SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20008
         (705 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X61923-1|CAA43925.1|  266|Homo sapiens ribosomal protein L7a pro...    90   6e-18
X52138-1|CAA36383.1|  266|Homo sapiens L7a protein protein.            90   6e-18
X06705-1|CAA29889.1|  266|Homo sapiens protein ( Human PLA-X mRN...    90   6e-18
M36072-1|AAA60282.1|  266|Homo sapiens RPL7A protein.                  90   6e-18
BC105290-1|AAI05291.1|  266|Homo sapiens ribosomal protein L7a p...    90   6e-18
BC073802-1|AAH73802.1|  266|Homo sapiens ribosomal protein L7a p...    90   6e-18
BC071901-1|AAH71901.1|  266|Homo sapiens ribosomal protein L7a p...    90   6e-18
BC071900-1|AAH71900.1|  266|Homo sapiens ribosomal protein L7a p...    90   6e-18
BC023624-1|AAH23624.1|  266|Homo sapiens ribosomal protein L7a p...    90   6e-18
BC023594-1|AAH23594.1|  266|Homo sapiens ribosomal protein L7a p...    90   6e-18
BC021979-1|AAH21979.1|  266|Homo sapiens ribosomal protein L7a p...    90   6e-18
BC005128-1|AAH05128.1|  266|Homo sapiens ribosomal protein L7a p...    90   6e-18
AL158826-10|CAI12834.1|  151|Homo sapiens ribosomal protein L7a ...    90   6e-18
AL158826-8|CAI12832.1|  266|Homo sapiens ribosomal protein L7a p...    90   6e-18
AB056665-1|BAB39381.1|  142|Homo sapiens ribosomal protein L7a p...    90   6e-18
AL158826-9|CAI12833.1|  191|Homo sapiens ribosomal protein L7a p...    83   7e-16
CR457238-1|CAG33519.1|  153|Homo sapiens NOLA2 protein.                37   0.061
BC006387-1|AAH06387.1|  153|Homo sapiens nucleolar protein famil...    37   0.061
BC000009-1|AAH00009.1|  153|Homo sapiens nucleolar protein famil...    37   0.061
AK000486-1|BAA91198.1|  153|Homo sapiens protein ( Homo sapiens ...    37   0.061
AJ293309-1|CAC08452.1|  153|Homo sapiens NHP2 protein protein.         37   0.061
AF401219-1|AAL02175.1|  153|Homo sapiens small nucleolar RNA bin...    37   0.061
Z83840-3|CAB46207.1|  128|Homo sapiens NHP2 non-histone chromoso...    32   2.3  
D50420-1|BAA23363.1|  128|Homo sapiens OTK27 protein.                  32   2.3  
CR541725-1|CAG46526.1|  128|Homo sapiens NHP2L1 protein.               32   2.3  
CR456531-1|CAG30417.1|  128|Homo sapiens NHP2L1 protein.               32   2.3  
BC095439-1|AAH95439.1|  128|Homo sapiens NHP2 non-histone chromo...    32   2.3  
BC019282-1|AAH19282.1|  128|Homo sapiens NHP2L1 protein protein.       32   2.3  
BC005358-1|AAH05358.1|  128|Homo sapiens NHP2 non-histone chromo...    32   2.3  
AF155235-1|AAF06959.1|  128|Homo sapiens 15.5 kD RNA binding pro...    32   2.3  
AF091076-1|AAC72945.1|  128|Homo sapiens OTK27 protein.                32   2.3  
X06704-1|CAA29888.1|  439|Homo sapiens protein ( Human mRNA for ...    31   5.3  
AY166857-1|AAN87839.1|  668|Homo sapiens serine/threonine protei...    30   9.3  
AK131534-1|BAD18671.1|  766|Homo sapiens protein ( Homo sapiens ...    30   9.3  
AJ006701-1|CAA07196.1|  603|Homo sapiens putative serine/threoni...    30   9.3  
AF533880-1|AAP97727.1|  674|Homo sapiens putative serine/threoni...    30   9.3  
AF533879-1|AAP97726.1|  736|Homo sapiens putative serine/threoni...    30   9.3  
AF533878-1|AAP97725.1|  674|Homo sapiens putative serine/threoni...    30   9.3  
AF533877-1|AAP97724.1|  674|Homo sapiens putative serine/threoni...    30   9.3  
AF533876-1|AAP97723.1|  668|Homo sapiens putative serine/threoni...    30   9.3  

>X61923-1|CAA43925.1|  266|Homo sapiens ribosomal protein L7a
           protein.
          Length = 266

 Score = 90.2 bits (214), Expect = 6e-18
 Identities = 43/65 (66%), Positives = 49/65 (75%)
 Frame = +2

Query: 509 VTKLVEKKKAQLWSSLMMLIPLSWFLFLPALCRKMGVPYCIVKGKSRLGALVHRKTCTCL 688
           VT LVE KKAQL      + P+   +FLPALCRKMGVPYCI+KGK+RLG LVHRKTCT +
Sbjct: 143 VTTLVENKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYCIIKGKARLGRLVHRKTCTTV 202

Query: 689 ALTNV 703
           A T V
Sbjct: 203 AFTQV 207



 Score = 83.4 bits (197), Expect = 7e-16
 Identities = 41/92 (44%), Positives = 51/92 (55%)
 Frame = +3

Query: 234 LVQICKMPKYIRIQRQKAVLQRRLKVPPPINQFTQTLDKTTAKGLFKILEKYRPETXXXX 413
           L +  K P+YIR+QRQ+A+L +RLKVPP INQFTQ LD+ TA  L K+  KYRPET    
Sbjct: 51  LTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALDRQTATQLLKLAHKYRPETKQEK 110

Query: 414 XXXXXXXXXXXXXXXXXXXXXRPNTIRSGTNT 509
                                RP  +R+G NT
Sbjct: 111 KQRLLARAEKKAAGKGDVPTKRPPVLRAGVNT 142



 Score = 61.7 bits (143), Expect = 2e-09
 Identities = 51/146 (34%), Positives = 62/146 (42%), Gaps = 4/146 (2%)
 Frame = +1

Query: 169 NPLFEKRPKNFAIGQGIQPTRDLSRFVRCPSISASSARRLYFSVV*KCP---LRSTNLPR 339
           NPLFEKRPKNF IGQ IQP RDL+RFV+ P       +R       K P    + T    
Sbjct: 29  NPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALD 88

Query: 340 HWTRLQLRAFSRFWRNTXXXXXXXXXXXXXXXXXXXXXXXMSLHQRGPTPSDPAQTRHQA 519
             T  QL   +  +R                          +  +R P       T    
Sbjct: 89  RQTATQLLKLAHKYRPETKQEKKQRLLARAEKKAAGKGDVPT--KRPPVLRAGVNTVTTL 146

Query: 520 GREEEGAVVVIAHDVDPIEL-VSLPA 594
              ++  +VVIAHDVDPIEL V LPA
Sbjct: 147 VENKKAQLVVIAHDVDPIELVVFLPA 172


>X52138-1|CAA36383.1|  266|Homo sapiens L7a protein protein.
          Length = 266

 Score = 90.2 bits (214), Expect = 6e-18
 Identities = 43/65 (66%), Positives = 49/65 (75%)
 Frame = +2

Query: 509 VTKLVEKKKAQLWSSLMMLIPLSWFLFLPALCRKMGVPYCIVKGKSRLGALVHRKTCTCL 688
           VT LVE KKAQL      + P+   +FLPALCRKMGVPYCI+KGK+RLG LVHRKTCT +
Sbjct: 143 VTTLVENKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYCIIKGKARLGRLVHRKTCTTV 202

Query: 689 ALTNV 703
           A T V
Sbjct: 203 AFTQV 207



 Score = 83.4 bits (197), Expect = 7e-16
 Identities = 41/92 (44%), Positives = 51/92 (55%)
 Frame = +3

Query: 234 LVQICKMPKYIRIQRQKAVLQRRLKVPPPINQFTQTLDKTTAKGLFKILEKYRPETXXXX 413
           L +  K P+YIR+QRQ+A+L +RLKVPP INQFTQ LD+ TA  L K+  KYRPET    
Sbjct: 51  LTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALDRQTATQLLKLAHKYRPETKQEK 110

Query: 414 XXXXXXXXXXXXXXXXXXXXXRPNTIRSGTNT 509
                                RP  +R+G NT
Sbjct: 111 KQRLLARAEKKAAGKGDVPTKRPPVLRAGVNT 142



 Score = 61.7 bits (143), Expect = 2e-09
 Identities = 51/146 (34%), Positives = 62/146 (42%), Gaps = 4/146 (2%)
 Frame = +1

Query: 169 NPLFEKRPKNFAIGQGIQPTRDLSRFVRCPSISASSARRLYFSVV*KCP---LRSTNLPR 339
           NPLFEKRPKNF IGQ IQP RDL+RFV+ P       +R       K P    + T    
Sbjct: 29  NPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALD 88

Query: 340 HWTRLQLRAFSRFWRNTXXXXXXXXXXXXXXXXXXXXXXXMSLHQRGPTPSDPAQTRHQA 519
             T  QL   +  +R                          +  +R P       T    
Sbjct: 89  RQTATQLLKLAHKYRPETKQEKKQRLLARAEKKAAGKGDVPT--KRPPVLRAGVNTVTTL 146

Query: 520 GREEEGAVVVIAHDVDPIEL-VSLPA 594
              ++  +VVIAHDVDPIEL V LPA
Sbjct: 147 VENKKAQLVVIAHDVDPIELVVFLPA 172


>X06705-1|CAA29889.1|  266|Homo sapiens protein ( Human PLA-X mRNA.
           ).
          Length = 266

 Score = 90.2 bits (214), Expect = 6e-18
 Identities = 43/65 (66%), Positives = 49/65 (75%)
 Frame = +2

Query: 509 VTKLVEKKKAQLWSSLMMLIPLSWFLFLPALCRKMGVPYCIVKGKSRLGALVHRKTCTCL 688
           VT LVE KKAQL      + P+   +FLPALCRKMGVPYCI+KGK+RLG LVHRKTCT +
Sbjct: 143 VTTLVENKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYCIIKGKARLGRLVHRKTCTTV 202

Query: 689 ALTNV 703
           A T V
Sbjct: 203 AFTQV 207



 Score = 83.4 bits (197), Expect = 7e-16
 Identities = 41/92 (44%), Positives = 51/92 (55%)
 Frame = +3

Query: 234 LVQICKMPKYIRIQRQKAVLQRRLKVPPPINQFTQTLDKTTAKGLFKILEKYRPETXXXX 413
           L +  K P+YIR+QRQ+A+L +RLKVPP INQFTQ LD+ TA  L K+  KYRPET    
Sbjct: 51  LTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALDRQTATQLLKLAHKYRPETKQEK 110

Query: 414 XXXXXXXXXXXXXXXXXXXXXRPNTIRSGTNT 509
                                RP  +R+G NT
Sbjct: 111 KQRLLARAEKKAAGKGDVPTKRPPVLRAGVNT 142



 Score = 61.7 bits (143), Expect = 2e-09
 Identities = 51/146 (34%), Positives = 62/146 (42%), Gaps = 4/146 (2%)
 Frame = +1

Query: 169 NPLFEKRPKNFAIGQGIQPTRDLSRFVRCPSISASSARRLYFSVV*KCP---LRSTNLPR 339
           NPLFEKRPKNF IGQ IQP RDL+RFV+ P       +R       K P    + T    
Sbjct: 29  NPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALD 88

Query: 340 HWTRLQLRAFSRFWRNTXXXXXXXXXXXXXXXXXXXXXXXMSLHQRGPTPSDPAQTRHQA 519
             T  QL   +  +R                          +  +R P       T    
Sbjct: 89  RQTATQLLKLAHKYRPETKQEKKQRLLARAEKKAAGKGDVPT--KRPPVLRAGVNTVTTL 146

Query: 520 GREEEGAVVVIAHDVDPIEL-VSLPA 594
              ++  +VVIAHDVDPIEL V LPA
Sbjct: 147 VENKKAQLVVIAHDVDPIELVVFLPA 172


>M36072-1|AAA60282.1|  266|Homo sapiens RPL7A protein.
          Length = 266

 Score = 90.2 bits (214), Expect = 6e-18
 Identities = 43/65 (66%), Positives = 49/65 (75%)
 Frame = +2

Query: 509 VTKLVEKKKAQLWSSLMMLIPLSWFLFLPALCRKMGVPYCIVKGKSRLGALVHRKTCTCL 688
           VT LVE KKAQL      + P+   +FLPALCRKMGVPYCI+KGK+RLG LVHRKTCT +
Sbjct: 143 VTTLVENKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYCIIKGKARLGRLVHRKTCTTV 202

Query: 689 ALTNV 703
           A T V
Sbjct: 203 AFTQV 207



 Score = 83.4 bits (197), Expect = 7e-16
 Identities = 41/92 (44%), Positives = 51/92 (55%)
 Frame = +3

Query: 234 LVQICKMPKYIRIQRQKAVLQRRLKVPPPINQFTQTLDKTTAKGLFKILEKYRPETXXXX 413
           L +  K P+YIR+QRQ+A+L +RLKVPP INQFTQ LD+ TA  L K+  KYRPET    
Sbjct: 51  LTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALDRQTATQLLKLAHKYRPETKQEK 110

Query: 414 XXXXXXXXXXXXXXXXXXXXXRPNTIRSGTNT 509
                                RP  +R+G NT
Sbjct: 111 KQRLLARAEKKAAGKGDVPTKRPPVLRAGVNT 142



 Score = 61.7 bits (143), Expect = 2e-09
 Identities = 51/146 (34%), Positives = 62/146 (42%), Gaps = 4/146 (2%)
 Frame = +1

Query: 169 NPLFEKRPKNFAIGQGIQPTRDLSRFVRCPSISASSARRLYFSVV*KCP---LRSTNLPR 339
           NPLFEKRPKNF IGQ IQP RDL+RFV+ P       +R       K P    + T    
Sbjct: 29  NPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALD 88

Query: 340 HWTRLQLRAFSRFWRNTXXXXXXXXXXXXXXXXXXXXXXXMSLHQRGPTPSDPAQTRHQA 519
             T  QL   +  +R                          +  +R P       T    
Sbjct: 89  RQTATQLLKLAHKYRPETKQEKKQRLLARAEKKAAGKGDVPT--KRPPVLRAGVNTVTTL 146

Query: 520 GREEEGAVVVIAHDVDPIEL-VSLPA 594
              ++  +VVIAHDVDPIEL V LPA
Sbjct: 147 VENKKAQLVVIAHDVDPIELVVFLPA 172


>BC105290-1|AAI05291.1|  266|Homo sapiens ribosomal protein L7a
           protein.
          Length = 266

 Score = 90.2 bits (214), Expect = 6e-18
 Identities = 43/65 (66%), Positives = 49/65 (75%)
 Frame = +2

Query: 509 VTKLVEKKKAQLWSSLMMLIPLSWFLFLPALCRKMGVPYCIVKGKSRLGALVHRKTCTCL 688
           VT LVE KKAQL      + P+   +FLPALCRKMGVPYCI+KGK+RLG LVHRKTCT +
Sbjct: 143 VTTLVENKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYCIIKGKARLGRLVHRKTCTTV 202

Query: 689 ALTNV 703
           A T V
Sbjct: 203 AFTQV 207



 Score = 83.4 bits (197), Expect = 7e-16
 Identities = 41/92 (44%), Positives = 51/92 (55%)
 Frame = +3

Query: 234 LVQICKMPKYIRIQRQKAVLQRRLKVPPPINQFTQTLDKTTAKGLFKILEKYRPETXXXX 413
           L +  K P+YIR+QRQ+A+L +RLKVPP INQFTQ LD+ TA  L K+  KYRPET    
Sbjct: 51  LTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALDRQTATQLLKLAHKYRPETKQEK 110

Query: 414 XXXXXXXXXXXXXXXXXXXXXRPNTIRSGTNT 509
                                RP  +R+G NT
Sbjct: 111 KQRLLARAEKKAAGKGDVPTKRPPVLRAGVNT 142



 Score = 61.7 bits (143), Expect = 2e-09
 Identities = 51/146 (34%), Positives = 62/146 (42%), Gaps = 4/146 (2%)
 Frame = +1

Query: 169 NPLFEKRPKNFAIGQGIQPTRDLSRFVRCPSISASSARRLYFSVV*KCP---LRSTNLPR 339
           NPLFEKRPKNF IGQ IQP RDL+RFV+ P       +R       K P    + T    
Sbjct: 29  NPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALD 88

Query: 340 HWTRLQLRAFSRFWRNTXXXXXXXXXXXXXXXXXXXXXXXMSLHQRGPTPSDPAQTRHQA 519
             T  QL   +  +R                          +  +R P       T    
Sbjct: 89  RQTATQLLKLAHKYRPETKQEKKQRLLARAEKKAAGKGDVPT--KRPPVLRAGVNTVTTL 146

Query: 520 GREEEGAVVVIAHDVDPIEL-VSLPA 594
              ++  +VVIAHDVDPIEL V LPA
Sbjct: 147 VENKKAQLVVIAHDVDPIELVVFLPA 172


>BC073802-1|AAH73802.1|  266|Homo sapiens ribosomal protein L7a
           protein.
          Length = 266

 Score = 90.2 bits (214), Expect = 6e-18
 Identities = 43/65 (66%), Positives = 49/65 (75%)
 Frame = +2

Query: 509 VTKLVEKKKAQLWSSLMMLIPLSWFLFLPALCRKMGVPYCIVKGKSRLGALVHRKTCTCL 688
           VT LVE KKAQL      + P+   +FLPALCRKMGVPYCI+KGK+RLG LVHRKTCT +
Sbjct: 143 VTTLVENKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYCIIKGKARLGRLVHRKTCTTV 202

Query: 689 ALTNV 703
           A T V
Sbjct: 203 AFTQV 207



 Score = 83.4 bits (197), Expect = 7e-16
 Identities = 41/92 (44%), Positives = 51/92 (55%)
 Frame = +3

Query: 234 LVQICKMPKYIRIQRQKAVLQRRLKVPPPINQFTQTLDKTTAKGLFKILEKYRPETXXXX 413
           L +  K P+YIR+QRQ+A+L +RLKVPP INQFTQ LD+ TA  L K+  KYRPET    
Sbjct: 51  LTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALDRQTATQLLKLAHKYRPETKQEK 110

Query: 414 XXXXXXXXXXXXXXXXXXXXXRPNTIRSGTNT 509
                                RP  +R+G NT
Sbjct: 111 KQRLLARAEKKAAGKGDVPTKRPPVLRAGVNT 142



 Score = 61.7 bits (143), Expect = 2e-09
 Identities = 51/146 (34%), Positives = 62/146 (42%), Gaps = 4/146 (2%)
 Frame = +1

Query: 169 NPLFEKRPKNFAIGQGIQPTRDLSRFVRCPSISASSARRLYFSVV*KCP---LRSTNLPR 339
           NPLFEKRPKNF IGQ IQP RDL+RFV+ P       +R       K P    + T    
Sbjct: 29  NPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALD 88

Query: 340 HWTRLQLRAFSRFWRNTXXXXXXXXXXXXXXXXXXXXXXXMSLHQRGPTPSDPAQTRHQA 519
             T  QL   +  +R                          +  +R P       T    
Sbjct: 89  RQTATQLLKLAHKYRPETKQEKKQRLLARAEKKAAGKGDVPT--KRPPVLRAGVNTVTTL 146

Query: 520 GREEEGAVVVIAHDVDPIEL-VSLPA 594
              ++  +VVIAHDVDPIEL V LPA
Sbjct: 147 VENKKAQLVVIAHDVDPIELVVFLPA 172


>BC071901-1|AAH71901.1|  266|Homo sapiens ribosomal protein L7a
           protein.
          Length = 266

 Score = 90.2 bits (214), Expect = 6e-18
 Identities = 43/65 (66%), Positives = 49/65 (75%)
 Frame = +2

Query: 509 VTKLVEKKKAQLWSSLMMLIPLSWFLFLPALCRKMGVPYCIVKGKSRLGALVHRKTCTCL 688
           VT LVE KKAQL      + P+   +FLPALCRKMGVPYCI+KGK+RLG LVHRKTCT +
Sbjct: 143 VTTLVENKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYCIIKGKARLGRLVHRKTCTTV 202

Query: 689 ALTNV 703
           A T V
Sbjct: 203 AFTQV 207



 Score = 83.4 bits (197), Expect = 7e-16
 Identities = 41/92 (44%), Positives = 51/92 (55%)
 Frame = +3

Query: 234 LVQICKMPKYIRIQRQKAVLQRRLKVPPPINQFTQTLDKTTAKGLFKILEKYRPETXXXX 413
           L +  K P+YIR+QRQ+A+L +RLKVPP INQFTQ LD+ TA  L K+  KYRPET    
Sbjct: 51  LTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALDRQTATQLLKLAHKYRPETKQEK 110

Query: 414 XXXXXXXXXXXXXXXXXXXXXRPNTIRSGTNT 509
                                RP  +R+G NT
Sbjct: 111 KQRLLARAEKKAAGKGDVPTKRPPVLRAGVNT 142



 Score = 61.7 bits (143), Expect = 2e-09
 Identities = 51/146 (34%), Positives = 62/146 (42%), Gaps = 4/146 (2%)
 Frame = +1

Query: 169 NPLFEKRPKNFAIGQGIQPTRDLSRFVRCPSISASSARRLYFSVV*KCP---LRSTNLPR 339
           NPLFEKRPKNF IGQ IQP RDL+RFV+ P       +R       K P    + T    
Sbjct: 29  NPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALD 88

Query: 340 HWTRLQLRAFSRFWRNTXXXXXXXXXXXXXXXXXXXXXXXMSLHQRGPTPSDPAQTRHQA 519
             T  QL   +  +R                          +  +R P       T    
Sbjct: 89  RQTATQLLKLAHKYRPETKQEKKQRLLARAEKKAAGKGDVPT--KRPPVLRAGVNTVTTL 146

Query: 520 GREEEGAVVVIAHDVDPIEL-VSLPA 594
              ++  +VVIAHDVDPIEL V LPA
Sbjct: 147 VENKKAQLVVIAHDVDPIELVVFLPA 172


>BC071900-1|AAH71900.1|  266|Homo sapiens ribosomal protein L7a
           protein.
          Length = 266

 Score = 90.2 bits (214), Expect = 6e-18
 Identities = 43/65 (66%), Positives = 49/65 (75%)
 Frame = +2

Query: 509 VTKLVEKKKAQLWSSLMMLIPLSWFLFLPALCRKMGVPYCIVKGKSRLGALVHRKTCTCL 688
           VT LVE KKAQL      + P+   +FLPALCRKMGVPYCI+KGK+RLG LVHRKTCT +
Sbjct: 143 VTTLVENKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYCIIKGKARLGRLVHRKTCTTV 202

Query: 689 ALTNV 703
           A T V
Sbjct: 203 AFTQV 207



 Score = 83.4 bits (197), Expect = 7e-16
 Identities = 41/92 (44%), Positives = 51/92 (55%)
 Frame = +3

Query: 234 LVQICKMPKYIRIQRQKAVLQRRLKVPPPINQFTQTLDKTTAKGLFKILEKYRPETXXXX 413
           L +  K P+YIR+QRQ+A+L +RLKVPP INQFTQ LD+ TA  L K+  KYRPET    
Sbjct: 51  LTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALDRQTATQLLKLAHKYRPETKQEK 110

Query: 414 XXXXXXXXXXXXXXXXXXXXXRPNTIRSGTNT 509
                                RP  +R+G NT
Sbjct: 111 KQRLLARAEKKAAGKGDVPTKRPPVLRAGVNT 142



 Score = 61.7 bits (143), Expect = 2e-09
 Identities = 51/146 (34%), Positives = 62/146 (42%), Gaps = 4/146 (2%)
 Frame = +1

Query: 169 NPLFEKRPKNFAIGQGIQPTRDLSRFVRCPSISASSARRLYFSVV*KCP---LRSTNLPR 339
           NPLFEKRPKNF IGQ IQP RDL+RFV+ P       +R       K P    + T    
Sbjct: 29  NPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALD 88

Query: 340 HWTRLQLRAFSRFWRNTXXXXXXXXXXXXXXXXXXXXXXXMSLHQRGPTPSDPAQTRHQA 519
             T  QL   +  +R                          +  +R P       T    
Sbjct: 89  RQTATQLLKLAHKYRPETKQEKKQRLLARAEKKAAGKGDVPT--KRPPVLRAGVNTVTTL 146

Query: 520 GREEEGAVVVIAHDVDPIEL-VSLPA 594
              ++  +VVIAHDVDPIEL V LPA
Sbjct: 147 VENKKAQLVVIAHDVDPIELVVFLPA 172


>BC023624-1|AAH23624.1|  266|Homo sapiens ribosomal protein L7a
           protein.
          Length = 266

 Score = 90.2 bits (214), Expect = 6e-18
 Identities = 43/65 (66%), Positives = 49/65 (75%)
 Frame = +2

Query: 509 VTKLVEKKKAQLWSSLMMLIPLSWFLFLPALCRKMGVPYCIVKGKSRLGALVHRKTCTCL 688
           VT LVE KKAQL      + P+   +FLPALCRKMGVPYCI+KGK+RLG LVHRKTCT +
Sbjct: 143 VTTLVENKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYCIIKGKARLGRLVHRKTCTTV 202

Query: 689 ALTNV 703
           A T V
Sbjct: 203 AFTQV 207



 Score = 83.4 bits (197), Expect = 7e-16
 Identities = 41/92 (44%), Positives = 51/92 (55%)
 Frame = +3

Query: 234 LVQICKMPKYIRIQRQKAVLQRRLKVPPPINQFTQTLDKTTAKGLFKILEKYRPETXXXX 413
           L +  K P+YIR+QRQ+A+L +RLKVPP INQFTQ LD+ TA  L K+  KYRPET    
Sbjct: 51  LTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALDRQTATQLLKLAHKYRPETKQEK 110

Query: 414 XXXXXXXXXXXXXXXXXXXXXRPNTIRSGTNT 509
                                RP  +R+G NT
Sbjct: 111 KQRLLARAEKKAAGKGDVPTKRPPVLRAGVNT 142



 Score = 61.7 bits (143), Expect = 2e-09
 Identities = 51/146 (34%), Positives = 62/146 (42%), Gaps = 4/146 (2%)
 Frame = +1

Query: 169 NPLFEKRPKNFAIGQGIQPTRDLSRFVRCPSISASSARRLYFSVV*KCP---LRSTNLPR 339
           NPLFEKRPKNF IGQ IQP RDL+RFV+ P       +R       K P    + T    
Sbjct: 29  NPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALD 88

Query: 340 HWTRLQLRAFSRFWRNTXXXXXXXXXXXXXXXXXXXXXXXMSLHQRGPTPSDPAQTRHQA 519
             T  QL   +  +R                          +  +R P       T    
Sbjct: 89  RQTATQLLKLAHKYRPETKQEKKQRLLARAEKKAAGKGDVPT--KRPPVLRAGVNTVTTL 146

Query: 520 GREEEGAVVVIAHDVDPIEL-VSLPA 594
              ++  +VVIAHDVDPIEL V LPA
Sbjct: 147 VENKKAQLVVIAHDVDPIELVVFLPA 172


>BC023594-1|AAH23594.1|  266|Homo sapiens ribosomal protein L7a
           protein.
          Length = 266

 Score = 90.2 bits (214), Expect = 6e-18
 Identities = 43/65 (66%), Positives = 49/65 (75%)
 Frame = +2

Query: 509 VTKLVEKKKAQLWSSLMMLIPLSWFLFLPALCRKMGVPYCIVKGKSRLGALVHRKTCTCL 688
           VT LVE KKAQL      + P+   +FLPALCRKMGVPYCI+KGK+RLG LVHRKTCT +
Sbjct: 143 VTTLVENKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYCIIKGKARLGRLVHRKTCTTV 202

Query: 689 ALTNV 703
           A T V
Sbjct: 203 AFTQV 207



 Score = 83.4 bits (197), Expect = 7e-16
 Identities = 41/92 (44%), Positives = 51/92 (55%)
 Frame = +3

Query: 234 LVQICKMPKYIRIQRQKAVLQRRLKVPPPINQFTQTLDKTTAKGLFKILEKYRPETXXXX 413
           L +  K P+YIR+QRQ+A+L +RLKVPP INQFTQ LD+ TA  L K+  KYRPET    
Sbjct: 51  LTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALDRQTATQLLKLAHKYRPETKQEK 110

Query: 414 XXXXXXXXXXXXXXXXXXXXXRPNTIRSGTNT 509
                                RP  +R+G NT
Sbjct: 111 KQRLLARAEKKAAGKGDVPTKRPPVLRAGVNT 142



 Score = 61.7 bits (143), Expect = 2e-09
 Identities = 51/146 (34%), Positives = 62/146 (42%), Gaps = 4/146 (2%)
 Frame = +1

Query: 169 NPLFEKRPKNFAIGQGIQPTRDLSRFVRCPSISASSARRLYFSVV*KCP---LRSTNLPR 339
           NPLFEKRPKNF IGQ IQP RDL+RFV+ P       +R       K P    + T    
Sbjct: 29  NPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALD 88

Query: 340 HWTRLQLRAFSRFWRNTXXXXXXXXXXXXXXXXXXXXXXXMSLHQRGPTPSDPAQTRHQA 519
             T  QL   +  +R                          +  +R P       T    
Sbjct: 89  RQTATQLLKLAHKYRPETKQEKKQRLLARAEKKAAGKGDVPT--KRPPVLRAGVNTVTTL 146

Query: 520 GREEEGAVVVIAHDVDPIEL-VSLPA 594
              ++  +VVIAHDVDPIEL V LPA
Sbjct: 147 VENKKAQLVVIAHDVDPIELVVFLPA 172


>BC021979-1|AAH21979.1|  266|Homo sapiens ribosomal protein L7a
           protein.
          Length = 266

 Score = 90.2 bits (214), Expect = 6e-18
 Identities = 43/65 (66%), Positives = 49/65 (75%)
 Frame = +2

Query: 509 VTKLVEKKKAQLWSSLMMLIPLSWFLFLPALCRKMGVPYCIVKGKSRLGALVHRKTCTCL 688
           VT LVE KKAQL      + P+   +FLPALCRKMGVPYCI+KGK+RLG LVHRKTCT +
Sbjct: 143 VTTLVENKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYCIIKGKARLGRLVHRKTCTTV 202

Query: 689 ALTNV 703
           A T V
Sbjct: 203 AFTQV 207



 Score = 83.4 bits (197), Expect = 7e-16
 Identities = 41/92 (44%), Positives = 51/92 (55%)
 Frame = +3

Query: 234 LVQICKMPKYIRIQRQKAVLQRRLKVPPPINQFTQTLDKTTAKGLFKILEKYRPETXXXX 413
           L +  K P+YIR+QRQ+A+L +RLKVPP INQFTQ LD+ TA  L K+  KYRPET    
Sbjct: 51  LTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALDRQTATQLLKLAHKYRPETKQEK 110

Query: 414 XXXXXXXXXXXXXXXXXXXXXRPNTIRSGTNT 509
                                RP  +R+G NT
Sbjct: 111 KQRLLARAEKKAAGKGDVPTKRPPVLRAGVNT 142



 Score = 61.7 bits (143), Expect = 2e-09
 Identities = 51/146 (34%), Positives = 62/146 (42%), Gaps = 4/146 (2%)
 Frame = +1

Query: 169 NPLFEKRPKNFAIGQGIQPTRDLSRFVRCPSISASSARRLYFSVV*KCP---LRSTNLPR 339
           NPLFEKRPKNF IGQ IQP RDL+RFV+ P       +R       K P    + T    
Sbjct: 29  NPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALD 88

Query: 340 HWTRLQLRAFSRFWRNTXXXXXXXXXXXXXXXXXXXXXXXMSLHQRGPTPSDPAQTRHQA 519
             T  QL   +  +R                          +  +R P       T    
Sbjct: 89  RQTATQLLKLAHKYRPETKQEKKQRLLARAEKKAAGKGDVPT--KRPPVLRAGVNTVTTL 146

Query: 520 GREEEGAVVVIAHDVDPIEL-VSLPA 594
              ++  +VVIAHDVDPIEL V LPA
Sbjct: 147 VENKKAQLVVIAHDVDPIELVVFLPA 172


>BC005128-1|AAH05128.1|  266|Homo sapiens ribosomal protein L7a
           protein.
          Length = 266

 Score = 90.2 bits (214), Expect = 6e-18
 Identities = 43/65 (66%), Positives = 49/65 (75%)
 Frame = +2

Query: 509 VTKLVEKKKAQLWSSLMMLIPLSWFLFLPALCRKMGVPYCIVKGKSRLGALVHRKTCTCL 688
           VT LVE KKAQL      + P+   +FLPALCRKMGVPYCI+KGK+RLG LVHRKTCT +
Sbjct: 143 VTTLVENKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYCIIKGKARLGRLVHRKTCTTV 202

Query: 689 ALTNV 703
           A T V
Sbjct: 203 AFTQV 207



 Score = 83.4 bits (197), Expect = 7e-16
 Identities = 41/92 (44%), Positives = 51/92 (55%)
 Frame = +3

Query: 234 LVQICKMPKYIRIQRQKAVLQRRLKVPPPINQFTQTLDKTTAKGLFKILEKYRPETXXXX 413
           L +  K P+YIR+QRQ+A+L +RLKVPP INQFTQ LD+ TA  L K+  KYRPET    
Sbjct: 51  LTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALDRQTATQLLKLAHKYRPETKQEK 110

Query: 414 XXXXXXXXXXXXXXXXXXXXXRPNTIRSGTNT 509
                                RP  +R+G NT
Sbjct: 111 KQRLLARAEKKAAGKGDVPTKRPPVLRAGVNT 142



 Score = 61.7 bits (143), Expect = 2e-09
 Identities = 51/146 (34%), Positives = 62/146 (42%), Gaps = 4/146 (2%)
 Frame = +1

Query: 169 NPLFEKRPKNFAIGQGIQPTRDLSRFVRCPSISASSARRLYFSVV*KCP---LRSTNLPR 339
           NPLFEKRPKNF IGQ IQP RDL+RFV+ P       +R       K P    + T    
Sbjct: 29  NPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALD 88

Query: 340 HWTRLQLRAFSRFWRNTXXXXXXXXXXXXXXXXXXXXXXXMSLHQRGPTPSDPAQTRHQA 519
             T  QL   +  +R                          +  +R P       T    
Sbjct: 89  RQTATQLLKLAHKYRPETKQEKKQRLLARAEKKAAGKGDVPT--KRPPVLRAGVNTVTTL 146

Query: 520 GREEEGAVVVIAHDVDPIEL-VSLPA 594
              ++  +VVIAHDVDPIEL V LPA
Sbjct: 147 VENKKAQLVVIAHDVDPIELVVFLPA 172


>AL158826-10|CAI12834.1|  151|Homo sapiens ribosomal protein L7a
           protein.
          Length = 151

 Score = 90.2 bits (214), Expect = 6e-18
 Identities = 43/65 (66%), Positives = 49/65 (75%)
 Frame = +2

Query: 509 VTKLVEKKKAQLWSSLMMLIPLSWFLFLPALCRKMGVPYCIVKGKSRLGALVHRKTCTCL 688
           VT LVE KKAQL      + P+   +FLPALCRKMGVPYCI+KGK+RLG LVHRKTCT +
Sbjct: 28  VTTLVENKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYCIIKGKARLGRLVHRKTCTTV 87

Query: 689 ALTNV 703
           A T V
Sbjct: 88  AFTQV 92


>AL158826-8|CAI12832.1|  266|Homo sapiens ribosomal protein L7a
           protein.
          Length = 266

 Score = 90.2 bits (214), Expect = 6e-18
 Identities = 43/65 (66%), Positives = 49/65 (75%)
 Frame = +2

Query: 509 VTKLVEKKKAQLWSSLMMLIPLSWFLFLPALCRKMGVPYCIVKGKSRLGALVHRKTCTCL 688
           VT LVE KKAQL      + P+   +FLPALCRKMGVPYCI+KGK+RLG LVHRKTCT +
Sbjct: 143 VTTLVENKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYCIIKGKARLGRLVHRKTCTTV 202

Query: 689 ALTNV 703
           A T V
Sbjct: 203 AFTQV 207



 Score = 83.4 bits (197), Expect = 7e-16
 Identities = 41/92 (44%), Positives = 51/92 (55%)
 Frame = +3

Query: 234 LVQICKMPKYIRIQRQKAVLQRRLKVPPPINQFTQTLDKTTAKGLFKILEKYRPETXXXX 413
           L +  K P+YIR+QRQ+A+L +RLKVPP INQFTQ LD+ TA  L K+  KYRPET    
Sbjct: 51  LTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALDRQTATQLLKLAHKYRPETKQEK 110

Query: 414 XXXXXXXXXXXXXXXXXXXXXRPNTIRSGTNT 509
                                RP  +R+G NT
Sbjct: 111 KQRLLARAEKKAAGKGDVPTKRPPVLRAGVNT 142



 Score = 61.7 bits (143), Expect = 2e-09
 Identities = 51/146 (34%), Positives = 62/146 (42%), Gaps = 4/146 (2%)
 Frame = +1

Query: 169 NPLFEKRPKNFAIGQGIQPTRDLSRFVRCPSISASSARRLYFSVV*KCP---LRSTNLPR 339
           NPLFEKRPKNF IGQ IQP RDL+RFV+ P       +R       K P    + T    
Sbjct: 29  NPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALD 88

Query: 340 HWTRLQLRAFSRFWRNTXXXXXXXXXXXXXXXXXXXXXXXMSLHQRGPTPSDPAQTRHQA 519
             T  QL   +  +R                          +  +R P       T    
Sbjct: 89  RQTATQLLKLAHKYRPETKQEKKQRLLARAEKKAAGKGDVPT--KRPPVLRAGVNTVTTL 146

Query: 520 GREEEGAVVVIAHDVDPIEL-VSLPA 594
              ++  +VVIAHDVDPIEL V LPA
Sbjct: 147 VENKKAQLVVIAHDVDPIELVVFLPA 172


>AB056665-1|BAB39381.1|  142|Homo sapiens ribosomal protein L7a
           protein.
          Length = 142

 Score = 90.2 bits (214), Expect = 6e-18
 Identities = 43/65 (66%), Positives = 49/65 (75%)
 Frame = +2

Query: 509 VTKLVEKKKAQLWSSLMMLIPLSWFLFLPALCRKMGVPYCIVKGKSRLGALVHRKTCTCL 688
           VT LVE KKAQL      + P+   +FLPALCRKMGVPYCI+KGK+RLG LVHRKTCT +
Sbjct: 19  VTTLVENKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYCIIKGKARLGRLVHRKTCTTV 78

Query: 689 ALTNV 703
           A T V
Sbjct: 79  AFTQV 83


>AL158826-9|CAI12833.1|  191|Homo sapiens ribosomal protein L7a
           protein.
          Length = 191

 Score = 83.4 bits (197), Expect = 7e-16
 Identities = 41/92 (44%), Positives = 51/92 (55%)
 Frame = +3

Query: 234 LVQICKMPKYIRIQRQKAVLQRRLKVPPPINQFTQTLDKTTAKGLFKILEKYRPETXXXX 413
           L +  K P+YIR+QRQ+A+L +RLKVPP INQFTQ LD+ TA  L K+  KYRPET    
Sbjct: 78  LTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALDRQTATQLLKLAHKYRPETKQEK 137

Query: 414 XXXXXXXXXXXXXXXXXXXXXRPNTIRSGTNT 509
                                RP  +R+G NT
Sbjct: 138 KQRLLARAEKKAAGKGDVPTKRPPVLRAGVNT 169



 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 24/30 (80%), Positives = 26/30 (86%)
 Frame = +1

Query: 169 NPLFEKRPKNFAIGQGIQPTRDLSRFVRCP 258
           NPLFEKRPKNF IGQ IQP RDL+RFV+ P
Sbjct: 56  NPLFEKRPKNFGIGQDIQPKRDLTRFVKWP 85


>CR457238-1|CAG33519.1|  153|Homo sapiens NOLA2 protein.
          Length = 153

 Score = 37.1 bits (82), Expect = 0.061
 Identities = 18/64 (28%), Positives = 29/64 (45%)
 Frame = +2

Query: 503 KHVTKLVEKKKAQLWSSLMMLIPLSWFLFLPALCRKMGVPYCIVKGKSRLGALVHRKTCT 682
           K V K V K +  +       +P+  +  LP +C    +PY  +  K+ LGA    K  T
Sbjct: 65  KEVQKFVNKGEKGIMVLAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGSKRPT 124

Query: 683 CLAL 694
           C+ +
Sbjct: 125 CVIM 128


>BC006387-1|AAH06387.1|  153|Homo sapiens nucleolar protein family
           A, member 2 (H/ACA small nucleolar RNPs) protein.
          Length = 153

 Score = 37.1 bits (82), Expect = 0.061
 Identities = 18/64 (28%), Positives = 29/64 (45%)
 Frame = +2

Query: 503 KHVTKLVEKKKAQLWSSLMMLIPLSWFLFLPALCRKMGVPYCIVKGKSRLGALVHRKTCT 682
           K V K V K +  +       +P+  +  LP +C    +PY  +  K+ LGA    K  T
Sbjct: 65  KEVQKFVNKGEKGIMVLAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGSKRPT 124

Query: 683 CLAL 694
           C+ +
Sbjct: 125 CVIM 128


>BC000009-1|AAH00009.1|  153|Homo sapiens nucleolar protein family
           A, member 2 (H/ACA small nucleolar RNPs) protein.
          Length = 153

 Score = 37.1 bits (82), Expect = 0.061
 Identities = 18/64 (28%), Positives = 29/64 (45%)
 Frame = +2

Query: 503 KHVTKLVEKKKAQLWSSLMMLIPLSWFLFLPALCRKMGVPYCIVKGKSRLGALVHRKTCT 682
           K V K V K +  +       +P+  +  LP +C    +PY  +  K+ LGA    K  T
Sbjct: 65  KEVQKFVNKGEKGIMVLAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGSKRPT 124

Query: 683 CLAL 694
           C+ +
Sbjct: 125 CVIM 128


>AK000486-1|BAA91198.1|  153|Homo sapiens protein ( Homo sapiens
           cDNA FLJ20479 fis, clone KAT07382. ).
          Length = 153

 Score = 37.1 bits (82), Expect = 0.061
 Identities = 18/64 (28%), Positives = 29/64 (45%)
 Frame = +2

Query: 503 KHVTKLVEKKKAQLWSSLMMLIPLSWFLFLPALCRKMGVPYCIVKGKSRLGALVHRKTCT 682
           K V K V K +  +       +P+  +  LP +C    +PY  +  K+ LGA    K  T
Sbjct: 65  KEVQKFVNKGEKGIMVLAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGSKRPT 124

Query: 683 CLAL 694
           C+ +
Sbjct: 125 CVIM 128


>AJ293309-1|CAC08452.1|  153|Homo sapiens NHP2 protein protein.
          Length = 153

 Score = 37.1 bits (82), Expect = 0.061
 Identities = 18/64 (28%), Positives = 29/64 (45%)
 Frame = +2

Query: 503 KHVTKLVEKKKAQLWSSLMMLIPLSWFLFLPALCRKMGVPYCIVKGKSRLGALVHRKTCT 682
           K V K V K +  +       +P+  +  LP +C    +PY  +  K+ LGA    K  T
Sbjct: 65  KEVQKFVNKGEKGIMVLAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGSKRPT 124

Query: 683 CLAL 694
           C+ +
Sbjct: 125 CVIM 128


>AF401219-1|AAL02175.1|  153|Homo sapiens small nucleolar RNA
           binding-like protein NHP2 protein.
          Length = 153

 Score = 37.1 bits (82), Expect = 0.061
 Identities = 18/64 (28%), Positives = 29/64 (45%)
 Frame = +2

Query: 503 KHVTKLVEKKKAQLWSSLMMLIPLSWFLFLPALCRKMGVPYCIVKGKSRLGALVHRKTCT 682
           K V K V K +  +       +P+  +  LP +C    +PY  +  K+ LGA    K  T
Sbjct: 65  KEVQKFVNKGEKGIMVLAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGSKRPT 124

Query: 683 CLAL 694
           C+ +
Sbjct: 125 CVIM 128


>Z83840-3|CAB46207.1|  128|Homo sapiens NHP2 non-histone chromosome
           protein 2-like 1 (S. cerevisiae) protein.
          Length = 128

 Score = 31.9 bits (69), Expect = 2.3
 Identities = 14/29 (48%), Positives = 15/29 (51%)
 Frame = +2

Query: 569 PLSWFLFLPALCRKMGVPYCIVKGKSRLG 655
           PL   L LP LC    VPY  V+ K  LG
Sbjct: 62  PLEIILHLPLLCEDKNVPYVFVRSKQALG 90


>D50420-1|BAA23363.1|  128|Homo sapiens OTK27 protein.
          Length = 128

 Score = 31.9 bits (69), Expect = 2.3
 Identities = 14/29 (48%), Positives = 15/29 (51%)
 Frame = +2

Query: 569 PLSWFLFLPALCRKMGVPYCIVKGKSRLG 655
           PL   L LP LC    VPY  V+ K  LG
Sbjct: 62  PLEIILHLPLLCEDKNVPYVFVRSKQALG 90


>CR541725-1|CAG46526.1|  128|Homo sapiens NHP2L1 protein.
          Length = 128

 Score = 31.9 bits (69), Expect = 2.3
 Identities = 14/29 (48%), Positives = 15/29 (51%)
 Frame = +2

Query: 569 PLSWFLFLPALCRKMGVPYCIVKGKSRLG 655
           PL   L LP LC    VPY  V+ K  LG
Sbjct: 62  PLEIILHLPLLCEDKNVPYVFVRSKQALG 90


>CR456531-1|CAG30417.1|  128|Homo sapiens NHP2L1 protein.
          Length = 128

 Score = 31.9 bits (69), Expect = 2.3
 Identities = 14/29 (48%), Positives = 15/29 (51%)
 Frame = +2

Query: 569 PLSWFLFLPALCRKMGVPYCIVKGKSRLG 655
           PL   L LP LC    VPY  V+ K  LG
Sbjct: 62  PLEIILHLPLLCEDKNVPYVFVRSKQALG 90


>BC095439-1|AAH95439.1|  128|Homo sapiens NHP2 non-histone
           chromosome protein 2-like 1 (S. cerevisiae) protein.
          Length = 128

 Score = 31.9 bits (69), Expect = 2.3
 Identities = 14/29 (48%), Positives = 15/29 (51%)
 Frame = +2

Query: 569 PLSWFLFLPALCRKMGVPYCIVKGKSRLG 655
           PL   L LP LC    VPY  V+ K  LG
Sbjct: 62  PLEIILHLPLLCEDKNVPYVFVRSKQALG 90


>BC019282-1|AAH19282.1|  128|Homo sapiens NHP2L1 protein protein.
          Length = 128

 Score = 31.9 bits (69), Expect = 2.3
 Identities = 14/29 (48%), Positives = 15/29 (51%)
 Frame = +2

Query: 569 PLSWFLFLPALCRKMGVPYCIVKGKSRLG 655
           PL   L LP LC    VPY  V+ K  LG
Sbjct: 62  PLEIILHLPLLCEDKNVPYVFVRSKQALG 90


>BC005358-1|AAH05358.1|  128|Homo sapiens NHP2 non-histone
           chromosome protein 2-like 1 (S. cerevisiae) protein.
          Length = 128

 Score = 31.9 bits (69), Expect = 2.3
 Identities = 14/29 (48%), Positives = 15/29 (51%)
 Frame = +2

Query: 569 PLSWFLFLPALCRKMGVPYCIVKGKSRLG 655
           PL   L LP LC    VPY  V+ K  LG
Sbjct: 62  PLEIILHLPLLCEDKNVPYVFVRSKQALG 90


>AF155235-1|AAF06959.1|  128|Homo sapiens 15.5 kD RNA binding
           protein protein.
          Length = 128

 Score = 31.9 bits (69), Expect = 2.3
 Identities = 14/29 (48%), Positives = 15/29 (51%)
 Frame = +2

Query: 569 PLSWFLFLPALCRKMGVPYCIVKGKSRLG 655
           PL   L LP LC    VPY  V+ K  LG
Sbjct: 62  PLEIILHLPLLCEDKNVPYVFVRSKQALG 90


>AF091076-1|AAC72945.1|  128|Homo sapiens OTK27 protein.
          Length = 128

 Score = 31.9 bits (69), Expect = 2.3
 Identities = 14/29 (48%), Positives = 15/29 (51%)
 Frame = +2

Query: 569 PLSWFLFLPALCRKMGVPYCIVKGKSRLG 655
           PL   L LP LC    VPY  V+ K  LG
Sbjct: 62  PLEIILHLPLLCEDKNVPYVFVRSKQALG 90


>X06704-1|CAA29888.1|  439|Homo sapiens protein ( Human mRNA for
           trk-2h oncogene. ).
          Length = 439

 Score = 30.7 bits (66), Expect = 5.3
 Identities = 12/13 (92%), Positives = 12/13 (92%)
 Frame = +1

Query: 169 NPLFEKRPKNFAI 207
           NPLFEKRPKNF I
Sbjct: 29  NPLFEKRPKNFGI 41


>AY166857-1|AAN87839.1|  668|Homo sapiens serine/threonine protein
           kinase isoform protein.
          Length = 668

 Score = 29.9 bits (64), Expect = 9.3
 Identities = 17/47 (36%), Positives = 23/47 (48%)
 Frame = +2

Query: 188 GQRTLPLVRAFSQLGTCPDL*DAQVYPHPAPEGCTSASSESAPSDQP 328
           GQR+  +  A S L T P L   +V PHP+P G    + +  P   P
Sbjct: 407 GQRSRSISGASSGLSTSP-LSSPRVTPHPSPRGSPLPTPKGTPVHTP 452


>AK131534-1|BAD18671.1|  766|Homo sapiens protein ( Homo sapiens
           cDNA FLJ16763 fis, clone BRAMY3018357, weakly  similar
           to SNF1-related protein kinase KIN10 (EC 2.7.1.-). ).
          Length = 766

 Score = 29.9 bits (64), Expect = 9.3
 Identities = 17/47 (36%), Positives = 23/47 (48%)
 Frame = +2

Query: 188 GQRTLPLVRAFSQLGTCPDL*DAQVYPHPAPEGCTSASSESAPSDQP 328
           GQR+  +  A S L T P L   +V PHP+P G    + +  P   P
Sbjct: 453 GQRSRSISGASSGLSTSP-LSSPRVTPHPSPRGSPLPTPKGTPVHTP 498


>AJ006701-1|CAA07196.1|  603|Homo sapiens putative serine/threonine
           protein kinase protein.
          Length = 603

 Score = 29.9 bits (64), Expect = 9.3
 Identities = 17/47 (36%), Positives = 23/47 (48%)
 Frame = +2

Query: 188 GQRTLPLVRAFSQLGTCPDL*DAQVYPHPAPEGCTSASSESAPSDQP 328
           GQR+  +  A S L T P L   +V PHP+P G    + +  P   P
Sbjct: 336 GQRSRSISGASSGLSTSP-LSSPRVTPHPSPRGSPLPTPKGTPVHTP 381


>AF533880-1|AAP97727.1|  674|Homo sapiens putative serine/threonine
           protein kinase variant B3 protein.
          Length = 674

 Score = 29.9 bits (64), Expect = 9.3
 Identities = 17/47 (36%), Positives = 23/47 (48%)
 Frame = +2

Query: 188 GQRTLPLVRAFSQLGTCPDL*DAQVYPHPAPEGCTSASSESAPSDQP 328
           GQR+  +  A S L T P L   +V PHP+P G    + +  P   P
Sbjct: 407 GQRSRSISGASSGLSTSP-LSSPRVTPHPSPRGSPLPTPKGTPVHTP 452


>AF533879-1|AAP97726.1|  736|Homo sapiens putative serine/threonine
           protein kinase variant C protein.
          Length = 736

 Score = 29.9 bits (64), Expect = 9.3
 Identities = 17/47 (36%), Positives = 23/47 (48%)
 Frame = +2

Query: 188 GQRTLPLVRAFSQLGTCPDL*DAQVYPHPAPEGCTSASSESAPSDQP 328
           GQR+  +  A S L T P L   +V PHP+P G    + +  P   P
Sbjct: 407 GQRSRSISGASSGLSTSP-LSSPRVTPHPSPRGSPLPTPKGTPVHTP 452


>AF533878-1|AAP97725.1|  674|Homo sapiens putative serine/threonine
           protein kinase variant B2 protein.
          Length = 674

 Score = 29.9 bits (64), Expect = 9.3
 Identities = 17/47 (36%), Positives = 23/47 (48%)
 Frame = +2

Query: 188 GQRTLPLVRAFSQLGTCPDL*DAQVYPHPAPEGCTSASSESAPSDQP 328
           GQR+  +  A S L T P L   +V PHP+P G    + +  P   P
Sbjct: 407 GQRSRSISGASSGLSTSP-LSSPRVTPHPSPRGSPLPTPKGTPVHTP 452


>AF533877-1|AAP97724.1|  674|Homo sapiens putative serine/threonine
           protein kinase variant B1 protein.
          Length = 674

 Score = 29.9 bits (64), Expect = 9.3
 Identities = 17/47 (36%), Positives = 23/47 (48%)
 Frame = +2

Query: 188 GQRTLPLVRAFSQLGTCPDL*DAQVYPHPAPEGCTSASSESAPSDQP 328
           GQR+  +  A S L T P L   +V PHP+P G    + +  P   P
Sbjct: 407 GQRSRSISGASSGLSTSP-LSSPRVTPHPSPRGSPLPTPKGTPVHTP 452


>AF533876-1|AAP97723.1|  668|Homo sapiens putative serine/threonine
           protein kinase variant A protein.
          Length = 668

 Score = 29.9 bits (64), Expect = 9.3
 Identities = 17/47 (36%), Positives = 23/47 (48%)
 Frame = +2

Query: 188 GQRTLPLVRAFSQLGTCPDL*DAQVYPHPAPEGCTSASSESAPSDQP 328
           GQR+  +  A S L T P L   +V PHP+P G    + +  P   P
Sbjct: 407 GQRSRSISGASSGLSTSP-LSSPRVTPHPSPRGSPLPTPKGTPVHTP 452


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 101,287,776
Number of Sequences: 237096
Number of extensions: 2128466
Number of successful extensions: 9525
Number of sequences better than 10.0: 40
Number of HSP's better than 10.0 without gapping: 9273
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9508
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8175213644
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -