKGVTKGFQYKMRAVYAHFPINCVTTEGNSIIEIRNFLGEKYIRRVKMAPGVTVVNS 431
           +NMIKGVT GF+YKMR+VYAHFPIN V  E  S++EIRNFLGEKYIRRV+M PGV    S
Sbjct: 78  QNMIKGVTLGFRYKMRSVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVRMRPGVACSVS 137

Query: 432 PKQKDELII 458
             QKDELI+
Sbjct: 138 QAQKDELIL 146



 Score = 89.8 bits (213), Expect = 6e-18
 Identities = 39/82 (47%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +1

Query: 28  MKQIVANQKVKIPDGLTVHVKSRLVTVKGPRGVLKRNFKHLAVDIRMV--NPRLLKVEKW 201
           MK I++NQ V IP+ + + +K R V VKGPRG L+R+F H+ V++ ++    + L+V+KW
Sbjct: 1   MKTILSNQTVDIPENVDITLKGRTVIVKGPRGTLRRDFNHINVELSLLGKKKKRLRVDKW 60

Query: 202 FGSKKELAAVRTVCSHVET*LK 267
           +G++KELA VRT+CSHV+  +K
Sbjct: 61  WGNRKELATVRTICSHVQNMIK 82



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 21/23 (91%), Positives = 22/23 (95%)
 Frame = +1

Query: 511 TTVKNKDIRKFLDGLYVSEKTTV 579
           TTVKNKDIRKFLDG+YVSEK TV
Sbjct: 165 TTVKNKDIRKFLDGIYVSEKGTV 187


>BC012149-1|AAH12149.1|  192|Homo sapiens RPL9 protein protein.
          Length = 192

 Score =  105 bits (252), Expect = 1e-22
 Identities = 49/69 (71%), Positives = 56/69 (81%)
 Frame = +3

Query: 252 RNMIKGVTKGFQYKMRAVYAHFPINCVTTEGNSIIEIRNFLGEKYIRRVKMAPGVTVVNS 431
           +NMIKGVT GF+YKMR+VYAHFPIN V  E  S++EIRNFLGEKYIRRV+M PGV    S
Sbjct: 78  QNMIKGVTLGFRYKMRSVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVRMRPGVACSVS 137

Query: 432 PKQKDELII 458
             QKDELI+
Sbjct: 138 QAQKDELIL 146



 Score = 89.8 bits (213), Expect = 6e-18
 Identities = 39/82 (47%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +1

Query: 28  MKQIVANQKVKIPDGLTVHVKSRLVTVKGPRGVLKRNFKHLAVDIRMV--NPRLLKVEKW 201
           MK I++NQ V IP+ + + +K R V VKGPRG L+R+F H+ V++ ++    + L+V+KW
Sbjct: 1   MKTILSNQTVDIPENVDITLKGRTVIVKGPRGTLRRDFNHINVELSLLGKKKKRLRVDKW 60

Query: 202 FGSKKELAAVRTVCSHVET*LK 267
           +G++KELA VRT+CSHV+  +K
Sbjct: 61  WGNRKELATVRTICSHVQNMIK 82



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 21/23 (91%), Positives = 22/23 (95%)
 Frame = +1

Query: 511 TTVKNKDIRKFLDGLYVSEKTTV 579
           TTVKNKDIRKFLDG+YVSEK TV
Sbjct: 165 TTVKNKDIRKFLDGIYVSEKGTV 187


>BC007967-1|AAH07967.1|  192|Homo sapiens RPL9 protein protein.
          Length = 192

 Score =  105 bits (252), Expect = 1e-22
 Identities = 49/69 (71%), Positives = 56/69 (81%)
 Frame = +3

Query: 252 RNMIKGVTKGFQYKMRAVYAHFPINCVTTEGNSIIEIRNFLGEKYIRRVKMAPGVTVVNS 431
           +NMIKGVT GF+YKMR+VYAHFPIN V  E  S++EIRNFLGEKYIRRV+M PGV    S
Sbjct: 78  QNMIKGVTLGFRYKMRSVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVRMRPGVACSVS 137

Query: 432 PKQKDELII 458
             QKDELI+
Sbjct: 138 QAQKDELIL 146



 Score = 89.8 bits (213), Expect = 6e-18
 Identities = 39/82 (47%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +1

Query: 28  MKQIVANQKVKIPDGLTVHVKSRLVTVKGPRGVLKRNFKHLAVDIRMV--NPRLLKVEKW 201
           MK I++NQ V IP+ + + +K R V VKGPRG L+R+F H+ V++ ++    + L+V+KW
Sbjct: 1   MKTILSNQTVDIPENVDITLKGRTVIVKGPRGTLRRDFNHINVELSLLGKKKKRLRVDKW 60

Query: 202 FGSKKELAAVRTVCSHVET*LK 267
           +G++KELA VRT+CSHV+  +K
Sbjct: 61  WGNRKELATVRTICSHVQNMIK 82



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 21/23 (91%), Positives = 22/23 (95%)
 Frame = +1

Query: 511 TTVKNKDIRKFLDGLYVSEKTTV 579
           TTVKNKDIRKFLDG+YVSEK TV
Sbjct: 165 TTVKNKDIRKFLDGIYVSEKGTV 187


>BC004206-1|AAH04206.1|  192|Homo sapiens ribosomal protein L9
           protein.
          Length = 192

 Score =  105 bits (252), Expect = 1e-22
 Identities = 49/69 (71%), Positives = 56/69 (81%)
 Frame = +3

Query: 252 RNMIKGVTKGFQYKMRAVYAHFPINCVTTEGNSIIEIRNFLGEKYIRRVKMAPGVTVVNS 431
           +NMIKGVT GF+YKMR+VYAHFPIN V  E  S++EIRNFLGEKYIRRV+M PGV    S
Sbjct: 78  QNMIKGVTLGFRYKMRSVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVRMRPGVACSVS 137

Query: 432 PKQKDELII 458
             QKDELI+
Sbjct: 138 QAQKDELIL 146



 Score = 89.8 bits (213), Expect = 6e-18
 Identities = 39/82 (47%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +1

Query: 28  MKQIVANQKVKIPDGLTVHVKSRLVTVKGPRGVLKRNFKHLAVDIRMV--NPRLLKVEKW 201
           MK I++NQ V IP+ + + +K R V VKGPRG L+R+F H+ V++ ++    + L+V+KW
Sbjct: 1   MKTILSNQTVDIPENVDITLKGRTVIVKGPRGTLRRDFNHINVELSLLGKKKKRLRVDKW 60

Query: 202 FGSKKELAAVRTVCSHVET*LK 267
           +G++KELA VRT+CSHV+  +K
Sbjct: 61  WGNRKELATVRTICSHVQNMIK 82



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 21/23 (91%), Positives = 22/23 (95%)
 Frame = +1

Query: 511 TTVKNKDIRKFLDGLYVSEKTTV 579
           TTVKNKDIRKFLDG+YVSEK TV
Sbjct: 165 TTVKNKDIRKFLDGIYVSEKGTV 187


>BC004156-1|AAH04156.1|  192|Homo sapiens ribosomal protein L9
           protein.
          Length = 192

 Score =  105 bits (252), Expect = 1e-22
 Identities = 49/69 (71%), Positives = 56/69 (81%)
 Frame = +3

Query: 252 RNMIKGVTKGFQYKMRAVYAHFPINCVTTEGNSIIEIRNFLGEKYIRRVKMAPGVTVVNS 431
           +NMIKGVT GF+YKMR+VYAHFPIN V  E  S++EIRNFLGEKYIRRV+M PGV    S
Sbjct: 78  QNMIKGVTLGFRYKMRSVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVRMRPGVACSVS 137

Query: 432 PKQKDELII 458
             QKDELI+
Sbjct: 138 QAQKDELIL 146



 Score = 89.8 bits (213), Expect = 6e-18
 Identities = 39/82 (47%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +1

Query: 28  MKQIVANQKVKIPDGLTVHVKSRLVTVKGPRGVLKRNFKHLAVDIRMV--NPRLLKVEKW 201
           MK I++NQ V IP+ + + +K R V VKGPRG L+R+F H+ V++ ++    + L+V+KW
Sbjct: 1   MKTILSNQTVDIPENVDITLKGRTVIVKGPRGTLRRDFNHINVELSLLGKKKKRLRVDKW 60

Query: 202 FGSKKELAAVRTVCSHVET*LK 267
           +G++KELA VRT+CSHV+  +K
Sbjct: 61  WGNRKELATVRTICSHVQNMIK 82



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 21/23 (91%), Positives = 22/23 (95%)
 Frame = +1

Query: 511 TTVKNKDIRKFLDGLYVSEKTTV 579
           TTVKNKDIRKFLDG+YVSEK TV
Sbjct: 165 TTVKNKDIRKFLDGIYVSEKGTV 187


>BC000483-1|AAH00483.1|  192|Homo sapiens ribosomal protein L9
           protein.
          Length = 192

 Score =  105 bits (252), Expect = 1e-22
 Identities = 49/69 (71%), Positives = 56/69 (81%)
 Frame = +3

Query: 252 RNMIKGVTKGFQYKMRAVYAHFPINCVTTEGNSIIEIRNFLGEKYIRRVKMAPGVTVVNS 431
           +NMIKGVT GF+YKMR+VYAHFPIN V  E  S++EIRNFLGEKYIRRV+M PGV    S
Sbjct: 78  QNMIKGVTLGFRYKMRSVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVRMRPGVACSVS 137

Query: 432 PKQKDELII 458
             QKDELI+
Sbjct: 138 QAQKDELIL 146



 Score = 89.8 bits (213), Expect = 6e-18
 Identities = 39/82 (47%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +1

Query: 28  MKQIVANQKVKIPDGLTVHVKSRLVTVKGPRGVLKRNFKHLAVDIRMV--NPRLLKVEKW 201
           MK I++NQ V IP+ + + +K R V VKGPRG L+R+F H+ V++ ++    + L+V+KW
Sbjct: 1   MKTILSNQTVDIPENVDITLKGRTVIVKGPRGTLRRDFNHINVELSLLGKKKKRLRVDKW 60

Query: 202 FGSKKELAAVRTVCSHVET*LK 267
           +G++KELA VRT+CSHV+  +K
Sbjct: 61  WGNRKELATVRTICSHVQNMIK 82



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 21/23 (91%), Positives = 22/23 (95%)
 Frame = +1

Query: 511 TTVKNKDIRKFLDGLYVSEKTTV 579
           TTVKNKDIRKFLDG+YVSEK TV
Sbjct: 165 TTVKNKDIRKFLDGIYVSEKGTV 187


>AY376242-1|AAQ82909.1|  192|Homo sapiens ribosomal protein L9
           isoform protein.
          Length = 192

 Score =  105 bits (252), Expect = 1e-22
 Identities = 49/69 (71%), Positives = 56/69 (81%)
 Frame = +3

Query: 252 RNMIKGVTKGFQYKMRAVYAHFPINCVTTEGNSIIEIRNFLGEKYIRRVKMAPGVTVVNS 431
           +NMIKGVT GF+YKMR+VYAHFPIN V  E  S++EIRNFLGEKYIRRV+M PGV    S
Sbjct: 78  QNMIKGVTLGFRYKMRSVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVRMRPGVACSVS 137

Query: 432 PKQKDELII 458
             QKDELI+
Sbjct: 138 QAQKDELIL 146



 Score = 89.8 bits (213), Expect = 6e-18
 Identities = 39/82 (47%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +1

Query: 28  MKQIVANQKVKIPDGLTVHVKSRLVTVKGPRGVLKRNFKHLAVDIRMV--NPRLLKVEKW 201
           MK I++NQ V IP+ + + +K R V VKGPRG L+R+F H+ V++ ++    + L+V+KW
Sbjct: 1   MKTILSNQTVDIPENVDITLKGRTVIVKGPRGTLRRDFNHINVELSLLGKKKKRLRVDKW 60

Query: 202 FGSKKELAAVRTVCSHVET*LK 267
           +G++KELA VRT+CSHV+  +K
Sbjct: 61  WGNRKELATVRTICSHVQNMIK 82



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 21/23 (91%), Positives = 22/23 (95%)
 Frame = +1

Query: 511 TTVKNKDIRKFLDGLYVSEKTTV 579
           TTVKNKDIRKFLDG+YVSEK TV
Sbjct: 165 TTVKNKDIRKFLDGIYVSEKGTV 187


>AB062431-1|BAB93494.1|  192|Homo sapiens ribosomal protein L9
           protein.
          Length = 192

 Score =  105 bits (252), Expect = 1e-22
 Identities = 49/69 (71%), Positives = 56/69 (81%)
 Frame = +3

Query: 252 RNMIKGVTKGFQYKMRAVYAHFPINCVTTEGNSIIEIRNFLGEKYIRRVKMAPGVTVVNS 431
           +NMIKGVT GF+YKMR+VYAHFPIN V  E  S++EIRNFLGEKYIRRV+M PGV    S
Sbjct: 78  QNMIKGVTLGFRYKMRSVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVRMRPGVACSVS 137

Query: 432 PKQKDELII 458
             QKDELI+
Sbjct: 138 QAQKDELIL 146



 Score = 89.8 bits (213), Expect = 6e-18
 Identities = 39/82 (47%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +1

Query: 28  MKQIVANQKVKIPDGLTVHVKSRLVTVKGPRGVLKRNFKHLAVDIRMV--NPRLLKVEKW 201
           MK I++NQ V IP+ + + +K R V VKGPRG L+R+F H+ V++ ++    + L+V+KW
Sbjct: 1   MKTILSNQTVDIPENVDITLKGRTVIVKGPRGTLRRDFNHINVELSLLGKKKKRLRVDKW 60

Query: 202 FGSKKELAAVRTVCSHVET*LK 267
           +G++KELA VRT+CSHV+  +K
Sbjct: 61  WGNRKELATVRTICSHVQNMIK 82



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 21/23 (91%), Positives = 22/23 (95%)
 Frame = +1

Query: 511 TTVKNKDIRKFLDGLYVSEKTTV 579
           TTVKNKDIRKFLDG+YVSEK TV
Sbjct: 165 TTVKNKDIRKFLDGIYVSEKGTV 187


>BC111370-1|AAI11371.1|  192|Homo sapiens Unknown (protein for
           MGC:131531) protein.
          Length = 192

 Score =  103 bits (248), Expect = 4e-22
 Identities = 47/69 (68%), Positives = 56/69 (81%)
 Frame = +3

Query: 252 RNMIKGVTKGFQYKMRAVYAHFPINCVTTEGNSIIEIRNFLGEKYIRRVKMAPGVTVVNS 431
           +NMIKGVT GF+YKMR+VYAHFPIN V  EG +++EIRNFLGEKYIRRV+M  GV    S
Sbjct: 78  QNMIKGVTLGFRYKMRSVYAHFPINVVMQEGGAMVEIRNFLGEKYIRRVRMRSGVNCAVS 137

Query: 432 PKQKDELII 458
             QKDEL++
Sbjct: 138 TNQKDELVL 146



 Score = 86.6 bits (205), Expect = 6e-17
 Identities = 39/82 (47%), Positives = 59/82 (71%), Gaps = 2/82 (2%)
 Frame = +1

Query: 28  MKQIVANQKVKIPDGLTVHVKSRLVTVKGPRGVLKRNFKHLAVDIRMVNP--RLLKVEKW 201
           MK I+++Q V +PD + V +K R VTVKGPRG L R F H+ +++ ++    + L+V KW
Sbjct: 1   MKTILSSQTVDLPDNVEVRLKGRTVTVKGPRGKLVREFNHINLELSLLGKKNKKLRVVKW 60

Query: 202 FGSKKELAAVRTVCSHVET*LK 267
           +G++KELA VRT+CSHV+  +K
Sbjct: 61  WGNRKELATVRTICSHVQNMIK 82



 Score = 48.4 bits (110), Expect = 2e-05
 Identities = 22/24 (91%), Positives = 23/24 (95%)
 Frame = +1

Query: 511 TTVKNKDIRKFLDGLYVSEKTTVV 582
           TTVKNKDIRKFLDG+YVSEK TVV
Sbjct: 165 TTVKNKDIRKFLDGIYVSEKGTVV 188


>AK130277-1|BAC85318.1|  134|Homo sapiens protein ( Homo sapiens
           cDNA FLJ26767 fis, clone PRS02825. ).
          Length = 134

 Score = 79.4 bits (187), Expect = 9e-15
 Identities = 36/55 (65%), Positives = 42/55 (76%)
 Frame = +3

Query: 252 RNMIKGVTKGFQYKMRAVYAHFPINCVTTEGNSIIEIRNFLGEKYIRRVKMAPGV 416
           +N IKGVT GF YKMR+ YAHFP + V  E  S++EIRNFL EKY RRV+M PGV
Sbjct: 73  QNTIKGVTLGFCYKMRSAYAHFPTDIVIQEDGSLVEIRNFLDEKYTRRVQMRPGV 127



 Score = 68.1 bits (159), Expect = 2e-11
 Identities = 35/80 (43%), Positives = 53/80 (66%)
 Frame = +1

Query: 28  MKQIVANQKVKIPDGLTVHVKSRLVTVKGPRGVLKRNFKHLAVDIRMVNPRLLKVEKWFG 207
           MK I +NQ V IP+ + + +K   VTV GPRG ++R+F H+ V++ +   RL    +W G
Sbjct: 1   MKTIHSNQTVVIPENVNITLKRCTVTVNGPRGTMQRDFSHINVELSL--KRLWSATRW-G 57

Query: 208 SKKELAAVRTVCSHVET*LK 267
           ++KELA VRTV S+V+  +K
Sbjct: 58  NRKELATVRTVGSYVQNTIK 77


>AB007169-1|BAA25830.1|   47|Homo sapiens ribosomal protein L9
           protein.
          Length = 47

 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 21/23 (91%), Positives = 22/23 (95%)
 Frame = +1

Query: 511 TTVKNKDIRKFLDGLYVSEKTTV 579
           TTVKNKDIRKFLDG+YVSEK TV
Sbjct: 20  TTVKNKDIRKFLDGIYVSEKGTV 42


>AK126078-1|BAC86427.1|  129|Homo sapiens protein ( Homo sapiens
           cDNA FLJ44090 fis, clone TESTI4041903. ).
          Length = 129

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 12/29 (41%), Positives = 18/29 (62%)
 Frame = -2

Query: 197 FSTFRRRGFTMRMSTAKCLKFLLRTPRGP 111
           F   + RGF++ + TA+   FL R P+GP
Sbjct: 25  FMVTQSRGFSLALPTAETCSFLARYPQGP 53


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 90,683,593
Number of Sequences: 237096
Number of extensions: 1955849
Number of successful extensions: 3633
Number of sequences better than 10.0: 19
Number of HSP's better than 10.0 without gapping: 3425
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3616
length of database: 76,859,062
effective HSP length: 86
effective length of database: 56,468,806
effective search space used: 6324506272
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -