SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20013
         (724 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X17644-1|CAA35635.1|  499|Homo sapiens protein ( Human GST1-Hs m...   173   7e-43
U95742-2|AAB67250.1|  499|Homo sapiens G1 to S phase transition ...   173   7e-43
BT006722-1|AAP35368.1|  498|Homo sapiens G1 to S phase transitio...   173   7e-43
BC009503-1|AAH09503.2|  633|Homo sapiens GSPT1 protein protein.       173   7e-43
BC036077-1|AAH36077.1|  628|Homo sapiens G1 to S phase transitio...   171   2e-42
AL929101-2|CAH71524.1|  628|Homo sapiens G1 to S phase transitio...   171   2e-42
AK023155-1|BAB14435.1|  504|Homo sapiens protein ( Homo sapiens ...   171   2e-42
AJ251548-1|CAB91089.1|  628|Homo sapiens polypeptide chain relea...   171   2e-42
AK001303-1|BAA91612.1|  628|Homo sapiens protein ( Homo sapiens ...   170   5e-42
U87791-1|AAD00645.1|  684|Homo sapiens eRFS protein.                  110   4e-24
BC040849-1|AAH40849.1|  684|Homo sapiens HBS1-like (S. cerevisia...   110   4e-24
BC001465-1|AAH01465.1|  684|Homo sapiens HBS1-like (S. cerevisia...   110   4e-24
AL445190-5|CAI95161.1|  684|Homo sapiens HBS1-like (S. cerevisia...   110   4e-24
AL353596-2|CAI17912.1|  684|Homo sapiens HBS1-like (S. cerevisia...   110   4e-24
AJ459826-1|CAD30873.1|  684|Homo sapiens HBS1-like protein protein.   110   4e-24
AB028961-1|BAA82990.1|  496|Homo sapiens KIAA1038 protein protein.    110   4e-24
X70940-1|CAA50280.1|  463|Homo sapiens elongation factor 1 alpha...    92   2e-18
X16869-1|CAA34756.1|  462|Homo sapiens protein ( Human mRNA for ...    92   2e-18
X03558-1|CAA27245.1|  462|Homo sapiens protein ( Human mRNA for ...    92   2e-18
L10340-1|AAA91835.1|  435|Homo sapiens elongation factor-1 alpha...    92   2e-18
J04617-1|AAA52343.1|  462|Homo sapiens EEF1A protein.                  92   2e-18
EF362804-1|ABO30531.1|  462|Homo sapiens EF1a protein.                 92   2e-18
BC111051-1|AAI11052.1|  462|Homo sapiens eukaryotic translation ...    92   2e-18
BC110409-1|AAI10410.1|  463|Homo sapiens eukaryotic translation ...    92   2e-18
BC082268-1|AAH82268.1|  462|Homo sapiens eukaryotic translation ...    92   2e-18
BC072385-1|AAH72385.1|  462|Homo sapiens eukaryotic translation ...    92   2e-18
BC071841-1|AAH71841.1|  462|Homo sapiens eukaryotic translation ...    92   2e-18
BC071741-1|AAH71741.1|  462|Homo sapiens eukaryotic translation ...    92   2e-18
BC071727-1|AAH71727.1|  462|Homo sapiens eukaryotic translation ...    92   2e-18
BC071619-1|AAH71619.1|  441|Homo sapiens EEF1A1 protein protein.       92   2e-18
BC066893-1|AAH66893.1|  462|Homo sapiens eukaryotic translation ...    92   2e-18
BC057391-1|AAH57391.1|  462|Homo sapiens eukaryotic translation ...    92   2e-18
BC038339-1|AAH38339.1|  462|Homo sapiens eukaryotic translation ...    92   2e-18
BC028674-1|AAH28674.1|  462|Homo sapiens eukaryotic translation ...    92   2e-18
BC021686-1|AAH21686.1|  462|Homo sapiens eukaryotic translation ...    92   2e-18
BC019669-1|AAH19669.1|  462|Homo sapiens EEF1A1 protein protein.       92   2e-18
BC018641-1|AAH18641.1|  462|Homo sapiens eukaryotic translation ...    92   2e-18
BC018150-1|AAH18150.1|  462|Homo sapiens eukaryotic translation ...    92   2e-18
BC014224-1|AAH14224.1|  462|Homo sapiens eukaryotic translation ...    92   2e-18
BC012891-1|AAH12891.1|  462|Homo sapiens eukaryotic translation ...    92   2e-18
BC010735-1|AAH10735.1|  462|Homo sapiens eukaryotic translation ...    92   2e-18
BC009875-1|AAH09875.1|  462|Homo sapiens eukaryotic translation ...    92   2e-18
BC009733-1|AAH09733.1|  462|Homo sapiens eukaryotic translation ...    92   2e-18
BC008587-1|AAH08587.1|  462|Homo sapiens eukaryotic translation ...    92   2e-18
BC000432-1|AAH00432.1|  463|Homo sapiens eukaryotic translation ...    92   2e-18
AY043301-1|AAK95378.1|  462|Homo sapiens elongation factor 1-alp...    92   2e-18
AL603910-9|CAI40951.1|  145|Homo sapiens eukaryotic translation ...    92   2e-18
AL603910-8|CAI14883.1|  462|Homo sapiens eukaryotic translation ...    92   2e-18
AL593851-4|CAH73620.1|  462|Homo sapiens eukaryotic translation ...    92   2e-18
AL121829-9|CAC15522.1|  463|Homo sapiens EEF1A2 protein.               92   2e-18
AK223046-1|BAD96766.1|  462|Homo sapiens eukaryotic translation ...    92   2e-18
AK223030-1|BAD96750.1|  462|Homo sapiens eukaryotic translation ...    92   2e-18
AK222982-1|BAD96702.1|  462|Homo sapiens eukaryotic translation ...    92   2e-18
AK222551-1|BAD96271.1|  462|Homo sapiens eukaryotic translation ...    92   2e-18
AK222523-1|BAD96243.1|  462|Homo sapiens eukaryotic translation ...    92   2e-18
AK222515-1|BAD96235.1|  462|Homo sapiens eukaryotic translation ...    92   2e-18
AF267861-1|AAG44730.1|  427|Homo sapiens EF1a-like protein protein.    92   2e-18
AF163763-1|AAF80488.1|  463|Homo sapiens elongation factor 1 A-2...    92   2e-18
AB209064-1|BAD92301.1|  340|Homo sapiens eukaryotic translation ...    92   2e-18
AK223042-1|BAD96762.1|  433|Homo sapiens eukaryotic translation ...    90   6e-18
AF174496-1|AAF36537.1|  426|Homo sapiens glucocorticoid receptor...    90   9e-18
L41498-1|AAC09386.1|  398|Homo sapiens longation factor 1-alpha ...    81   3e-15
L41490-1|AAC09385.1|  398|Homo sapiens eukaryotic translation el...    81   3e-15
AY062434-1|AAL38981.1|  398|Homo sapiens elongation factor 1-alp...    81   3e-15
AF397403-1|AAK93966.1|  398|Homo sapiens translation elongation ...    81   3e-15
X03689-1|CAA27325.1|   94|Homo sapiens protein ( Human mRNA frag...    61   3e-09
BC070131-1|AAH70131.1|  111|Homo sapiens EEF1A1 protein protein.       61   3e-09
AL603910-10|CAO03613.1|  107|Homo sapiens eukaryotic translation...    61   3e-09
BC070500-1|AAH70500.1|   67|Homo sapiens EEF1A1 protein protein.       60   6e-09
AL445190-4|CAI95162.1|  453|Homo sapiens HBS1-like (S. cerevisia...    59   1e-08
AL353596-1|CAI17913.1|  453|Homo sapiens HBS1-like (S. cerevisia...    59   1e-08
X84694-1|CAA59169.1|  452|Homo sapiens mitochondrial elongation ...    54   7e-07
S75463-1|AAC60647.1|  452|Homo sapiens P43 protein.                    54   7e-07
L38995-1|AAB00499.1|  452|Homo sapiens elongation factor Tu prot...    54   7e-07
BC010041-1|AAH10041.2|  455|Homo sapiens Tu translation elongati...    54   7e-07
BC001633-1|AAH01633.2|  455|Homo sapiens Tu translation elongati...    54   7e-07
AK222519-1|BAD96239.1|  366|Homo sapiens eukaryotic translation ...    50   8e-06
AF328730-1|AAN09722.1|  361|Homo sapiens CTCL tumor antigen HD-C...    44   4e-04
AF322220-1|AAN51932.1|  361|Homo sapiens cervical cancer suppres...    44   4e-04
M29548-1|AAA52367.1|  327|Homo sapiens EEF1A protein.                  40   0.012
BC007933-1|AAH07933.1|  569|Homo sapiens EEFSEC protein protein.       39   0.016
AF268872-1|AAG13375.1|  526|Homo sapiens MJ0495-like protein Sel...    39   0.016
BC049210-1|AAH49210.1|  751|Homo sapiens G elongation factor, mi...    35   0.26 
BC036768-1|AAH36768.1|  669|Homo sapiens GUF1 GTPase homolog (S....    35   0.26 
AF367998-1|AAK53402.1|  751|Homo sapiens elongation factor G1 pr...    35   0.26 
AF309777-1|AAK58877.1|  751|Homo sapiens elongation factor G pro...    35   0.26 
AK023282-1|BAB14507.1|  669|Homo sapiens protein ( Homo sapiens ...    34   0.45 
L19161-1|AAA19696.1|  472|Homo sapiens translation initiation fa...    34   0.59 
DQ120619-1|ABB92405.1|  471|Homo sapiens eFI-2-gamma protein.          34   0.59 
BC087847-1|AAH87847.1|  465|Homo sapiens Unknown (protein for IM...    34   0.59 
BC019906-1|AAH19906.1|  472|Homo sapiens eukaryotic translation ...    34   0.59 
AK222577-1|BAD96297.1|  472|Homo sapiens eukaryotic translation ...    34   0.59 
AJ006932-1|CAA07331.1|  248|Homo sapiens eIF-2gA protein.              34   0.59 
L34600-1|AAA67038.1|  727|Homo sapiens initiation factor 2 protein.    33   1.4  
BC064977-1|AAH64977.1|  465|Homo sapiens MTIF2 protein protein.        33   1.4  
BC039848-1|AAH39848.1|  500|Homo sapiens Similar to mitochondria...    33   1.4  
AF495546-1|AAM70196.1|  727|Homo sapiens translation initiation ...    33   1.4  
AF494407-1|AAM14617.1|  727|Homo sapiens mitochondrial translati...    33   1.4  
D21163-1|BAA04699.2|  977|Homo sapiens KIAA0031 protein.               31   3.2  
CR456774-1|CAG33055.1|  972|Homo sapiens U5-116KD protein.             31   3.2  
BC030612-1|AAH30612.1|  777|Homo sapiens G elongation factor, mi...    31   3.2  
BC015712-1|AAH15712.1|  779|Homo sapiens GFM2 protein protein.         31   3.2  
BC002360-1|AAH02360.1|  972|Homo sapiens elongation factor Tu GT...    31   3.2  
AY453587-1|AAS49035.1|  531|Homo sapiens elongation factor G iso...    31   3.2  
AK025314-1|BAB15109.1|  513|Homo sapiens protein ( Homo sapiens ...    31   3.2  
AJ505017-1|CAD43720.1|  850|Homo sapiens small nuclear ribonucle...    31   3.2  
AJ001515-1|CAA04798.1| 4870|Homo sapiens ryanodine receptor 3 pr...    31   3.2  
AF367997-1|AAK53401.1|  779|Homo sapiens elongation factor G2 pr...    31   3.2  
AF183412-1|AAG09681.1|  435|Homo sapiens cytochrome P450 monooxy...    31   3.2  
AF111808-1|AAL39010.1|  732|Homo sapiens MSTP027 protein.              31   3.2  
AB001025-1|BAA23795.1| 4866|Homo sapiens brain ryanodine recepto...    31   3.2  
BC128262-1|AAI28263.1|  346|Homo sapiens ANKRD36 protein protein.      31   4.2  
BC032639-1|AAH32639.1| 1220|Homo sapiens eukaryotic translation ...    31   5.5  
AL133563-1|CAB63717.1| 1132|Homo sapiens hypothetical protein pr...    31   5.5  
AJ006776-1|CAB44357.1| 1220|Homo sapiens IF2 protein protein.          31   5.5  
AF078035-1|AAD16006.1| 1220|Homo sapiens translation initiation ...    31   5.5  
AC018690-1|AAY24313.1|  728|Homo sapiens unknown protein.              31   5.5  
AB018284-1|BAA34461.2| 1222|Homo sapiens KIAA0741 protein protein.     31   5.5  
BC044844-1|AAH44844.1|  450|Homo sapiens KIAA1641 protein protein.     30   9.6  
BC031883-1|AAH31883.1|  450|Homo sapiens KIAA1641 protein protein.     30   9.6  

>X17644-1|CAA35635.1|  499|Homo sapiens protein ( Human GST1-Hs mRNA
           for GTP-binding protein. ).
          Length = 499

 Score =  173 bits (420), Expect = 7e-43
 Identities = 78/82 (95%), Positives = 82/82 (100%)
 Frame = +3

Query: 264 WYLSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAV 443
           WYLSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGA+QADLAV
Sbjct: 121 WYLSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGASQADLAV 180

Query: 444 LVISARKGEFETGFDRGGQTRD 509
           LVISARKGEFETGF++GGQTR+
Sbjct: 181 LVISARKGEFETGFEKGGQTRE 202



 Score =  102 bits (244), Expect = 1e-21
 Identities = 54/87 (62%), Positives = 60/87 (68%)
 Frame = +1

Query: 58  ELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYER 237
           E  ++IPK K         KKEHVNVVFIGHVDAGKSTIGGQIM LTGMVDKRTLEKYER
Sbjct: 52  EEEEEIPKPKSVVAPPGAPKKEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYER 111

Query: 238 EAREKSENHGTYHGHWTQIKKNETKAK 318
           EA+EK  N  T++  W      E + K
Sbjct: 112 EAKEK--NRETWYLSWALDTNQEERDK 136



 Score = 83.8 bits (198), Expect = 6e-16
 Identities = 33/44 (75%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HAMLAKTAGVKHL+ L+NKMDDPTVNW  +RY EC+EK++P+LK
Sbjct: 203 HAMLAKTAGVKHLIVLINKMDDPTVNWSNERYEECKEKLVPFLK 246



 Score = 29.9 bits (64), Expect = 9.6
 Identities = 11/28 (39%), Positives = 19/28 (67%)
 Frame = +1

Query: 640 ELGFNTAKDLSFLPVSGQTGQVIRRLTE 723
           ++GFN  KD+ F+P SG TG  ++  ++
Sbjct: 247 KVGFNPKKDIHFMPCSGLTGANLKEQSD 274


>U95742-2|AAB67250.1|  499|Homo sapiens G1 to S phase transition
           protein protein.
          Length = 499

 Score =  173 bits (420), Expect = 7e-43
 Identities = 78/82 (95%), Positives = 82/82 (100%)
 Frame = +3

Query: 264 WYLSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAV 443
           WYLSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGA+QADLAV
Sbjct: 121 WYLSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGASQADLAV 180

Query: 444 LVISARKGEFETGFDRGGQTRD 509
           LVISARKGEFETGF++GGQTR+
Sbjct: 181 LVISARKGEFETGFEKGGQTRE 202



 Score =  102 bits (244), Expect = 1e-21
 Identities = 54/87 (62%), Positives = 60/87 (68%)
 Frame = +1

Query: 58  ELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYER 237
           E  ++IPK K         KKEHVNVVFIGHVDAGKSTIGGQIM LTGMVDKRTLEKYER
Sbjct: 52  EEEEEIPKPKSVVAPPGAPKKEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYER 111

Query: 238 EAREKSENHGTYHGHWTQIKKNETKAK 318
           EA+EK  N  T++  W      E + K
Sbjct: 112 EAKEK--NRETWYLSWALDTNQEERDK 136



 Score = 83.8 bits (198), Expect = 6e-16
 Identities = 33/44 (75%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HAMLAKTAGVKHL+ L+NKMDDPTVNW  +RY EC+EK++P+LK
Sbjct: 203 HAMLAKTAGVKHLIVLINKMDDPTVNWSNERYEECKEKLVPFLK 246



 Score = 29.9 bits (64), Expect = 9.6
 Identities = 11/28 (39%), Positives = 19/28 (67%)
 Frame = +1

Query: 640 ELGFNTAKDLSFLPVSGQTGQVIRRLTE 723
           ++GFN  KD+ F+P SG TG  ++  ++
Sbjct: 247 KVGFNPKKDIHFMPCSGLTGANLKEQSD 274


>BT006722-1|AAP35368.1|  498|Homo sapiens G1 to S phase transition 1
           protein.
          Length = 498

 Score =  173 bits (420), Expect = 7e-43
 Identities = 78/82 (95%), Positives = 82/82 (100%)
 Frame = +3

Query: 264 WYLSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAV 443
           WYLSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGA+QADLAV
Sbjct: 120 WYLSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGASQADLAV 179

Query: 444 LVISARKGEFETGFDRGGQTRD 509
           LVISARKGEFETGF++GGQTR+
Sbjct: 180 LVISARKGEFETGFEKGGQTRE 201



 Score =  102 bits (244), Expect = 1e-21
 Identities = 54/87 (62%), Positives = 60/87 (68%)
 Frame = +1

Query: 58  ELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYER 237
           E  ++IPK K         KKEHVNVVFIGHVDAGKSTIGGQIM LTGMVDKRTLEKYER
Sbjct: 51  EEEEEIPKPKSVVAPPGAPKKEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYER 110

Query: 238 EAREKSENHGTYHGHWTQIKKNETKAK 318
           EA+EK  N  T++  W      E + K
Sbjct: 111 EAKEK--NRETWYLSWALDTNQEERDK 135



 Score = 83.8 bits (198), Expect = 6e-16
 Identities = 33/44 (75%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HAMLAKTAGVKHL+ L+NKMDDPTVNW  +RY EC+EK++P+LK
Sbjct: 202 HAMLAKTAGVKHLIVLINKMDDPTVNWSNERYEECKEKLVPFLK 245



 Score = 29.9 bits (64), Expect = 9.6
 Identities = 11/28 (39%), Positives = 19/28 (67%)
 Frame = +1

Query: 640 ELGFNTAKDLSFLPVSGQTGQVIRRLTE 723
           ++GFN  KD+ F+P SG TG  ++  ++
Sbjct: 246 KVGFNPKKDIHFMPCSGLTGANLKEQSD 273


>BC009503-1|AAH09503.2|  633|Homo sapiens GSPT1 protein protein.
          Length = 633

 Score =  173 bits (420), Expect = 7e-43
 Identities = 78/82 (95%), Positives = 82/82 (100%)
 Frame = +3

Query: 264 WYLSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAV 443
           WYLSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGA+QADLAV
Sbjct: 255 WYLSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGASQADLAV 314

Query: 444 LVISARKGEFETGFDRGGQTRD 509
           LVISARKGEFETGF++GGQTR+
Sbjct: 315 LVISARKGEFETGFEKGGQTRE 336



 Score =  102 bits (244), Expect = 1e-21
 Identities = 54/87 (62%), Positives = 60/87 (68%)
 Frame = +1

Query: 58  ELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYER 237
           E  ++IPK K         KKEHVNVVFIGHVDAGKSTIGGQIM LTGMVDKRTLEKYER
Sbjct: 186 EEEEEIPKPKSVVAPPGAPKKEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYER 245

Query: 238 EAREKSENHGTYHGHWTQIKKNETKAK 318
           EA+EK  N  T++  W      E + K
Sbjct: 246 EAKEK--NRETWYLSWALDTNQEERDK 270



 Score = 83.8 bits (198), Expect = 6e-16
 Identities = 33/44 (75%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HAMLAKTAGVKHL+ L+NKMDDPTVNW  +RY EC+EK++P+LK
Sbjct: 337 HAMLAKTAGVKHLIVLINKMDDPTVNWSNERYEECKEKLVPFLK 380



 Score = 29.9 bits (64), Expect = 9.6
 Identities = 11/28 (39%), Positives = 19/28 (67%)
 Frame = +1

Query: 640 ELGFNTAKDLSFLPVSGQTGQVIRRLTE 723
           ++GFN  KD+ F+P SG TG  ++  ++
Sbjct: 381 KVGFNPKKDIHFMPCSGLTGANLKEQSD 408


>BC036077-1|AAH36077.1|  628|Homo sapiens G1 to S phase transition 2
           protein.
          Length = 628

 Score =  171 bits (417), Expect = 2e-42
 Identities = 77/82 (93%), Positives = 82/82 (100%)
 Frame = +3

Query: 264 WYLSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAV 443
           WYLSWALDTNQEERDKGKTVEVGRAYFETE+KHFTILDAPGHKSFVPNMIGGA+QADLAV
Sbjct: 250 WYLSWALDTNQEERDKGKTVEVGRAYFETERKHFTILDAPGHKSFVPNMIGGASQADLAV 309

Query: 444 LVISARKGEFETGFDRGGQTRD 509
           LVISARKGEFETGF++GGQTR+
Sbjct: 310 LVISARKGEFETGFEKGGQTRE 331



 Score =  101 bits (242), Expect = 3e-21
 Identities = 57/96 (59%), Positives = 63/96 (65%), Gaps = 4/96 (4%)
 Frame = +1

Query: 43  PNEDG----ELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVD 210
           P E G    E  ++I K K   V     KKEHVNVVFIGHVDAGKSTIGGQIM LTGMVD
Sbjct: 172 PEESGQEMMEEKEEIRKSKSVIVPSGAPKKEHVNVVFIGHVDAGKSTIGGQIMFLTGMVD 231

Query: 211 KRTLEKYEREAREKSENHGTYHGHWTQIKKNETKAK 318
           KRTLEKYEREA+EK  N  T++  W      E + K
Sbjct: 232 KRTLEKYEREAKEK--NRETWYLSWALDTNQEERDK 265



 Score = 79.0 bits (186), Expect = 2e-14
 Identities = 32/44 (72%), Positives = 39/44 (88%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HAMLAKTAGVKHL+ L+NKMDD TVNW  +RY EC+EK++P+LK
Sbjct: 332 HAMLAKTAGVKHLIVLINKMDDHTVNWSIERYEECKEKLVPFLK 375


>AL929101-2|CAH71524.1|  628|Homo sapiens G1 to S phase transition 2
           protein.
          Length = 628

 Score =  171 bits (417), Expect = 2e-42
 Identities = 77/82 (93%), Positives = 82/82 (100%)
 Frame = +3

Query: 264 WYLSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAV 443
           WYLSWALDTNQEERDKGKTVEVGRAYFETE+KHFTILDAPGHKSFVPNMIGGA+QADLAV
Sbjct: 250 WYLSWALDTNQEERDKGKTVEVGRAYFETERKHFTILDAPGHKSFVPNMIGGASQADLAV 309

Query: 444 LVISARKGEFETGFDRGGQTRD 509
           LVISARKGEFETGF++GGQTR+
Sbjct: 310 LVISARKGEFETGFEKGGQTRE 331



 Score =  101 bits (242), Expect = 3e-21
 Identities = 57/96 (59%), Positives = 63/96 (65%), Gaps = 4/96 (4%)
 Frame = +1

Query: 43  PNEDG----ELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVD 210
           P E G    E  ++I K K   V     KKEHVNVVFIGHVDAGKSTIGGQIM LTGMVD
Sbjct: 172 PEESGQEMMEEKEEIRKSKSVIVPSGAPKKEHVNVVFIGHVDAGKSTIGGQIMFLTGMVD 231

Query: 211 KRTLEKYEREAREKSENHGTYHGHWTQIKKNETKAK 318
           KRTLEKYEREA+EK  N  T++  W      E + K
Sbjct: 232 KRTLEKYEREAKEK--NRETWYLSWALDTNQEERDK 265



 Score = 82.6 bits (195), Expect = 1e-15
 Identities = 33/44 (75%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HAMLAKTAGVKHL+ L+NKMDDPTVNW  +RY EC+EK++P+LK
Sbjct: 332 HAMLAKTAGVKHLIVLINKMDDPTVNWSIERYEECKEKLVPFLK 375


>AK023155-1|BAB14435.1|  504|Homo sapiens protein ( Homo sapiens
           cDNA FLJ13093 fis, clone NT2RP3002151, highly similar to
           G1 TO S PHASE TRANSITION PROTEIN 1 HOMOLOG. ).
          Length = 504

 Score =  171 bits (417), Expect = 2e-42
 Identities = 77/82 (93%), Positives = 82/82 (100%)
 Frame = +3

Query: 264 WYLSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAV 443
           WYLSWALDTNQEERDKGKTVEVGRAYFETE+KHFTILDAPGHKSFVPNMIGGA+QADLAV
Sbjct: 147 WYLSWALDTNQEERDKGKTVEVGRAYFETERKHFTILDAPGHKSFVPNMIGGASQADLAV 206

Query: 444 LVISARKGEFETGFDRGGQTRD 509
           LVISARKGEFETGF++GGQTR+
Sbjct: 207 LVISARKGEFETGFEKGGQTRE 228



 Score =  101 bits (242), Expect = 3e-21
 Identities = 57/96 (59%), Positives = 63/96 (65%), Gaps = 4/96 (4%)
 Frame = +1

Query: 43  PNEDG----ELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVD 210
           P E G    E  ++I K K   V     KKEHVNVVFIGHVDAGKSTIGGQIM LTGMVD
Sbjct: 69  PEESGQEMMEEKEEIRKSKSVIVPSGAPKKEHVNVVFIGHVDAGKSTIGGQIMFLTGMVD 128

Query: 211 KRTLEKYEREAREKSENHGTYHGHWTQIKKNETKAK 318
           KRTLEKYEREA+EK  N  T++  W      E + K
Sbjct: 129 KRTLEKYEREAKEK--NRETWYLSWALDTNQEERDK 162



 Score = 82.6 bits (195), Expect = 1e-15
 Identities = 33/44 (75%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HAMLAKTAGVKHL+ L+NKMDDPTVNW  +RY EC+EK++P+LK
Sbjct: 229 HAMLAKTAGVKHLIVLINKMDDPTVNWSIERYEECKEKLVPFLK 272


>AJ251548-1|CAB91089.1|  628|Homo sapiens polypeptide chain release
           factor 3b protein.
          Length = 628

 Score =  171 bits (417), Expect = 2e-42
 Identities = 77/82 (93%), Positives = 82/82 (100%)
 Frame = +3

Query: 264 WYLSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAV 443
           WYLSWALDTNQEERDKGKTVEVGRAYFETE+KHFTILDAPGHKSFVPNMIGGA+QADLAV
Sbjct: 250 WYLSWALDTNQEERDKGKTVEVGRAYFETERKHFTILDAPGHKSFVPNMIGGASQADLAV 309

Query: 444 LVISARKGEFETGFDRGGQTRD 509
           LVISARKGEFETGF++GGQTR+
Sbjct: 310 LVISARKGEFETGFEKGGQTRE 331



 Score =  101 bits (242), Expect = 3e-21
 Identities = 57/96 (59%), Positives = 63/96 (65%), Gaps = 4/96 (4%)
 Frame = +1

Query: 43  PNEDG----ELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVD 210
           P E G    E  ++I K K   V     KKEHVNVVFIGHVDAGKSTIGGQIM LTGMVD
Sbjct: 172 PEESGQEMMEEKEEIRKSKSVIVPSGAPKKEHVNVVFIGHVDAGKSTIGGQIMFLTGMVD 231

Query: 211 KRTLEKYEREAREKSENHGTYHGHWTQIKKNETKAK 318
           KRTLEKYEREA+EK  N  T++  W      E + K
Sbjct: 232 KRTLEKYEREAKEK--NRETWYLSWALDTNQEERDK 265



 Score = 82.6 bits (195), Expect = 1e-15
 Identities = 33/44 (75%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HAMLAKTAGVKHL+ L+NKMDDPTVNW  +RY EC+EK++P+LK
Sbjct: 332 HAMLAKTAGVKHLIVLINKMDDPTVNWSIERYEECKEKLVPFLK 375


>AK001303-1|BAA91612.1|  628|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10441 fis, clone NT2RP1000733, highly similar to
           Human mRNA for GSPT1-TK protein. ).
          Length = 628

 Score =  170 bits (413), Expect = 5e-42
 Identities = 76/82 (92%), Positives = 81/82 (98%)
 Frame = +3

Query: 264 WYLSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAV 443
           WYLSWALDTNQEERDKGKTVEVGRAYFETE+KHFTILDAPGHK FVPNMIGGA+QADLAV
Sbjct: 250 WYLSWALDTNQEERDKGKTVEVGRAYFETERKHFTILDAPGHKGFVPNMIGGASQADLAV 309

Query: 444 LVISARKGEFETGFDRGGQTRD 509
           LVISARKGEFETGF++GGQTR+
Sbjct: 310 LVISARKGEFETGFEKGGQTRE 331



 Score =  101 bits (242), Expect = 3e-21
 Identities = 57/96 (59%), Positives = 63/96 (65%), Gaps = 4/96 (4%)
 Frame = +1

Query: 43  PNEDG----ELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVD 210
           P E G    E  ++I K K   V     KKEHVNVVFIGHVDAGKSTIGGQIM LTGMVD
Sbjct: 172 PEESGQEMMEEKEEIRKSKSVIVPSGAPKKEHVNVVFIGHVDAGKSTIGGQIMFLTGMVD 231

Query: 211 KRTLEKYEREAREKSENHGTYHGHWTQIKKNETKAK 318
           KRTLEKYEREA+EK  N  T++  W      E + K
Sbjct: 232 KRTLEKYEREAKEK--NRETWYLSWALDTNQEERDK 265



 Score = 82.6 bits (195), Expect = 1e-15
 Identities = 33/44 (75%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HAMLAKTAGVKHL+ L+NKMDDPTVNW  +RY EC+EK++P+LK
Sbjct: 332 HAMLAKTAGVKHLIVLINKMDDPTVNWSIERYEECKEKLVPFLK 375


>U87791-1|AAD00645.1|  684|Homo sapiens eRFS protein.
          Length = 684

 Score =  110 bits (265), Expect = 4e-24
 Identities = 48/79 (60%), Positives = 61/79 (77%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD   EER++G T++VG   FET  K  T++DAPGHK F+PNMI GAAQAD+AVLV+
Sbjct: 310 AWVLDETGEERERGVTMDVGMTKFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVV 369

Query: 453 SARKGEFETGFDRGGQTRD 509
            A +GEFE GF+ GGQTR+
Sbjct: 370 DASRGEFEAGFETGGQTRE 388



 Score = 59.3 bits (137), Expect = 1e-08
 Identities = 29/75 (38%), Positives = 49/75 (65%)
 Frame = +1

Query: 49  EDGELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEK 228
           + G+L ++I  K    +E  +  K+ +N+V IGHVDAGKST+ G ++ L G ++KRT+ K
Sbjct: 237 KSGKLRQQIDVKA--ELEKRQGGKQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHK 294

Query: 229 YEREAREKSENHGTY 273
           YE+E+++  +    Y
Sbjct: 295 YEQESKKAGKASFAY 309



 Score = 39.1 bits (87), Expect = 0.016
 Identities = 18/44 (40%), Positives = 26/44 (59%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           H +L ++ GV  L   VNKMD   VNW ++R+ E   K+  +LK
Sbjct: 389 HGLLVRSLGVTQLAVAVNKMDQ--VNWQQERFQEITGKLGHFLK 430


>BC040849-1|AAH40849.1|  684|Homo sapiens HBS1-like (S. cerevisiae)
           protein.
          Length = 684

 Score =  110 bits (265), Expect = 4e-24
 Identities = 48/79 (60%), Positives = 61/79 (77%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD   EER++G T++VG   FET  K  T++DAPGHK F+PNMI GAAQAD+AVLV+
Sbjct: 310 AWVLDETGEERERGVTMDVGMTKFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVV 369

Query: 453 SARKGEFETGFDRGGQTRD 509
            A +GEFE GF+ GGQTR+
Sbjct: 370 DASRGEFEAGFETGGQTRE 388



 Score = 59.3 bits (137), Expect = 1e-08
 Identities = 29/75 (38%), Positives = 49/75 (65%)
 Frame = +1

Query: 49  EDGELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEK 228
           + G+L ++I  K    +E  +  K+ +N+V IGHVDAGKST+ G ++ L G ++KRT+ K
Sbjct: 237 KSGKLRQQIDVKA--ELEKRQGGKQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHK 294

Query: 229 YEREAREKSENHGTY 273
           YE+E+++  +    Y
Sbjct: 295 YEQESKKAGKASFAY 309



 Score = 39.1 bits (87), Expect = 0.016
 Identities = 18/44 (40%), Positives = 26/44 (59%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           H +L ++ GV  L   VNKMD   VNW ++R+ E   K+  +LK
Sbjct: 389 HGLLVRSLGVTQLAVAVNKMDQ--VNWQQERFQEITGKLGHFLK 430


>BC001465-1|AAH01465.1|  684|Homo sapiens HBS1-like (S. cerevisiae)
           protein.
          Length = 684

 Score =  110 bits (265), Expect = 4e-24
 Identities = 48/79 (60%), Positives = 61/79 (77%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD   EER++G T++VG   FET  K  T++DAPGHK F+PNMI GAAQAD+AVLV+
Sbjct: 310 AWVLDETGEERERGVTMDVGMTKFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVV 369

Query: 453 SARKGEFETGFDRGGQTRD 509
            A +GEFE GF+ GGQTR+
Sbjct: 370 DASRGEFEAGFETGGQTRE 388



 Score = 59.3 bits (137), Expect = 1e-08
 Identities = 29/75 (38%), Positives = 49/75 (65%)
 Frame = +1

Query: 49  EDGELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEK 228
           + G+L ++I  K    +E  +  K+ +N+V IGHVDAGKST+ G ++ L G ++KRT+ K
Sbjct: 237 KSGKLRQQIDVKA--ELEKRQGGKQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHK 294

Query: 229 YEREAREKSENHGTY 273
           YE+E+++  +    Y
Sbjct: 295 YEQESKKAGKASFAY 309



 Score = 39.1 bits (87), Expect = 0.016
 Identities = 18/44 (40%), Positives = 26/44 (59%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           H +L ++ GV  L   VNKMD   VNW ++R+ E   K+  +LK
Sbjct: 389 HGLLVRSLGVTQLAVAVNKMDQ--VNWQQERFQEITGKLGHFLK 430


>AL445190-5|CAI95161.1|  684|Homo sapiens HBS1-like (S. cerevisiae)
           protein.
          Length = 684

 Score =  110 bits (265), Expect = 4e-24
 Identities = 48/79 (60%), Positives = 61/79 (77%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD   EER++G T++VG   FET  K  T++DAPGHK F+PNMI GAAQAD+AVLV+
Sbjct: 310 AWVLDETGEERERGVTMDVGMTKFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVV 369

Query: 453 SARKGEFETGFDRGGQTRD 509
            A +GEFE GF+ GGQTR+
Sbjct: 370 DASRGEFEAGFETGGQTRE 388



 Score = 59.3 bits (137), Expect = 1e-08
 Identities = 29/75 (38%), Positives = 49/75 (65%)
 Frame = +1

Query: 49  EDGELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEK 228
           + G+L ++I  K    +E  +  K+ +N+V IGHVDAGKST+ G ++ L G ++KRT+ K
Sbjct: 237 KSGKLRQQIDVKA--ELEKRQGGKQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHK 294

Query: 229 YEREAREKSENHGTY 273
           YE+E+++  +    Y
Sbjct: 295 YEQESKKAGKASFAY 309



 Score = 39.1 bits (87), Expect = 0.016
 Identities = 18/44 (40%), Positives = 26/44 (59%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           H +L ++ GV  L   VNKMD   VNW ++R+ E   K+  +LK
Sbjct: 389 HGLLVRSLGVTQLAVAVNKMDQ--VNWQQERFQEITGKLGHFLK 430


>AL353596-2|CAI17912.1|  684|Homo sapiens HBS1-like (S. cerevisiae)
           protein.
          Length = 684

 Score =  110 bits (265), Expect = 4e-24
 Identities = 48/79 (60%), Positives = 61/79 (77%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD   EER++G T++VG   FET  K  T++DAPGHK F+PNMI GAAQAD+AVLV+
Sbjct: 310 AWVLDETGEERERGVTMDVGMTKFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVV 369

Query: 453 SARKGEFETGFDRGGQTRD 509
            A +GEFE GF+ GGQTR+
Sbjct: 370 DASRGEFEAGFETGGQTRE 388



 Score = 59.3 bits (137), Expect = 1e-08
 Identities = 29/75 (38%), Positives = 49/75 (65%)
 Frame = +1

Query: 49  EDGELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEK 228
           + G+L ++I  K    +E  +  K+ +N+V IGHVDAGKST+ G ++ L G ++KRT+ K
Sbjct: 237 KSGKLRQQIDVKA--ELEKRQGGKQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHK 294

Query: 229 YEREAREKSENHGTY 273
           YE+E+++  +    Y
Sbjct: 295 YEQESKKAGKASFAY 309



 Score = 39.1 bits (87), Expect = 0.016
 Identities = 18/44 (40%), Positives = 26/44 (59%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           H +L ++ GV  L   VNKMD   VNW ++R+ E   K+  +LK
Sbjct: 389 HGLLVRSLGVTQLAVAVNKMDQ--VNWQQERFQEITGKLGHFLK 430


>AJ459826-1|CAD30873.1|  684|Homo sapiens HBS1-like protein protein.
          Length = 684

 Score =  110 bits (265), Expect = 4e-24
 Identities = 48/79 (60%), Positives = 61/79 (77%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD   EER++G T++VG   FET  K  T++DAPGHK F+PNMI GAAQAD+AVLV+
Sbjct: 310 AWVLDETGEERERGVTMDVGMTKFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVV 369

Query: 453 SARKGEFETGFDRGGQTRD 509
            A +GEFE GF+ GGQTR+
Sbjct: 370 DASRGEFEAGFETGGQTRE 388



 Score = 59.3 bits (137), Expect = 1e-08
 Identities = 29/75 (38%), Positives = 49/75 (65%)
 Frame = +1

Query: 49  EDGELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEK 228
           + G+L ++I  K    +E  +  K+ +N+V IGHVDAGKST+ G ++ L G ++KRT+ K
Sbjct: 237 KSGKLRQQIDVKA--ELEKRQGGKQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHK 294

Query: 229 YEREAREKSENHGTY 273
           YE+E+++  +    Y
Sbjct: 295 YEQESKKAGKASFAY 309



 Score = 39.1 bits (87), Expect = 0.016
 Identities = 18/44 (40%), Positives = 26/44 (59%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           H +L ++ GV  L   VNKMD   VNW ++R+ E   K+  +LK
Sbjct: 389 HGLLVRSLGVTQLAVAVNKMDQ--VNWQQERFQEITGKLGHFLK 430


>AB028961-1|BAA82990.1|  496|Homo sapiens KIAA1038 protein protein.
          Length = 496

 Score =  110 bits (265), Expect = 4e-24
 Identities = 48/79 (60%), Positives = 61/79 (77%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD   EER++G T++VG   FET  K  T++DAPGHK F+PNMI GAAQAD+AVLV+
Sbjct: 122 AWVLDETGEERERGVTMDVGMTKFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVV 181

Query: 453 SARKGEFETGFDRGGQTRD 509
            A +GEFE GF+ GGQTR+
Sbjct: 182 DASRGEFEAGFETGGQTRE 200



 Score = 59.3 bits (137), Expect = 1e-08
 Identities = 29/75 (38%), Positives = 49/75 (65%)
 Frame = +1

Query: 49  EDGELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEK 228
           + G+L ++I  K    +E  +  K+ +N+V IGHVDAGKST+ G ++ L G ++KRT+ K
Sbjct: 49  KSGKLRQQIDVKA--ELEKRQGGKQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHK 106

Query: 229 YEREAREKSENHGTY 273
           YE+E+++  +    Y
Sbjct: 107 YEQESKKAGKASFAY 121



 Score = 39.1 bits (87), Expect = 0.016
 Identities = 18/44 (40%), Positives = 26/44 (59%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           H +L ++ GV  L   VNKMD   VNW ++R+ E   K+  +LK
Sbjct: 201 HGLLVRSLGVTQLAVAVNKMDQ--VNWQQERFQEITGKLGHFLK 242


>X70940-1|CAA50280.1|  463|Homo sapiens elongation factor 1 alpha-2
           protein.
          Length = 463

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGVGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKY 56



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 21/44 (47%), Positives = 29/44 (65%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + EKRY+E  +++  Y+K
Sbjct: 136 HALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIK 179


>X16869-1|CAA34756.1|  462|Homo sapiens protein ( Human mRNA for
           elongation factor 1-alpha (clone CEF4). ).
          Length = 462

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGVGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKY 56



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + +KRY E  +++  Y+K
Sbjct: 136 HALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIK 179


>X03558-1|CAA27245.1|  462|Homo sapiens protein ( Human mRNA for
           elongation factor 1 alpha subunit (EF-1 alpha). ).
          Length = 462

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGVGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKY 56



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + +KRY E  +++  Y+K
Sbjct: 136 HALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIK 179


>L10340-1|AAA91835.1|  435|Homo sapiens elongation factor-1 alpha
           protein.
          Length = 435

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 29  AWVLDKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIV 88

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 89  AAGVGEFEAGISKNGQTRE 107



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 21/44 (47%), Positives = 29/44 (65%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + EKRY+E  +++  Y+K
Sbjct: 108 HALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIK 151



 Score = 29.9 bits (64), Expect = 9.6
 Identities = 12/25 (48%), Positives = 17/25 (68%)
 Frame = +1

Query: 199 GMVDKRTLEKYEREAREKSENHGTY 273
           G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   GGIDKRTIEKFEKEAAEMGKGSFKY 28


>J04617-1|AAA52343.1|  462|Homo sapiens EEF1A protein.
          Length = 462

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGVGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKY 56



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + +KRY E  +++  Y+K
Sbjct: 136 HALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIK 179


>EF362804-1|ABO30531.1|  462|Homo sapiens EF1a protein.
          Length = 462

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGVGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKY 56



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + +KRY E  +++  Y+K
Sbjct: 136 HALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIK 179


>BC111051-1|AAI11052.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGVGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKY 56



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + +KRY E  +++  Y+K
Sbjct: 136 HALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIK 179


>BC110409-1|AAI10410.1|  463|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 2 protein.
          Length = 463

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGVGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKY 56



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 21/44 (47%), Positives = 29/44 (65%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + EKRY+E  +++  Y+K
Sbjct: 136 HALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIK 179


>BC082268-1|AAH82268.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGVGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKY 56



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + +KRY E  +++  Y+K
Sbjct: 136 HALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIK 179


>BC072385-1|AAH72385.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGVGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKY 56



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + +KRY E  +++  Y+K
Sbjct: 136 HALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIK 179


>BC071841-1|AAH71841.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGVGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKY 56



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + +KRY E  +++  Y+K
Sbjct: 136 HALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIK 179


>BC071741-1|AAH71741.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGVGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKY 56



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + +KRY E  +++  Y+K
Sbjct: 136 HALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIK 179


>BC071727-1|AAH71727.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGVGEFEAGISKNGQTRE 135



 Score = 60.9 bits (141), Expect = 5e-09
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKFGGIDKRTIEKFEKEAAEMGKGSFKY 56



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + +KRY E  +++  Y+K
Sbjct: 136 HALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIK 179


>BC071619-1|AAH71619.1|  441|Homo sapiens EEF1A1 protein protein.
          Length = 441

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGVGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKY 56


>BC066893-1|AAH66893.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGVGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKY 56



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + +KRY E  +++  Y+K
Sbjct: 136 HALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIK 179


>BC057391-1|AAH57391.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGVGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKY 56



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + +KRY E  +++  Y+K
Sbjct: 136 HALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIK 179


>BC038339-1|AAH38339.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGVGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKY 56



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + +KRY E  +++  Y+K
Sbjct: 136 HALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIK 179


>BC028674-1|AAH28674.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGVGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKY 56



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + +KRY E  +++  Y+K
Sbjct: 136 HALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIK 179


>BC021686-1|AAH21686.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGVGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKY 56



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + +KRY E  +++  Y+K
Sbjct: 136 HALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIK 179


>BC019669-1|AAH19669.1|  462|Homo sapiens EEF1A1 protein protein.
          Length = 462

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGVGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKY 56



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + +KRY E  +++  Y+K
Sbjct: 136 HALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIK 179


>BC018641-1|AAH18641.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGVGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKY 56



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + +KRY E  +++  Y+K
Sbjct: 136 HALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIK 179


>BC018150-1|AAH18150.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGVGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKY 56



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + +KRY E  +++  Y+K
Sbjct: 136 HALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIK 179


>BC014224-1|AAH14224.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGVGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKY 56



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + +KRY E  +++  Y+K
Sbjct: 136 HALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIK 179


>BC012891-1|AAH12891.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGVGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKY 56



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + +KRY E  +++  Y+K
Sbjct: 136 HALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIK 179


>BC010735-1|AAH10735.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGVGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKY 56



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + +KRY E  +++  Y+K
Sbjct: 136 HALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIK 179


>BC009875-1|AAH09875.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGVGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKY 56



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + +KRY E  +++  Y+K
Sbjct: 136 HALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIK 179


>BC009733-1|AAH09733.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGVGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKY 56



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + +KRY E  +++  Y+K
Sbjct: 136 HALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIK 179


>BC008587-1|AAH08587.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGVGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKY 56



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + +KRY E  +++  Y+K
Sbjct: 136 HALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIK 179


>BC000432-1|AAH00432.1|  463|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 2 protein.
          Length = 463

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGVGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKY 56



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 21/44 (47%), Positives = 29/44 (65%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + EKRY+E  +++  Y+K
Sbjct: 136 HALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIK 179


>AY043301-1|AAK95378.1|  462|Homo sapiens elongation factor 1-alpha
           protein.
          Length = 462

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGVGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKY 56



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + +KRY E  +++  Y+K
Sbjct: 136 HALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIK 179


>AL603910-9|CAI40951.1|  145|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 145

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGVGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKY 56


>AL603910-8|CAI14883.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGVGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKY 56



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + +KRY E  +++  Y+K
Sbjct: 136 HALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIK 179


>AL593851-4|CAH73620.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha-like 3 protein.
          Length = 462

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGVGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKY 56



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + +KRY E  +++  Y+K
Sbjct: 136 HALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIK 179


>AL121829-9|CAC15522.1|  463|Homo sapiens EEF1A2 protein.
          Length = 463

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGVGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKY 56



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 21/44 (47%), Positives = 29/44 (65%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + EKRY+E  +++  Y+K
Sbjct: 136 HALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIK 179


>AK223046-1|BAD96766.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 462

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGVGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKY 56



 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + +KRY E  +++  Y+K
Sbjct: 136 HALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIAKEVSTYIK 179


>AK223030-1|BAD96750.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 462

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGVGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKY 56



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + +KRY E  +++  Y+K
Sbjct: 136 HALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIK 179


>AK222982-1|BAD96702.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 462

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGVGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKY 56



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + +KRY E  +++  Y+K
Sbjct: 136 HALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSAYIK 179


>AK222551-1|BAD96271.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 462

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGVGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKY 56



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + +KRY E  +++  Y+K
Sbjct: 136 HALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIK 179


>AK222523-1|BAD96243.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 462

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGVGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKY 56



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + +KRY E  +++  Y+K
Sbjct: 136 HALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIK 179


>AK222515-1|BAD96235.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 462

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGVGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKY 56



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + +KRY E  +++  Y+K
Sbjct: 136 HALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIK 179


>AF267861-1|AAG44730.1|  427|Homo sapiens EF1a-like protein protein.
          Length = 427

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGVGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKY 56



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + +KRY E  +++  Y+K
Sbjct: 136 HALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIK 179


>AF163763-1|AAF80488.1|  463|Homo sapiens elongation factor 1 A-2
           protein.
          Length = 463

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGVGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKY 56



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 21/44 (47%), Positives = 29/44 (65%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + EKRY+E  +++  Y+K
Sbjct: 136 HALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIK 179


>AB209064-1|BAD92301.1|  340|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 2 variant protein.
          Length = 340

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 33  AWVLDKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIV 92

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 93  AAGVGEFEAGISKNGQTRE 111



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 21/44 (47%), Positives = 29/44 (65%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + EKRY+E  +++  Y+K
Sbjct: 112 HALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIK 155


>AK223042-1|BAD96762.1|  433|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 433

 Score = 90.2 bits (214), Expect = 6e-18
 Identities = 38/79 (48%), Positives = 55/79 (69%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + T +DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 28  AWVLDKLKAERERGITIDISLWKFETSKYYVTTIDAPGHRDFIKNMITGTSQADCAVLIV 87

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 88  AAGVGEFEAGISKNGQTRE 106



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + +KRY E  +++  Y+K
Sbjct: 107 HALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIK 150



 Score = 29.9 bits (64), Expect = 9.6
 Identities = 12/25 (48%), Positives = 17/25 (68%)
 Frame = +1

Query: 199 GMVDKRTLEKYEREAREKSENHGTY 273
           G +DKRT+EK+E+EA E  +    Y
Sbjct: 3   GGIDKRTIEKFEKEAAEMGKGSFKY 27


>AF174496-1|AAF36537.1|  426|Homo sapiens glucocorticoid receptor
           AF-1 specific elongation factor protein.
          Length = 426

 Score = 89.8 bits (213), Expect = 9e-18
 Identities = 38/79 (48%), Positives = 55/79 (69%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W  D  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 21  AWVWDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 80

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 81  AAGVGEFEAGISKNGQTRE 99



 Score = 39.1 bits (87), Expect = 0.016
 Identities = 18/44 (40%), Positives = 26/44 (59%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNK       + +KRY E  +++  Y+K
Sbjct: 100 HALLAYTLGVKQLIVGVNKSHSTEPPYSQKRYEEIVKEVRTYIK 143


>L41498-1|AAC09386.1|  398|Homo sapiens longation factor 1-alpha 1
           protein.
          Length = 398

 Score = 81.4 bits (192), Expect = 3e-15
 Identities = 34/70 (48%), Positives = 50/70 (71%)
 Frame = +3

Query: 300 ERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARKGEFET 479
           + ++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL+++A  GEFE 
Sbjct: 2   QSERGITIDISLWKFETSKYYVTIIDAPGHRDFIQNMITGTSQADCAVLIVAAGVGEFEA 61

Query: 480 GFDRGGQTRD 509
           G  + GQTR+
Sbjct: 62  GISKNGQTRE 71



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + +KRY E  +++  Y+K
Sbjct: 72  HALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIK 115


>L41490-1|AAC09385.1|  398|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1-like 14 protein.
          Length = 398

 Score = 81.4 bits (192), Expect = 3e-15
 Identities = 34/70 (48%), Positives = 50/70 (71%)
 Frame = +3

Query: 300 ERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARKGEFET 479
           + ++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL+++A  GEFE 
Sbjct: 2   QSERGITIDISLWKFETSKYYVTIIDAPGHRDFIQNMITGTSQADCAVLIVAAGVGEFEA 61

Query: 480 GFDRGGQTRD 509
           G  + GQTR+
Sbjct: 62  GISKNGQTRE 71



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + +KRY E  +++  Y+K
Sbjct: 72  HALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIK 115


>AY062434-1|AAL38981.1|  398|Homo sapiens elongation factor 1-alpha
           1 protein.
          Length = 398

 Score = 81.4 bits (192), Expect = 3e-15
 Identities = 34/70 (48%), Positives = 50/70 (71%)
 Frame = +3

Query: 300 ERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARKGEFET 479
           + ++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL+++A  GEFE 
Sbjct: 2   QSERGITIDISLWKFETSKYYVTIIDAPGHRDFIQNMITGTSQADCAVLIVAAGVGEFEA 61

Query: 480 GFDRGGQTRD 509
           G  + GQTR+
Sbjct: 62  GISKNGQTRE 71



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + +KRY E  +++  Y+K
Sbjct: 72  HALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIK 115


>AF397403-1|AAK93966.1|  398|Homo sapiens translation elongation
           factor 1 alpha 1-like 14 protein.
          Length = 398

 Score = 81.4 bits (192), Expect = 3e-15
 Identities = 34/70 (48%), Positives = 50/70 (71%)
 Frame = +3

Query: 300 ERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARKGEFET 479
           + ++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL+++A  GEFE 
Sbjct: 2   QSERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEA 61

Query: 480 GFDRGGQTRD 509
           G  + GQTR+
Sbjct: 62  GISKNGQTRE 71



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + +KRY E  +++  Y+K
Sbjct: 72  HALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIK 115


>X03689-1|CAA27325.1|   94|Homo sapiens protein ( Human mRNA
           fragment for elongation factor TU (N-terminus). ).
          Length = 94

 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKY 56



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 17/38 (44%), Positives = 26/38 (68%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPG 386
           +W LD  + ER++G T+++    FET K + TI+DAPG
Sbjct: 57  AWVLDKLKAERERGITIDISLWKFETAKYYVTIIDAPG 94


>BC070131-1|AAH70131.1|  111|Homo sapiens EEF1A1 protein protein.
          Length = 111

 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKY 56


>AL603910-10|CAO03613.1|  107|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 107

 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA E  +    Y
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKY 56



 Score = 57.6 bits (133), Expect = 4e-08
 Identities = 23/51 (45%), Positives = 35/51 (68%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAA 425
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +
Sbjct: 57  AWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTS 107


>BC070500-1|AAH70500.1|   67|Homo sapiens EEF1A1 protein protein.
          Length = 67

 Score = 60.5 bits (140), Expect = 6e-09
 Identities = 25/45 (55%), Positives = 35/45 (77%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREARE 249
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA E
Sbjct: 4   EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAE 48


>AL445190-4|CAI95162.1|  453|Homo sapiens HBS1-like (S. cerevisiae)
           protein.
          Length = 453

 Score = 59.3 bits (137), Expect = 1e-08
 Identities = 29/75 (38%), Positives = 49/75 (65%)
 Frame = +1

Query: 49  EDGELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEK 228
           + G+L ++I  K    +E  +  K+ +N+V IGHVDAGKST+ G ++ L G ++KRT+ K
Sbjct: 237 KSGKLRQQIDVKA--ELEKRQGGKQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHK 294

Query: 229 YEREAREKSENHGTY 273
           YE+E+++  +    Y
Sbjct: 295 YEQESKKAGKASFAY 309


>AL353596-1|CAI17913.1|  453|Homo sapiens HBS1-like (S. cerevisiae)
           protein.
          Length = 453

 Score = 59.3 bits (137), Expect = 1e-08
 Identities = 29/75 (38%), Positives = 49/75 (65%)
 Frame = +1

Query: 49  EDGELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEK 228
           + G+L ++I  K    +E  +  K+ +N+V IGHVDAGKST+ G ++ L G ++KRT+ K
Sbjct: 237 KSGKLRQQIDVKA--ELEKRQGGKQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHK 294

Query: 229 YEREAREKSENHGTY 273
           YE+E+++  +    Y
Sbjct: 295 YEQESKKAGKASFAY 309


>X84694-1|CAA59169.1|  452|Homo sapiens mitochondrial elongation
           factor Tu protein.
          Length = 452

 Score = 53.6 bits (123), Expect = 7e-07
 Identities = 23/62 (37%), Positives = 33/62 (53%)
 Frame = +3

Query: 282 LDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISAR 461
           +D   EER +G T+      + T  +H+   D PGH  +V NMI G A  D  +LV++A 
Sbjct: 95  IDNAPEERARGITINAAHVEYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAAN 154

Query: 462 KG 467
            G
Sbjct: 155 DG 156



 Score = 34.3 bits (75), Expect = 0.45
 Identities = 17/39 (43%), Positives = 21/39 (53%)
 Frame = +1

Query: 118 KEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYE 234
           K HVNV  IGHVD GK+T+   I  +         +KYE
Sbjct: 55  KPHVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYE 93


>S75463-1|AAC60647.1|  452|Homo sapiens P43 protein.
          Length = 452

 Score = 53.6 bits (123), Expect = 7e-07
 Identities = 23/62 (37%), Positives = 33/62 (53%)
 Frame = +3

Query: 282 LDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISAR 461
           +D   EER +G T+      + T  +H+   D PGH  +V NMI G A  D  +LV++A 
Sbjct: 98  IDNAPEERARGITINAAHVEYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAAN 157

Query: 462 KG 467
            G
Sbjct: 158 DG 159



 Score = 34.3 bits (75), Expect = 0.45
 Identities = 17/39 (43%), Positives = 21/39 (53%)
 Frame = +1

Query: 118 KEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYE 234
           K HVNV  IGHVD GK+T+   I  +         +KYE
Sbjct: 58  KPHVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYE 96


>L38995-1|AAB00499.1|  452|Homo sapiens elongation factor Tu
           protein.
          Length = 452

 Score = 53.6 bits (123), Expect = 7e-07
 Identities = 23/62 (37%), Positives = 33/62 (53%)
 Frame = +3

Query: 282 LDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISAR 461
           +D   EER +G T+      + T  +H+   D PGH  +V NMI G A  D  +LV++A 
Sbjct: 95  IDNAPEERARGITINAAHVEYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAAN 154

Query: 462 KG 467
            G
Sbjct: 155 DG 156



 Score = 34.3 bits (75), Expect = 0.45
 Identities = 17/39 (43%), Positives = 21/39 (53%)
 Frame = +1

Query: 118 KEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYE 234
           K HVNV  IGHVD GK+T+   I  +         +KYE
Sbjct: 55  KPHVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYE 93


>BC010041-1|AAH10041.2|  455|Homo sapiens Tu translation elongation
           factor, mitochondrial protein.
          Length = 455

 Score = 53.6 bits (123), Expect = 7e-07
 Identities = 23/62 (37%), Positives = 33/62 (53%)
 Frame = +3

Query: 282 LDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISAR 461
           +D   EER +G T+      + T  +H+   D PGH  +V NMI G A  D  +LV++A 
Sbjct: 98  IDNAPEERARGITINAAHVEYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAAN 157

Query: 462 KG 467
            G
Sbjct: 158 DG 159



 Score = 34.3 bits (75), Expect = 0.45
 Identities = 17/39 (43%), Positives = 21/39 (53%)
 Frame = +1

Query: 118 KEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYE 234
           K HVNV  IGHVD GK+T+   I  +         +KYE
Sbjct: 58  KPHVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYE 96


>BC001633-1|AAH01633.2|  455|Homo sapiens Tu translation elongation
           factor, mitochondrial protein.
          Length = 455

 Score = 53.6 bits (123), Expect = 7e-07
 Identities = 23/62 (37%), Positives = 33/62 (53%)
 Frame = +3

Query: 282 LDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISAR 461
           +D   EER +G T+      + T  +H+   D PGH  +V NMI G A  D  +LV++A 
Sbjct: 98  IDNAPEERARGITINAAHVEYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAAN 157

Query: 462 KG 467
            G
Sbjct: 158 DG 159



 Score = 34.3 bits (75), Expect = 0.45
 Identities = 17/39 (43%), Positives = 21/39 (53%)
 Frame = +1

Query: 118 KEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYE 234
           K HVNV  IGHVD GK+T+   I  +         +KYE
Sbjct: 58  KPHVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYE 96


>AK222519-1|BAD96239.1|  366|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 366

 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 21/38 (55%), Positives = 28/38 (73%)
 Frame = +3

Query: 396 FVPNMIGGAAQADLAVLVISARKGEFETGFDRGGQTRD 509
           F+ NMI G +QAD AVL+++A  GEFE G  + GQTR+
Sbjct: 2   FIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTRE 39



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + +KRY E  +++  Y+K
Sbjct: 40  HALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIK 83


>AF328730-1|AAN09722.1|  361|Homo sapiens CTCL tumor antigen
           HD-CL-08 protein.
          Length = 361

 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 19/34 (55%), Positives = 25/34 (73%)
 Frame = +3

Query: 408 MIGGAAQADLAVLVISARKGEFETGFDRGGQTRD 509
           MI G +QAD AVL+++A  GEFE G  + GQTR+
Sbjct: 1   MITGTSQADCAVLIVAAGVGEFEAGISKNGQTRE 34



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + +KRY E  +++  Y+K
Sbjct: 35  HALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIK 78


>AF322220-1|AAN51932.1|  361|Homo sapiens cervical cancer suppressor
           3 protein.
          Length = 361

 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 19/34 (55%), Positives = 25/34 (73%)
 Frame = +3

Query: 408 MIGGAAQADLAVLVISARKGEFETGFDRGGQTRD 509
           MI G +QAD AVL+++A  GEFE G  + GQTR+
Sbjct: 1   MITGTSQADCAVLIVAAGVGEFEAGISKNGQTRE 34



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + +KRY E  +++  Y+K
Sbjct: 35  HALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIK 78


>M29548-1|AAA52367.1|  327|Homo sapiens EEF1A protein.
          Length = 327

 Score = 39.5 bits (88), Expect = 0.012
 Identities = 18/42 (42%), Positives = 26/42 (61%)
 Frame = +2

Query: 515 MLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           +LA T GVK L+  VNKMD     + +KRY E  +++  Y+K
Sbjct: 3   LLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIK 44


>BC007933-1|AAH07933.1|  569|Homo sapiens EEFSEC protein protein.
          Length = 569

 Score = 39.1 bits (87), Expect = 0.016
 Identities = 17/34 (50%), Positives = 22/34 (64%)
 Frame = +3

Query: 366 TILDAPGHKSFVPNMIGGAAQADLAVLVISARKG 467
           T++D PGH S +  +IGGA   DL +LVI   KG
Sbjct: 62  TLVDCPGHASLIRTIIGGAQIIDLMMLVIDVTKG 95


>AF268872-1|AAG13375.1|  526|Homo sapiens MJ0495-like protein SelB
           protein.
          Length = 526

 Score = 39.1 bits (87), Expect = 0.016
 Identities = 17/34 (50%), Positives = 22/34 (64%)
 Frame = +3

Query: 366 TILDAPGHKSFVPNMIGGAAQADLAVLVISARKG 467
           T++D PGH S +  +IGGA   DL +LVI   KG
Sbjct: 19  TLVDCPGHASLIRTIIGGAQIIDLMMLVIDVTKG 52


>BC049210-1|AAH49210.1|  751|Homo sapiens G elongation factor,
           mitochondrial 1 protein.
          Length = 751

 Score = 35.1 bits (77), Expect = 0.26
 Identities = 19/62 (30%), Positives = 30/62 (48%)
 Frame = +3

Query: 282 LDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISAR 461
           +D+ + ER +G T++    Y   +  +  I+D PGH  F   +       D AVLV+ A 
Sbjct: 89  MDSMELERQRGITIQSAATYTMWKDVNINIIDTPGHVDFTIEVERALRVLDGAVLVLCAV 148

Query: 462 KG 467
            G
Sbjct: 149 GG 150


>BC036768-1|AAH36768.1|  669|Homo sapiens GUF1 GTPase homolog (S.
           cerevisiae) protein.
          Length = 669

 Score = 35.1 bits (77), Expect = 0.26
 Identities = 15/41 (36%), Positives = 27/41 (65%), Gaps = 1/41 (2%)
 Frame = +1

Query: 94  RVEDTRSKKEHV-NVVFIGHVDAGKSTIGGQIMSLTGMVDK 213
           +++ +R   E++ N   + HVD GKST+  +++ LTG +DK
Sbjct: 57  KLDMSRFPVENIRNFSIVAHVDHGKSTLADRLLELTGTIDK 97



 Score = 33.1 bits (72), Expect = 1.0
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 4/66 (6%)
 Frame = +3

Query: 282 LDTNQEERDKGKTVEVGRA--YFETEKKHF--TILDAPGHKSFVPNMIGGAAQADLAVLV 449
           LD  Q ER++G TV+   A  ++  E K +   ++D PGH  F   +    +     +LV
Sbjct: 105 LDKLQVERERGITVKAQTASLFYNCEGKQYLLNLIDTPGHVDFSYEVSRSLSACQGVLLV 164

Query: 450 ISARKG 467
           + A +G
Sbjct: 165 VDANEG 170


>AF367998-1|AAK53402.1|  751|Homo sapiens elongation factor G1
           protein.
          Length = 751

 Score = 35.1 bits (77), Expect = 0.26
 Identities = 19/62 (30%), Positives = 30/62 (48%)
 Frame = +3

Query: 282 LDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISAR 461
           +D+ + ER +G T++    Y   +  +  I+D PGH  F   +       D AVLV+ A 
Sbjct: 89  MDSMELERQRGITIQSAATYTMWKDVNINIIDTPGHVDFTIEVERALRVLDGAVLVLCAV 148

Query: 462 KG 467
            G
Sbjct: 149 GG 150


>AF309777-1|AAK58877.1|  751|Homo sapiens elongation factor G
           protein.
          Length = 751

 Score = 35.1 bits (77), Expect = 0.26
 Identities = 19/62 (30%), Positives = 30/62 (48%)
 Frame = +3

Query: 282 LDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISAR 461
           +D+ + ER +G T++    Y   +  +  I+D PGH  F   +       D AVLV+ A 
Sbjct: 89  MDSMELERQRGITIQSAATYTMWKDVNINIIDTPGHVDFTIEVERALRVLDGAVLVLCAV 148

Query: 462 KG 467
            G
Sbjct: 149 GG 150


>AK023282-1|BAB14507.1|  669|Homo sapiens protein ( Homo sapiens
           cDNA FLJ13220 fis, clone NT2RP4002047, moderately
           similar to GTP-BINDING PROTEIN LEPA. ).
          Length = 669

 Score = 34.3 bits (75), Expect = 0.45
 Identities = 18/46 (39%), Positives = 29/46 (63%), Gaps = 1/46 (2%)
 Frame = +1

Query: 79  KKKPPRVEDTRSKKEHV-NVVFIGHVDAGKSTIGGQIMSLTGMVDK 213
           K+KP   + +R   E++ N   + HVD GKST+  +++ LTG +DK
Sbjct: 55  KEKP---DMSRFPVENIRNFSIVAHVDHGKSTLTDRLLELTGTIDK 97



 Score = 33.1 bits (72), Expect = 1.0
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 4/66 (6%)
 Frame = +3

Query: 282 LDTNQEERDKGKTVEVGRA--YFETEKKHF--TILDAPGHKSFVPNMIGGAAQADLAVLV 449
           LD  Q ER++G TV+   A  ++  E K +   ++D PGH  F   +    +     +LV
Sbjct: 105 LDKLQVERERGITVKAQTASLFYNCEGKQYLLNLIDTPGHVDFSYEVSRSLSACQGVLLV 164

Query: 450 ISARKG 467
           + A +G
Sbjct: 165 VDANEG 170


>L19161-1|AAA19696.1|  472|Homo sapiens translation initiation
           factor eIF-2 gamma subunit protein.
          Length = 472

 Score = 33.9 bits (74), Expect = 0.59
 Identities = 13/36 (36%), Positives = 22/36 (61%)
 Frame = +3

Query: 357 KHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARK 464
           +H + +D PGH   +  M+ GAA  D A+L+I+  +
Sbjct: 128 RHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNE 163


>DQ120619-1|ABB92405.1|  471|Homo sapiens eFI-2-gamma protein.
          Length = 471

 Score = 33.9 bits (74), Expect = 0.59
 Identities = 13/36 (36%), Positives = 22/36 (61%)
 Frame = +3

Query: 357 KHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARK 464
           +H + +D PGH   +  M+ GAA  D A+L+I+  +
Sbjct: 128 RHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNE 163


>BC087847-1|AAH87847.1|  465|Homo sapiens Unknown (protein for
           IMAGE:30389268) protein.
          Length = 465

 Score = 33.9 bits (74), Expect = 0.59
 Identities = 13/36 (36%), Positives = 22/36 (61%)
 Frame = +3

Query: 357 KHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARK 464
           +H + +D PGH   +  M+ GAA  D A+L+I+  +
Sbjct: 127 RHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNE 162


>BC019906-1|AAH19906.1|  472|Homo sapiens eukaryotic translation
           initiation factor 2, subunit 3 gamma, 52kDa protein.
          Length = 472

 Score = 33.9 bits (74), Expect = 0.59
 Identities = 13/36 (36%), Positives = 22/36 (61%)
 Frame = +3

Query: 357 KHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARK 464
           +H + +D PGH   +  M+ GAA  D A+L+I+  +
Sbjct: 128 RHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNE 163


>AK222577-1|BAD96297.1|  472|Homo sapiens eukaryotic translation
           initiation factor 2, subunit 3 gamma, 52kDa variant
           protein.
          Length = 472

 Score = 33.9 bits (74), Expect = 0.59
 Identities = 13/36 (36%), Positives = 22/36 (61%)
 Frame = +3

Query: 357 KHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARK 464
           +H + +D PGH   +  M+ GAA  D A+L+I+  +
Sbjct: 128 RHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNE 163


>AJ006932-1|CAA07331.1|  248|Homo sapiens eIF-2gA protein.
          Length = 248

 Score = 33.9 bits (74), Expect = 0.59
 Identities = 13/36 (36%), Positives = 22/36 (61%)
 Frame = +3

Query: 357 KHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARK 464
           +H + +D PGH   +  M+ GAA  D A+L+I+  +
Sbjct: 68  RHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNE 103


>L34600-1|AAA67038.1|  727|Homo sapiens initiation factor 2 protein.
          Length = 727

 Score = 32.7 bits (71), Expect = 1.4
 Identities = 15/34 (44%), Positives = 19/34 (55%)
 Frame = +3

Query: 366 TILDAPGHKSFVPNMIGGAAQADLAVLVISARKG 467
           T LD PGH +F      GA   D+ VLV++A  G
Sbjct: 231 TFLDTPGHAAFSAMRARGAQVTDIVVLVVAADDG 264


>BC064977-1|AAH64977.1|  465|Homo sapiens MTIF2 protein protein.
          Length = 465

 Score = 32.7 bits (71), Expect = 1.4
 Identities = 15/34 (44%), Positives = 19/34 (55%)
 Frame = +3

Query: 366 TILDAPGHKSFVPNMIGGAAQADLAVLVISARKG 467
           T LD PGH +F      GA   D+ VLV++A  G
Sbjct: 231 TFLDTPGHAAFSAMRARGAQVTDIVVLVVAADDG 264


>BC039848-1|AAH39848.1|  500|Homo sapiens Similar to mitochondrial
           translational initiation factor 2 protein.
          Length = 500

 Score = 32.7 bits (71), Expect = 1.4
 Identities = 15/34 (44%), Positives = 19/34 (55%)
 Frame = +3

Query: 366 TILDAPGHKSFVPNMIGGAAQADLAVLVISARKG 467
           T LD PGH +F      GA   D+ VLV++A  G
Sbjct: 231 TFLDTPGHAAFSAMRARGAQVTDIVVLVVAADDG 264


>AF495546-1|AAM70196.1|  727|Homo sapiens translation initiation
           factor 2 protein.
          Length = 727

 Score = 32.7 bits (71), Expect = 1.4
 Identities = 15/34 (44%), Positives = 19/34 (55%)
 Frame = +3

Query: 366 TILDAPGHKSFVPNMIGGAAQADLAVLVISARKG 467
           T LD PGH +F      GA   D+ VLV++A  G
Sbjct: 231 TFLDTPGHAAFSAMRARGAQVTDIVVLVVAADDG 264


>AF494407-1|AAM14617.1|  727|Homo sapiens mitochondrial
           translation-initiation factor 2 protein.
          Length = 727

 Score = 32.7 bits (71), Expect = 1.4
 Identities = 15/34 (44%), Positives = 19/34 (55%)
 Frame = +3

Query: 366 TILDAPGHKSFVPNMIGGAAQADLAVLVISARKG 467
           T LD PGH +F      GA   D+ VLV++A  G
Sbjct: 231 TFLDTPGHAAFSAMRARGAQVTDIVVLVVAADDG 264


>D21163-1|BAA04699.2|  977|Homo sapiens KIAA0031 protein.
          Length = 977

 Score = 31.5 bits (68), Expect = 3.2
 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 3/61 (4%)
 Frame = +3

Query: 294 QEERDKG-KTVEVGRAYFETEKKH--FTILDAPGHKSFVPNMIGGAAQADLAVLVISARK 464
           ++ER  G K+  V     +T+ K   F I+D PGH +F   +  G   +D  VL I A +
Sbjct: 179 EQERGVGIKSTPVTVVLPDTKGKSYLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAE 238

Query: 465 G 467
           G
Sbjct: 239 G 239


>CR456774-1|CAG33055.1|  972|Homo sapiens U5-116KD protein.
          Length = 972

 Score = 31.5 bits (68), Expect = 3.2
 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 3/61 (4%)
 Frame = +3

Query: 294 QEERDKG-KTVEVGRAYFETEKKH--FTILDAPGHKSFVPNMIGGAAQADLAVLVISARK 464
           ++ER  G K+  V     +T+ K   F I+D PGH +F   +  G   +D  VL I A +
Sbjct: 174 EQERGVGIKSTPVTVVLPDTKGKSYLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAE 233

Query: 465 G 467
           G
Sbjct: 234 G 234


>BC030612-1|AAH30612.1|  777|Homo sapiens G elongation factor,
           mitochondrial 2 protein.
          Length = 777

 Score = 31.5 bits (68), Expect = 3.2
 Identities = 17/61 (27%), Positives = 27/61 (44%)
 Frame = +3

Query: 285 DTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARK 464
           D   +ER++G T++     F+ +     ++D PGH  F   +       D AV V  A  
Sbjct: 111 DFMAQERERGITIQSAAVTFDWKGYRVNLIDTPGHVDFTLEVERCLRVLDGAVAVFDASA 170

Query: 465 G 467
           G
Sbjct: 171 G 171


>BC015712-1|AAH15712.1|  779|Homo sapiens GFM2 protein protein.
          Length = 779

 Score = 31.5 bits (68), Expect = 3.2
 Identities = 17/61 (27%), Positives = 27/61 (44%)
 Frame = +3

Query: 285 DTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARK 464
           D   +ER++G T++     F+ +     ++D PGH  F   +       D AV V  A  
Sbjct: 111 DFMAQERERGITIQSAAVTFDWKGYRVNLIDTPGHVDFTLEVERCLRVLDGAVAVFDASA 170

Query: 465 G 467
           G
Sbjct: 171 G 171


>BC002360-1|AAH02360.1|  972|Homo sapiens elongation factor Tu GTP
           binding domain containing 2 protein.
          Length = 972

 Score = 31.5 bits (68), Expect = 3.2
 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 3/61 (4%)
 Frame = +3

Query: 294 QEERDKG-KTVEVGRAYFETEKKH--FTILDAPGHKSFVPNMIGGAAQADLAVLVISARK 464
           ++ER  G K+  V     +T+ K   F I+D PGH +F   +  G   +D  VL I A +
Sbjct: 174 EQERGVGIKSTPVTVVLPDTKGKSYLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAE 233

Query: 465 G 467
           G
Sbjct: 234 G 234


>AY453587-1|AAS49035.1|  531|Homo sapiens elongation factor G
           isoform protein.
          Length = 531

 Score = 31.5 bits (68), Expect = 3.2
 Identities = 17/61 (27%), Positives = 27/61 (44%)
 Frame = +3

Query: 285 DTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARK 464
           D   +ER++G T++     F+ +     ++D PGH  F   +       D AV V  A  
Sbjct: 111 DFMAQERERGITIQSAAVTFDWKGYRVNLIDTPGHVDFTLEVERCLRVLDGAVAVFDASA 170

Query: 465 G 467
           G
Sbjct: 171 G 171


>AK025314-1|BAB15109.1|  513|Homo sapiens protein ( Homo sapiens
           cDNA: FLJ21661 fis, clone COL08837. ).
          Length = 513

 Score = 31.5 bits (68), Expect = 3.2
 Identities = 17/61 (27%), Positives = 27/61 (44%)
 Frame = +3

Query: 285 DTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARK 464
           D   +ER++G T++     F+ +     ++D PGH  F   +       D AV V  A  
Sbjct: 111 DFMAQERERGITIQSAAVTFDWKGYRVNLIDTPGHVDFTLEVERCLRVLDGAVAVFDASA 170

Query: 465 G 467
           G
Sbjct: 171 G 171


>AJ505017-1|CAD43720.1|  850|Homo sapiens small nuclear
           ribonucleoprotein component protein.
          Length = 850

 Score = 31.5 bits (68), Expect = 3.2
 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 3/61 (4%)
 Frame = +3

Query: 294 QEERDKG-KTVEVGRAYFETEKKH--FTILDAPGHKSFVPNMIGGAAQADLAVLVISARK 464
           ++ER  G K+  V     +T+ K   F I+D PGH +F   +  G   +D  VL I A +
Sbjct: 52  EQERGVGIKSTPVTVVLPDTKGKSYLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAE 111

Query: 465 G 467
           G
Sbjct: 112 G 112


>AJ001515-1|CAA04798.1| 4870|Homo sapiens ryanodine receptor 3
            protein.
          Length = 4870

 Score = 31.5 bits (68), Expect = 3.2
 Identities = 22/86 (25%), Positives = 41/86 (47%)
 Frame = +1

Query: 55   GELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYE 234
            G+L++ I K +PP +E T  KK       +   +  +    G++ S     +K  +E  E
Sbjct: 4301 GDLSEIIGKDEPPTLESTVQKKRKAQAAEMKAANEAE----GKVES-----EKADMEDGE 4351

Query: 235  REAREKSENHGTYHGHWTQIKKNETK 312
            +E ++K E    Y   WT++ K + +
Sbjct: 4352 KEDKDKEEEQAEY--LWTEVTKKKKR 4375


>AF367997-1|AAK53401.1|  779|Homo sapiens elongation factor G2
           protein.
          Length = 779

 Score = 31.5 bits (68), Expect = 3.2
 Identities = 17/61 (27%), Positives = 27/61 (44%)
 Frame = +3

Query: 285 DTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARK 464
           D   +ER++G T++     F+ +     ++D PGH  F   +       D AV V  A  
Sbjct: 111 DFMAQERERGITIQSAAVTFDWKGYRVNLIDTPGHVDFTLEVERCLRVLDGAVAVFDASA 170

Query: 465 G 467
           G
Sbjct: 171 G 171


>AF183412-1|AAG09681.1|  435|Homo sapiens cytochrome P450
           monooxygenase protein.
          Length = 435

 Score = 31.5 bits (68), Expect = 3.2
 Identities = 17/58 (29%), Positives = 30/58 (51%)
 Frame = +1

Query: 148 HVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTYHGHWTQIKKNETKAKQ 321
           HV   +  +G  + S+T MV   T E  ++E     +NHGT   +W+  K++  + K+
Sbjct: 161 HVPLSQHMLGFAMKSVTQMVMGSTFED-DQEVIRFQKNHGTPSCNWSLFKEHHKRTKR 217


>AF111808-1|AAL39010.1|  732|Homo sapiens MSTP027 protein.
          Length = 732

 Score = 31.5 bits (68), Expect = 3.2
 Identities = 17/61 (27%), Positives = 27/61 (44%)
 Frame = +3

Query: 285 DTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARK 464
           D   +ER++G T++     F+ +     ++D PGH  F   +       D AV V  A  
Sbjct: 111 DFMAQERERGITIQSAAVTFDWKGYRVNLIDTPGHVDFTLEVERCLRVLDGAVAVFDASA 170

Query: 465 G 467
           G
Sbjct: 171 G 171


>AB001025-1|BAA23795.1| 4866|Homo sapiens brain ryanodine receptor
            protein.
          Length = 4866

 Score = 31.5 bits (68), Expect = 3.2
 Identities = 22/86 (25%), Positives = 41/86 (47%)
 Frame = +1

Query: 55   GELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYE 234
            G+L++ I K +PP +E T  KK       +   +  +    G++ S     +K  +E  E
Sbjct: 4297 GDLSEIIGKDEPPTLESTVQKKRKAQAAEMKAANEAE----GKVES-----EKADMEDGE 4347

Query: 235  REAREKSENHGTYHGHWTQIKKNETK 312
            +E ++K E    Y   WT++ K + +
Sbjct: 4348 KEDKDKEEEQAEY--LWTEVTKKKKR 4371


>BC128262-1|AAI28263.1|  346|Homo sapiens ANKRD36 protein protein.
          Length = 346

 Score = 31.1 bits (67), Expect = 4.2
 Identities = 12/40 (30%), Positives = 25/40 (62%)
 Frame = +1

Query: 10  EELDTQVGNTNPNEDGELTKKIPKKKPPRVEDTRSKKEHV 129
           +E D+ +G    N+DGE ++ +  +KPP ++ +  +K+ V
Sbjct: 280 DEEDSVLGIARENKDGEKSRTVSSEKPPGLKASSDEKDSV 319


>BC032639-1|AAH32639.1| 1220|Homo sapiens eukaryotic translation
           initiation factor 5B protein.
          Length = 1220

 Score = 30.7 bits (66), Expect = 5.5
 Identities = 13/33 (39%), Positives = 20/33 (60%)
 Frame = +3

Query: 369 ILDAPGHKSFVPNMIGGAAQADLAVLVISARKG 467
           I+D PGH+SF      G++  D+A+LV+    G
Sbjct: 700 IIDTPGHESFSNLRNRGSSLCDIAILVVDIMHG 732


>AL133563-1|CAB63717.1| 1132|Homo sapiens hypothetical protein
           protein.
          Length = 1132

 Score = 30.7 bits (66), Expect = 5.5
 Identities = 13/33 (39%), Positives = 20/33 (60%)
 Frame = +3

Query: 369 ILDAPGHKSFVPNMIGGAAQADLAVLVISARKG 467
           I+D PGH+SF      G++  D+A+LV+    G
Sbjct: 612 IIDTPGHESFSNLRNRGSSLCDIAILVVDIMHG 644


>AJ006776-1|CAB44357.1| 1220|Homo sapiens IF2 protein protein.
          Length = 1220

 Score = 30.7 bits (66), Expect = 5.5
 Identities = 13/33 (39%), Positives = 20/33 (60%)
 Frame = +3

Query: 369 ILDAPGHKSFVPNMIGGAAQADLAVLVISARKG 467
           I+D PGH+SF      G++  D+A+LV+    G
Sbjct: 700 IIDTPGHESFSNLRNRGSSLCDIAILVVDIMHG 732


>AF078035-1|AAD16006.1| 1220|Homo sapiens translation initiation
           factor IF2 protein.
          Length = 1220

 Score = 30.7 bits (66), Expect = 5.5
 Identities = 13/33 (39%), Positives = 20/33 (60%)
 Frame = +3

Query: 369 ILDAPGHKSFVPNMIGGAAQADLAVLVISARKG 467
           I+D PGH+SF      G++  D+A+LV+    G
Sbjct: 700 IIDTPGHESFSNLRNRGSSLCDIAILVVDIMHG 732


>AC018690-1|AAY24313.1|  728|Homo sapiens unknown protein.
          Length = 728

 Score = 30.7 bits (66), Expect = 5.5
 Identities = 13/33 (39%), Positives = 20/33 (60%)
 Frame = +3

Query: 369 ILDAPGHKSFVPNMIGGAAQADLAVLVISARKG 467
           I+D PGH+SF      G++  D+A+LV+    G
Sbjct: 208 IIDTPGHESFSNLRNRGSSLCDIAILVVDIMHG 240


>AB018284-1|BAA34461.2| 1222|Homo sapiens KIAA0741 protein protein.
          Length = 1222

 Score = 30.7 bits (66), Expect = 5.5
 Identities = 13/33 (39%), Positives = 20/33 (60%)
 Frame = +3

Query: 369 ILDAPGHKSFVPNMIGGAAQADLAVLVISARKG 467
           I+D PGH+SF      G++  D+A+LV+    G
Sbjct: 702 IIDTPGHESFSNLRNRGSSLCDIAILVVDIMHG 734


>BC044844-1|AAH44844.1|  450|Homo sapiens KIAA1641 protein protein.
          Length = 450

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 12/40 (30%), Positives = 24/40 (60%)
 Frame = +1

Query: 10  EELDTQVGNTNPNEDGELTKKIPKKKPPRVEDTRSKKEHV 129
           +E D+    T   +DGE+++ +  +KPP ++ T  K++ V
Sbjct: 4   DEKDSFSNITREKKDGEISRTVSSQKPPALKATSVKEDSV 43


>BC031883-1|AAH31883.1|  450|Homo sapiens KIAA1641 protein protein.
          Length = 450

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 12/40 (30%), Positives = 24/40 (60%)
 Frame = +1

Query: 10  EELDTQVGNTNPNEDGELTKKIPKKKPPRVEDTRSKKEHV 129
           +E D+    T   +DGE+++ +  +KPP ++ T  K++ V
Sbjct: 4   DEKDSFSNITREKKDGEISRTVSSQKPPALKATSVKEDSV 43


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 100,164,586
Number of Sequences: 237096
Number of extensions: 1974882
Number of successful extensions: 9466
Number of sequences better than 10.0: 120
Number of HSP's better than 10.0 without gapping: 9048
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9465
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8511181328
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -