SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20007
         (719 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

M57424-1|AAA51737.1|  298|Homo sapiens adenine nucleotide transl...   149   7e-36
L78810-1|AAB39266.1|  298|Homo sapiens ANT-2 protein.                 149   7e-36
BC056160-1|AAH56160.1|  298|Homo sapiens solute carrier family 2...   149   7e-36
CR457400-1|CAG33681.1|  298|Homo sapiens SLC25A6 protein.             147   3e-35
BC031912-1|AAH31912.1|  298|Homo sapiens solute carrier family 2...   147   3e-35
BC014775-1|AAH14775.1|  298|Homo sapiens solute carrier family 2...   147   3e-35
BC008935-1|AAH08935.1|  298|Homo sapiens solute carrier family 2...   147   3e-35
BC008737-1|AAH08737.1|  298|Homo sapiens solute carrier family 2...   147   3e-35
BC007850-1|AAH07850.1|  298|Homo sapiens solute carrier family 2...   147   3e-35
BC007295-1|AAH07295.1|  298|Homo sapiens solute carrier family 2...   147   3e-35
AY007135-1|AAG01998.1|  298|Homo sapiens protein ( Homo sapiens ...   147   3e-35
AL683870-2|CAI39844.1|  158|Homo sapiens solute carrier family 2...   147   3e-35
AL683870-1|CAI39843.1|  298|Homo sapiens solute carrier family 2...   147   3e-35
AB209822-1|BAD93059.1|  323|Homo sapiens ADP,ATP carrier protein...   147   3e-35
J04982-1|AAA51736.1|  298|Homo sapiens ANT1 protein.                  147   4e-35
BC063643-1|AAH63643.1|  298|Homo sapiens solute carrier family 2...   147   4e-35
BC061589-1|AAH61589.1|  298|Homo sapiens solute carrier family 2...   147   4e-35
BC008664-1|AAH08664.1|  298|Homo sapiens solute carrier family 2...   147   4e-35
AB209764-1|BAD93001.1|  261|Homo sapiens solute carrier family 2...   147   4e-35
J03591-1|AAA36749.1|  252|Homo sapiens protein ( Human ADP/ATP t...   146   5e-35
BC068199-1|AAH68199.1|  323|Homo sapiens SLC25A5 protein protein.     146   5e-35
AC004000-1|AAB96347.1|  298|Homo sapiens ADP/ATP carrier protein...   146   5e-35
J02683-1|AAA35579.1|  298|Homo sapiens protein ( Human ADP/ATP c...   146   7e-35
J02966-1|AAA61223.1|  297|Homo sapiens ANT1 protein.                  140   5e-33
J03592-1|AAA36750.1|  262|Homo sapiens protein ( Human ADP/ATP t...   138   2e-32
BC022032-1|AAH22032.1|  315|Homo sapiens solute carrier family 2...   132   1e-30
AY550240-1|AAT42263.1|  315|Homo sapiens sperm flagellar energy ...   132   1e-30
AJ863129-1|CAI05952.1|  315|Homo sapiens ADP/ATP carrier isoform...   132   1e-30
AC093591-1|AAY40974.1|  315|Homo sapiens unknown protein.             132   1e-30
AF091236-1|AAC61590.1|   72|Homo sapiens ADP/ATP translocase pro...   102   1e-21
J03593-1|AAA36751.1|   37|Homo sapiens protein ( Human ADP/ATP t...    57   6e-08
BC068561-1|AAH68561.1|  477|Homo sapiens solute carrier family 2...    43   0.001
BC030266-1|AAH30266.1|  332|Homo sapiens solute carrier family 2...    43   0.001
BC014519-1|AAH14519.1|  477|Homo sapiens solute carrier family 2...    43   0.001
AL713888-2|CAI15116.1|  332|Homo sapiens solute carrier family 2...    43   0.001
AL390036-2|CAI13623.1|  477|Homo sapiens solute carrier family 2...    43   0.001
AL359258-2|CAI14513.1|  477|Homo sapiens solute carrier family 2...    43   0.001
AJ619987-1|CAF04493.1|  477|Homo sapiens small calcium-binding m...    43   0.001
AJ619961-1|CAF04058.1|  458|Homo sapiens mitochondrial ATP-Mg/Pi...    43   0.001
AF123303-1|AAF28888.1|  411|Homo sapiens calcium-binding transpo...    43   0.001
Y14494-1|CAA74834.1|  678|Homo sapiens aralar1 protein.                42   0.002
BC016932-1|AAH16932.1|  678|Homo sapiens solute carrier family 2...    42   0.002
AJ496568-1|CAD43090.1|  678|Homo sapiens mitochondrial aspartate...    42   0.002
AC068039-2|AAY24134.1|  678|Homo sapiens unknown protein.              42   0.002
BC132739-1|AAI32740.1|  291|Homo sapiens solute carrier family 2...    42   0.003
AL627107-4|CAI23613.1|  291|Homo sapiens protein ( udogene, a no...    42   0.003
M31659-1|AAA36329.1|  349|Homo sapiens protein ( Human GT mitoch...    40   0.007
BC045598-1|AAH45598.1|  318|Homo sapiens solute carrier family 2...    40   0.007
AC004143-1|AAC02758.1|  216|Homo sapiens R29893_1 protein.             40   0.007
AL035423-5|CAI42440.1|  353|Homo sapiens solute carrier family 2...    40   0.012
AL035423-4|CAI42441.1|  322|Homo sapiens solute carrier family 2...    40   0.012
AF155811-1|AAG29584.1|  322|Homo sapiens mitochondrial uncouplin...    40   0.012
AF155810-1|AAG29583.1|  353|Homo sapiens mitochondrial uncouplin...    40   0.012
Y17571-1|CAB62206.1|  675|Homo sapiens aralar2 protein.                39   0.021
BC103933-1|AAI03934.1|  469|Homo sapiens solute carrier family 2...    39   0.021
BC103932-1|AAI03933.1|  469|Homo sapiens solute carrier family 2...    39   0.021
BC103931-1|AAI03932.1|  469|Homo sapiens solute carrier family 2...    39   0.021
BC103930-1|AAI03931.1|  469|Homo sapiens solute carrier family 2...    39   0.021
BC089448-1|AAH89448.1|  469|Homo sapiens solute carrier family 2...    39   0.021
BC006566-1|AAH06566.1|  675|Homo sapiens solute carrier family 2...    39   0.021
BC005163-1|AAH05163.2|  308|Homo sapiens SLC25A25 protein protein.     39   0.021
AY358515-1|AAQ88879.1|  469|Homo sapiens LCLC549 protein.              39   0.021
AL590708-19|CAI13838.1|  469|Homo sapiens solute carrier family ...    39   0.021
AL590708-16|CAI13836.1|  501|Homo sapiens solute carrier family ...    39   0.021
AL590708-7|CAI13827.1|  515|Homo sapiens solute carrier family 2...    39   0.021
AL590708-6|CAI13826.1|  313|Homo sapiens solute carrier family 2...    39   0.021
AL360268-5|CAH73136.1|  469|Homo sapiens solute carrier family 2...    39   0.021
AL360268-4|CAH73135.1|  501|Homo sapiens solute carrier family 2...    39   0.021
AL360268-3|CAH73134.1|  515|Homo sapiens solute carrier family 2...    39   0.021
AL360268-2|CAH73133.1|  313|Homo sapiens solute carrier family 2...    39   0.021
AK222864-1|BAD96584.1|  675|Homo sapiens solute carrier family 2...    39   0.021
AJ619992-1|CAF04498.1|  366|Homo sapiens small calcium-binding m...    39   0.021
AJ619991-1|CAF04497.1|  489|Homo sapiens small calcium-binding m...    39   0.021
AJ619990-1|CAF04496.1|  503|Homo sapiens small calcium-binding m...    39   0.021
AJ619989-1|CAF04495.1|  469|Homo sapiens small calcium-binding m...    39   0.021
AJ619963-1|CAF04060.1|  489|Homo sapiens mitochondrial ATP-Mg/Pi...    39   0.021
AJ496569-1|CAD43091.1|  676|Homo sapiens mitochondrial aspartate...    39   0.021
AF118838-1|AAD38501.1|  675|Homo sapiens citrin protein.               39   0.021
AC002450-1|AAB67049.1|  187|Homo sapiens WUGSC:H_GS244B22.1 prot...    39   0.021
AB067483-1|BAB67789.1|  568|Homo sapiens KIAA1896 protein protein.     39   0.021
BC119667-1|AAI19668.1|  325|Homo sapiens solute carrier family 2...    38   0.027
BC119666-1|AAI19667.1|  325|Homo sapiens solute carrier family 2...    38   0.027
AY358099-1|AAQ88466.1|  325|Homo sapiens UCP5 protein.                 38   0.027
AL035423-3|CAB41251.1|  325|Homo sapiens solute carrier family 2...    38   0.027
AL035423-2|CAI42439.1|  198|Homo sapiens solute carrier family 2...    38   0.027
AF155809-1|AAG29582.1|  325|Homo sapiens mitochondrial uncouplin...    38   0.027
AF078544-1|AAD04346.1|  325|Homo sapiens brain mitochondrial car...    38   0.027
BC001656-1|AAH01656.1|  482|Homo sapiens SLC25A23 protein protein.     38   0.048
AY750170-1|AAU95077.1|  468|Homo sapiens mitochondrial Ca2+-depe...    38   0.048
AK092094-1|BAC03803.1|  138|Homo sapiens protein ( Homo sapiens ...    38   0.048
AK054901-1|BAB70825.1|  384|Homo sapiens protein ( Homo sapiens ...    38   0.048
AJ619988-1|CAF04494.1|  468|Homo sapiens small calcium-binding m...    38   0.048
AJ619962-1|CAF04059.1|  468|Homo sapiens mitochondrial ATP-Mg/Pi...    38   0.048
AJ512835-1|CAD55563.1|  438|Homo sapiens putative calcium bindin...    38   0.048
U84763-1|AAC51367.1|  312|Homo sapiens UCP3 protein.                   36   0.19 
U82818-1|AAC51356.1|  275|Homo sapiens UCP3S protein.                  36   0.19 
AF050113-1|AAG02284.1|  312|Homo sapiens uncoupling protein-3 pr...    36   0.19 
AF026958-1|AAC18822.1|  312|Homo sapiens uncoupling protein 3 pr...    36   0.19 
AF012202-1|AAC51785.1|  300|Homo sapiens uncoupling protein 3 pr...    36   0.19 
AF011449-1|AAC51767.1|  312|Homo sapiens uncoupling protein-3 pr...    36   0.19 
AF001787-1|AAC51369.1|  312|Homo sapiens uncoupling protein 3 pr...    36   0.19 
CR456578-1|CAG30464.1|  315|Homo sapiens SLC25A18 protein.             35   0.34 
BC071871-1|AAH71871.1|  341|Homo sapiens solute carrier family 2...    35   0.34 
BC031644-1|AAH31644.1|  315|Homo sapiens SLC25A18 protein protein.     35   0.34 
BC019584-1|AAH19584.1|  341|Homo sapiens solute carrier family 2...    35   0.34 
AY008285-1|AAG22855.1|  315|Homo sapiens solute carrier protein.       35   0.34 
AK094254-1|BAC04318.1|  289|Homo sapiens protein ( Homo sapiens ...    35   0.34 
AJ428203-1|CAD21008.1|  315|Homo sapiens glutamate carrier protein.    35   0.34 
Y17775-1|CAB55356.1|  301|Homo sapiens carnitine/acylcarnitine t...    34   0.59 
Y10319-1|CAA71367.1|  301|Homo sapiens carnitine carrier protein.      34   0.59 
BC031671-1|AAH31671.1|  251|Homo sapiens SLC25A41 protein protein.     34   0.59 
BC001689-1|AAH01689.1|  301|Homo sapiens solute carrier family 2...    34   0.59 
AK097761-1|BAC05163.1|  232|Homo sapiens protein ( Homo sapiens ...    34   0.59 
BC105995-1|AAI05996.1|  300|Homo sapiens SLC25A35 protein protein.     33   0.78 
BC101330-1|AAI01331.1|  291|Homo sapiens SLC25A35 protein protein.     33   0.78 
BC101329-1|AAI01330.2|  295|Homo sapiens SLC25A35 protein protein.     33   0.78 
BC005120-1|AAH05120.1|  320|Homo sapiens solute carrier family 2...    33   0.78 
BC001075-1|AAH01075.1|  320|Homo sapiens solute carrier family 2...    33   0.78 
AY498866-1|AAR92153.1|  287|Homo sapiens unknown protein protein.      33   0.78 
AY346372-1|AAQ54327.1|  263|Homo sapiens solute carrier family 2...    33   0.78 
AK097536-1|BAC05091.1|  295|Homo sapiens protein ( Homo sapiens ...    33   0.78 
AK075239-1|BAC11492.1|  320|Homo sapiens protein ( Homo sapiens ...    33   0.78 
AJ301616-1|CAC37793.1|  320|Homo sapiens deoxynucleotide carrier...    33   0.78 
AJ251857-1|CAC27560.1|  320|Homo sapiens thiamine pyrophosphate ...    33   0.78 
AF182404-1|AAG16903.1|  320|Homo sapiens mitochondrial uncouplin...    33   0.78 
Z98048-2|CAI20491.1|  307|Homo sapiens solute carrier family 25 ...    33   1.4  
Y12860-1|CAA73367.1|  307|Homo sapiens peroxisomal integral memb...    33   1.4  
CR456577-1|CAG30463.1|  307|Homo sapiens SLC25A17 protein.             33   1.4  
BC012998-1|AAH12998.1|  307|Homo sapiens solute carrier family 2...    33   1.4  
BC005957-1|AAH05957.1|  307|Homo sapiens solute carrier family 2...    33   1.4  
AL049764-1|CAI20333.1|  307|Homo sapiens solute carrier family 2...    33   1.4  
X96924-1|CAA65633.1|  318|Homo sapiens mitochondrial citrate tra...    32   2.4  
U25147-1|AAB08515.1|  311|Homo sapiens citrate transporter prote...    32   2.4  
L76134-1|AAL40091.1|  311|Homo sapiens citrate transport protein...    32   2.4  
L75823-1|AAL40090.1|  311|Homo sapiens citrate transport protein...    32   2.4  
BC113365-1|AAI13366.1|  299|Homo sapiens solute carrier family 2...    32   2.4  
BC101521-1|AAI01522.1|  299|Homo sapiens solute carrier family 2...    32   2.4  
BC008061-1|AAH08061.1|  311|Homo sapiens solute carrier family 2...    32   2.4  
BC004980-1|AAH04980.1|  311|Homo sapiens solute carrier family 2...    32   2.4  
AJ278148-1|CAC27562.1|  299|Homo sapiens oxodicarboxylate carrie...    32   2.4  
AC002540-1|AAB70112.1|  238|Homo sapiens unknown protein.              32   2.4  
AB058756-1|BAB47482.1|  708|Homo sapiens KIAA1853 protein protein.     31   3.1  
X77337-1|CAB56611.1|  362|Homo sapiens phosphate carrier protein.      31   4.1  
M74089-1|AAA03587.1|  434|Homo sapiens TB1 protein.                    31   4.1  
BC017169-1|AAH17169.1|  418|Homo sapiens solute carrier family 2...    31   4.1  
AK172788-1|BAD18767.1|  303|Homo sapiens protein ( Homo sapiens ...    31   4.1  
X77337-2|CAB56612.1|  361|Homo sapiens phosphate carrier protein.      31   5.5  
X60036-1|CAA42641.1|  361|Homo sapiens phosphate carrier protein...    31   5.5  
BC051367-1|AAH51367.2|  361|Homo sapiens solute carrier family 2...    31   5.5  
BC015379-1|AAH15379.2|  360|Homo sapiens SLC25A3 protein protein.      31   5.5  
BC014019-1|AAH14019.1|  361|Homo sapiens solute carrier family 2...    31   5.5  
BC011641-1|AAH11641.1|  361|Homo sapiens solute carrier family 2...    31   5.5  
BC011574-1|AAH11574.1|  361|Homo sapiens solute carrier family 2...    31   5.5  
BC006455-1|AAH06455.1|  361|Homo sapiens solute carrier family 2...    31   5.5  
BC004345-1|AAH04345.1|  361|Homo sapiens solute carrier family 2...    31   5.5  
BC003504-1|AAH03504.1|  361|Homo sapiens solute carrier family 2...    31   5.5  
BC001328-1|AAH01328.1|  361|Homo sapiens solute carrier family 2...    31   5.5  
BC000998-1|AAH00998.1|  361|Homo sapiens solute carrier family 2...    31   5.5  
AY261384-1|AAO84265.1|  370|Homo sapiens lysosome-associated tra...    31   5.5  
AY219177-1|AAO64359.1|  124|Homo sapiens lysosome-associated pro...    31   5.5  
AY219176-1|AAO64358.1|  124|Homo sapiens lysosome-associated pro...    31   5.5  
AY198226-1|AAO63563.1|  124|Homo sapiens LAPTM4B protein.              31   5.5  
AY057051-1|AAL17908.2|  317|Homo sapiens lysosomal associated tr...    31   5.5  
AK222658-1|BAD96378.1|  361|Homo sapiens solute carrier family 2...    31   5.5  
AK074759-1|BAC11187.1|  361|Homo sapiens protein ( Homo sapiens ...    31   5.5  
AF527412-1|AAP14034.1|  317|Homo sapiens lysosomal associated tr...    31   5.5  
AB064666-1|BAB93517.1|  361|Homo sapiens OK/SW-CL.48 protein.          31   5.5  
U70824-1|AAC24726.1|  440|Homo sapiens BLu protein protein.            30   7.3  
BC132966-1|AAI32967.1|  237|Homo sapiens SLC25A29 protein protein.     30   7.3  
BC132964-1|AAI32965.1|  237|Homo sapiens SLC25A29 protein protein.     30   7.3  
BC033732-1|AAH33732.1|  440|Homo sapiens zinc finger, MYND-type ...    30   7.3  
BC021893-1|AAH21893.1|  315|Homo sapiens solute carrier family 2...    30   7.3  
AL833828-1|CAD38688.1|  440|Homo sapiens hypothetical protein pr...    30   7.3  
AK223343-1|BAD97063.1|  440|Homo sapiens zinc finger, MYND domai...    30   7.3  
AK096294-1|BAC04751.1|  237|Homo sapiens protein ( Homo sapiens ...    30   7.3  
AK027787-1|BAB55368.1|  315|Homo sapiens protein ( Homo sapiens ...    30   7.3  
AK027531-1|BAB55180.1|  315|Homo sapiens protein ( Homo sapiens ...    30   7.3  
AF283645-1|AAG37834.1|  315|Homo sapiens folate transporter/carr...    30   7.3  
U53209-1|AAC50658.1|  282|Homo sapiens transformer-2 alpha protein.    30   9.6  
BC117184-1|AAI17185.1| 1388|Homo sapiens retrotransposon gag dom...    30   9.6  
BC113670-1|AAI13671.1| 1388|Homo sapiens retrotransposon gag dom...    30   9.6  
BC105006-1|AAI05007.1|  312|Homo sapiens PRP38 pre-mRNA processi...    30   9.6  
BC105004-1|AAI05005.1|  312|Homo sapiens PRP38 pre-mRNA processi...    30   9.6  
BC063655-1|AAH63655.1|  125|Homo sapiens PRP38 pre-mRNA processi...    30   9.6  
BC041100-1|AAH41100.1|  335|Homo sapiens SLC25A45 protein protein.     30   9.6  
BC036869-1|AAH36869.1|  246|Homo sapiens solute carrier family 2...    30   9.6  
BC027998-1|AAH27998.1|  304|Homo sapiens solute carrier family 2...    30   9.6  
BC017094-1|AAH17094.1|  282|Homo sapiens transformer-2 alpha pro...    30   9.6  
BC000777-1|AAH00777.2|  125|Homo sapiens PRP38 pre-mRNA processi...    30   9.6  
AY121804-1|AAM82752.1| 1388|Homo sapiens BJ-HCC-23 tumor antigen...    30   9.6  
AL513218-9|CAI12289.1|  312|Homo sapiens PRP38 pre-mRNA processi...    30   9.6  
AL450998-1|CAH70849.1|  304|Homo sapiens solute carrier family 2...    30   9.6  
AK092038-1|BAC03796.1|  312|Homo sapiens protein ( Homo sapiens ...    30   9.6  
AK027842-1|BAB55405.1|  236|Homo sapiens protein ( Homo sapiens ...    30   9.6  
AC023105-1|AAQ96870.1|  282|Homo sapiens unknown protein.              30   9.6  
AB097048-1|BAC77401.1|  282|Homo sapiens putative MAPK activatin...    30   9.6  
AB037739-1|BAA92556.1| 1418|Homo sapiens KIAA1318 protein protein.     30   9.6  

>M57424-1|AAA51737.1|  298|Homo sapiens adenine nucleotide
           translocator-2 protein.
          Length = 298

 Score =  149 bits (362), Expect = 7e-36
 Identities = 68/91 (74%), Positives = 72/91 (79%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G LSFWRGN ANVIRYFPTQALNFAFKDKYKQ+FLGGVDK+TQFWRYF        
Sbjct: 62  PKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGG 121

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
               TSLCFVYPLDFARTRLAADVGK   +R
Sbjct: 122 AAGATSLCFVYPLDFARTRLAADVGKAGAER 152



 Score =  108 bits (259), Expect = 2e-23
 Identities = 50/62 (80%), Positives = 58/62 (93%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           V+FAKDFLAGG++AA+SKTAVAPIERVKLLLQVQH SKQI AD++YKGI+D  VRIPKEQ
Sbjct: 6   VSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQ 65

Query: 249 GL 254
           G+
Sbjct: 66  GV 67



 Score = 64.5 bits (150), Expect = 4e-10
 Identities = 29/40 (72%), Positives = 31/40 (77%)
 Frame = +3

Query: 573 QRFRCVRASIIIYRASYFGFYDTARGMLPDPKNTPIVISW 692
           Q F      IIIYRA+YFG YDTA+GMLPDPKNT IVISW
Sbjct: 175 QGFNVSVQGIIIYRAAYFGIYDTAKGMLPDPKNTHIVISW 214



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 16/24 (66%), Positives = 21/24 (87%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           F GLG+C+ KI+KSDG+ GLY+GF
Sbjct: 154 FRGLGDCLVKIYKSDGIKGLYQGF 177


>L78810-1|AAB39266.1|  298|Homo sapiens ANT-2 protein.
          Length = 298

 Score =  149 bits (362), Expect = 7e-36
 Identities = 68/91 (74%), Positives = 72/91 (79%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G LSFWRGN ANVIRYFPTQALNFAFKDKYKQ+FLGGVDK+TQFWRYF        
Sbjct: 62  PKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGG 121

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
               TSLCFVYPLDFARTRLAADVGK   +R
Sbjct: 122 AAGATSLCFVYPLDFARTRLAADVGKAGAER 152



 Score =  108 bits (259), Expect = 2e-23
 Identities = 50/62 (80%), Positives = 58/62 (93%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           V+FAKDFLAGG++AA+SKTAVAPIERVKLLLQVQH SKQI AD++YKGI+D  VRIPKEQ
Sbjct: 6   VSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQ 65

Query: 249 GL 254
           G+
Sbjct: 66  GV 67



 Score = 64.5 bits (150), Expect = 4e-10
 Identities = 29/40 (72%), Positives = 31/40 (77%)
 Frame = +3

Query: 573 QRFRCVRASIIIYRASYFGFYDTARGMLPDPKNTPIVISW 692
           Q F      IIIYRA+YFG YDTA+GMLPDPKNT IVISW
Sbjct: 175 QGFNVSVQGIIIYRAAYFGIYDTAKGMLPDPKNTHIVISW 214



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 16/24 (66%), Positives = 21/24 (87%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           F GLG+C+ KI+KSDG+ GLY+GF
Sbjct: 154 FRGLGDCLVKIYKSDGIKGLYQGF 177


>BC056160-1|AAH56160.1|  298|Homo sapiens solute carrier family 25
           (mitochondrial carrier; adenine nucleotide translocato
           protein.
          Length = 298

 Score =  149 bits (362), Expect = 7e-36
 Identities = 68/91 (74%), Positives = 72/91 (79%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G LSFWRGN ANVIRYFPTQALNFAFKDKYKQ+FLGGVDK+TQFWRYF        
Sbjct: 62  PKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGG 121

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
               TSLCFVYPLDFARTRLAADVGK   +R
Sbjct: 122 AAGATSLCFVYPLDFARTRLAADVGKAGAER 152



 Score =  108 bits (259), Expect = 2e-23
 Identities = 50/62 (80%), Positives = 58/62 (93%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           V+FAKDFLAGG++AA+SKTAVAPIERVKLLLQVQH SKQI AD++YKGI+D  VRIPKEQ
Sbjct: 6   VSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQ 65

Query: 249 GL 254
           G+
Sbjct: 66  GV 67



 Score = 64.5 bits (150), Expect = 4e-10
 Identities = 29/40 (72%), Positives = 31/40 (77%)
 Frame = +3

Query: 573 QRFRCVRASIIIYRASYFGFYDTARGMLPDPKNTPIVISW 692
           Q F      IIIYRA+YFG YDTA+GMLPDPKNT IVISW
Sbjct: 175 QGFNVSVQGIIIYRAAYFGIYDTAKGMLPDPKNTHIVISW 214



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 16/24 (66%), Positives = 21/24 (87%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           F GLG+C+ KI+KSDG+ GLY+GF
Sbjct: 154 FRGLGDCLVKIYKSDGIKGLYQGF 177


>CR457400-1|CAG33681.1|  298|Homo sapiens SLC25A6 protein.
          Length = 298

 Score =  147 bits (357), Expect = 3e-35
 Identities = 68/91 (74%), Positives = 71/91 (78%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G LSFWRGN ANVIRYFPTQALNFAFKDKYKQ+FLGGVDK TQFWRYF        
Sbjct: 62  PKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWRYFAGNLASGG 121

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
               TSLCFVYPLDFARTRLAADVGK   +R
Sbjct: 122 AAGATSLCFVYPLDFARTRLAADVGKSGTER 152



 Score =  110 bits (265), Expect = 4e-24
 Identities = 52/62 (83%), Positives = 59/62 (95%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           ++FAKDFLAGGI+AA+SKTAVAPIERVKLLLQVQH SKQIAAD++YKGIVD  VRIPKEQ
Sbjct: 6   ISFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPKEQ 65

Query: 249 GL 254
           G+
Sbjct: 66  GV 67



 Score = 63.3 bits (147), Expect = 8e-10
 Identities = 28/40 (70%), Positives = 31/40 (77%)
 Frame = +3

Query: 573 QRFRCVRASIIIYRASYFGFYDTARGMLPDPKNTPIVISW 692
           Q F      IIIYRA+YFG YDTA+GMLPDPKNT IV+SW
Sbjct: 175 QGFSVSVQGIIIYRAAYFGVYDTAKGMLPDPKNTHIVVSW 214



 Score = 39.5 bits (88), Expect = 0.012
 Identities = 16/24 (66%), Positives = 20/24 (83%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           F GLG+C+ KI KSDG+ GLY+GF
Sbjct: 154 FRGLGDCLVKITKSDGIRGLYQGF 177


>BC031912-1|AAH31912.1|  298|Homo sapiens solute carrier family 25
           (mitochondrial carrier; adenine nucleotide translocato
           protein.
          Length = 298

 Score =  147 bits (357), Expect = 3e-35
 Identities = 68/91 (74%), Positives = 71/91 (78%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G LSFWRGN ANVIRYFPTQALNFAFKDKYKQ+FLGGVDK TQFWRYF        
Sbjct: 62  PKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWRYFAGNLASGG 121

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
               TSLCFVYPLDFARTRLAADVGK   +R
Sbjct: 122 AAGATSLCFVYPLDFARTRLAADVGKSGTER 152



 Score =  110 bits (265), Expect = 4e-24
 Identities = 52/62 (83%), Positives = 59/62 (95%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           ++FAKDFLAGGI+AA+SKTAVAPIERVKLLLQVQH SKQIAAD++YKGIVD  VRIPKEQ
Sbjct: 6   ISFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPKEQ 65

Query: 249 GL 254
           G+
Sbjct: 66  GV 67



 Score = 63.3 bits (147), Expect = 8e-10
 Identities = 28/40 (70%), Positives = 31/40 (77%)
 Frame = +3

Query: 573 QRFRCVRASIIIYRASYFGFYDTARGMLPDPKNTPIVISW 692
           Q F      IIIYRA+YFG YDTA+GMLPDPKNT IV+SW
Sbjct: 175 QGFSVSVQGIIIYRAAYFGVYDTAKGMLPDPKNTHIVVSW 214



 Score = 39.5 bits (88), Expect = 0.012
 Identities = 16/24 (66%), Positives = 20/24 (83%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           F GLG+C+ KI KSDG+ GLY+GF
Sbjct: 154 FRGLGDCLVKITKSDGIRGLYQGF 177


>BC014775-1|AAH14775.1|  298|Homo sapiens solute carrier family 25
           (mitochondrial carrier; adenine nucleotide translocato
           protein.
          Length = 298

 Score =  147 bits (357), Expect = 3e-35
 Identities = 68/91 (74%), Positives = 71/91 (78%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G LSFWRGN ANVIRYFPTQALNFAFKDKYKQ+FLGGVDK TQFWRYF        
Sbjct: 62  PKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWRYFAGNLASGG 121

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
               TSLCFVYPLDFARTRLAADVGK   +R
Sbjct: 122 AAGATSLCFVYPLDFARTRLAADVGKSGTER 152



 Score =  110 bits (265), Expect = 4e-24
 Identities = 52/62 (83%), Positives = 59/62 (95%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           ++FAKDFLAGGI+AA+SKTAVAPIERVKLLLQVQH SKQIAAD++YKGIVD  VRIPKEQ
Sbjct: 6   ISFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPKEQ 65

Query: 249 GL 254
           G+
Sbjct: 66  GV 67



 Score = 63.3 bits (147), Expect = 8e-10
 Identities = 28/40 (70%), Positives = 31/40 (77%)
 Frame = +3

Query: 573 QRFRCVRASIIIYRASYFGFYDTARGMLPDPKNTPIVISW 692
           Q F      IIIYRA+YFG YDTA+GMLPDPKNT IV+SW
Sbjct: 175 QGFSVSVQGIIIYRAAYFGVYDTAKGMLPDPKNTHIVVSW 214



 Score = 39.5 bits (88), Expect = 0.012
 Identities = 16/24 (66%), Positives = 20/24 (83%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           F GLG+C+ KI KSDG+ GLY+GF
Sbjct: 154 FRGLGDCLVKITKSDGIRGLYQGF 177


>BC008935-1|AAH08935.1|  298|Homo sapiens solute carrier family 25
           (mitochondrial carrier; adenine nucleotide translocato
           protein.
          Length = 298

 Score =  147 bits (357), Expect = 3e-35
 Identities = 68/91 (74%), Positives = 71/91 (78%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G LSFWRGN ANVIRYFPTQALNFAFKDKYKQ+FLGGVDK TQFWRYF        
Sbjct: 62  PKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWRYFAGNLASGG 121

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
               TSLCFVYPLDFARTRLAADVGK   +R
Sbjct: 122 AAGATSLCFVYPLDFARTRLAADVGKSGTER 152



 Score =  110 bits (265), Expect = 4e-24
 Identities = 52/62 (83%), Positives = 59/62 (95%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           ++FAKDFLAGGI+AA+SKTAVAPIERVKLLLQVQH SKQIAAD++YKGIVD  VRIPKEQ
Sbjct: 6   ISFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPKEQ 65

Query: 249 GL 254
           G+
Sbjct: 66  GV 67



 Score = 63.3 bits (147), Expect = 8e-10
 Identities = 28/40 (70%), Positives = 31/40 (77%)
 Frame = +3

Query: 573 QRFRCVRASIIIYRASYFGFYDTARGMLPDPKNTPIVISW 692
           Q F      IIIYRA+YFG YDTA+GMLPDPKNT IV+SW
Sbjct: 175 QGFSVSVQGIIIYRAAYFGVYDTAKGMLPDPKNTHIVVSW 214



 Score = 39.5 bits (88), Expect = 0.012
 Identities = 16/24 (66%), Positives = 20/24 (83%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           F GLG+C+ KI KSDG+ GLY+GF
Sbjct: 154 FRGLGDCLVKITKSDGIRGLYQGF 177


>BC008737-1|AAH08737.1|  298|Homo sapiens solute carrier family 25
           (mitochondrial carrier; adenine nucleotide translocato
           protein.
          Length = 298

 Score =  147 bits (357), Expect = 3e-35
 Identities = 68/91 (74%), Positives = 71/91 (78%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G LSFWRGN ANVIRYFPTQALNFAFKDKYKQ+FLGGVDK TQFWRYF        
Sbjct: 62  PKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWRYFAGNLASGG 121

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
               TSLCFVYPLDFARTRLAADVGK   +R
Sbjct: 122 AAGATSLCFVYPLDFARTRLAADVGKSGTER 152



 Score =  110 bits (265), Expect = 4e-24
 Identities = 52/62 (83%), Positives = 59/62 (95%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           ++FAKDFLAGGI+AA+SKTAVAPIERVKLLLQVQH SKQIAAD++YKGIVD  VRIPKEQ
Sbjct: 6   ISFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPKEQ 65

Query: 249 GL 254
           G+
Sbjct: 66  GV 67



 Score = 63.3 bits (147), Expect = 8e-10
 Identities = 28/40 (70%), Positives = 31/40 (77%)
 Frame = +3

Query: 573 QRFRCVRASIIIYRASYFGFYDTARGMLPDPKNTPIVISW 692
           Q F      IIIYRA+YFG YDTA+GMLPDPKNT IV+SW
Sbjct: 175 QGFSVSVQGIIIYRAAYFGVYDTAKGMLPDPKNTHIVVSW 214



 Score = 39.5 bits (88), Expect = 0.012
 Identities = 16/24 (66%), Positives = 20/24 (83%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           F GLG+C+ KI KSDG+ GLY+GF
Sbjct: 154 FRGLGDCLVKITKSDGIRGLYQGF 177


>BC007850-1|AAH07850.1|  298|Homo sapiens solute carrier family 25
           (mitochondrial carrier; adenine nucleotide translocato
           protein.
          Length = 298

 Score =  147 bits (357), Expect = 3e-35
 Identities = 68/91 (74%), Positives = 71/91 (78%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G LSFWRGN ANVIRYFPTQALNFAFKDKYKQ+FLGGVDK TQFWRYF        
Sbjct: 62  PKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWRYFAGNLASGG 121

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
               TSLCFVYPLDFARTRLAADVGK   +R
Sbjct: 122 AAGATSLCFVYPLDFARTRLAADVGKSGTER 152



 Score =  110 bits (265), Expect = 4e-24
 Identities = 52/62 (83%), Positives = 59/62 (95%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           ++FAKDFLAGGI+AA+SKTAVAPIERVKLLLQVQH SKQIAAD++YKGIVD  VRIPKEQ
Sbjct: 6   ISFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPKEQ 65

Query: 249 GL 254
           G+
Sbjct: 66  GV 67



 Score = 63.3 bits (147), Expect = 8e-10
 Identities = 28/40 (70%), Positives = 31/40 (77%)
 Frame = +3

Query: 573 QRFRCVRASIIIYRASYFGFYDTARGMLPDPKNTPIVISW 692
           Q F      IIIYRA+YFG YDTA+GMLPDPKNT IV+SW
Sbjct: 175 QGFSVSVQGIIIYRAAYFGVYDTAKGMLPDPKNTHIVVSW 214



 Score = 39.5 bits (88), Expect = 0.012
 Identities = 16/24 (66%), Positives = 20/24 (83%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           F GLG+C+ KI KSDG+ GLY+GF
Sbjct: 154 FRGLGDCLVKITKSDGIRGLYQGF 177


>BC007295-1|AAH07295.1|  298|Homo sapiens solute carrier family 25
           (mitochondrial carrier; adenine nucleotide translocato
           protein.
          Length = 298

 Score =  147 bits (357), Expect = 3e-35
 Identities = 68/91 (74%), Positives = 71/91 (78%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G LSFWRGN ANVIRYFPTQALNFAFKDKYKQ+FLGGVDK TQFWRYF        
Sbjct: 62  PKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWRYFAGNLASGG 121

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
               TSLCFVYPLDFARTRLAADVGK   +R
Sbjct: 122 AAGATSLCFVYPLDFARTRLAADVGKSGTER 152



 Score =  110 bits (265), Expect = 4e-24
 Identities = 52/62 (83%), Positives = 59/62 (95%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           ++FAKDFLAGGI+AA+SKTAVAPIERVKLLLQVQH SKQIAAD++YKGIVD  VRIPKEQ
Sbjct: 6   ISFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPKEQ 65

Query: 249 GL 254
           G+
Sbjct: 66  GV 67



 Score = 63.3 bits (147), Expect = 8e-10
 Identities = 28/40 (70%), Positives = 31/40 (77%)
 Frame = +3

Query: 573 QRFRCVRASIIIYRASYFGFYDTARGMLPDPKNTPIVISW 692
           Q F      IIIYRA+YFG YDTA+GMLPDPKNT IV+SW
Sbjct: 175 QGFSVSVQGIIIYRAAYFGVYDTAKGMLPDPKNTHIVVSW 214



 Score = 39.5 bits (88), Expect = 0.012
 Identities = 16/24 (66%), Positives = 20/24 (83%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           F GLG+C+ KI KSDG+ GLY+GF
Sbjct: 154 FRGLGDCLVKITKSDGIRGLYQGF 177


>AY007135-1|AAG01998.1|  298|Homo sapiens protein ( Homo sapiens
           clone CDABP0051 mRNA sequence. ).
          Length = 298

 Score =  147 bits (357), Expect = 3e-35
 Identities = 68/91 (74%), Positives = 71/91 (78%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G LSFWRGN ANVIRYFPTQALNFAFKDKYKQ+FLGGVDK TQFWRYF        
Sbjct: 62  PKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWRYFAGNLASGG 121

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
               TSLCFVYPLDFARTRLAADVGK   +R
Sbjct: 122 AAGATSLCFVYPLDFARTRLAADVGKSGTER 152



 Score =  110 bits (265), Expect = 4e-24
 Identities = 52/62 (83%), Positives = 59/62 (95%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           ++FAKDFLAGGI+AA+SKTAVAPIERVKLLLQVQH SKQIAAD++YKGIVD  VRIPKEQ
Sbjct: 6   ISFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPKEQ 65

Query: 249 GL 254
           G+
Sbjct: 66  GV 67



 Score = 63.3 bits (147), Expect = 8e-10
 Identities = 28/40 (70%), Positives = 31/40 (77%)
 Frame = +3

Query: 573 QRFRCVRASIIIYRASYFGFYDTARGMLPDPKNTPIVISW 692
           Q F      IIIYRA+YFG YDTA+GMLPDPKNT IV+SW
Sbjct: 175 QGFSVSVQGIIIYRAAYFGVYDTAKGMLPDPKNTHIVVSW 214



 Score = 39.5 bits (88), Expect = 0.012
 Identities = 16/24 (66%), Positives = 20/24 (83%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           F GLG+C+ KI KSDG+ GLY+GF
Sbjct: 154 FRGLGDCLVKITKSDGIRGLYQGF 177


>AL683870-2|CAI39844.1|  158|Homo sapiens solute carrier family 25
           (mitochondrial carrier; adenine nucleotide translocato
           protein.
          Length = 158

 Score =  147 bits (357), Expect = 3e-35
 Identities = 68/91 (74%), Positives = 71/91 (78%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G LSFWRGN ANVIRYFPTQALNFAFKDKYKQ+FLGGVDK TQFWRYF        
Sbjct: 62  PKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWRYFAGNLASGG 121

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
               TSLCFVYPLDFARTRLAADVGK   +R
Sbjct: 122 AAGATSLCFVYPLDFARTRLAADVGKSGTER 152



 Score =  110 bits (265), Expect = 4e-24
 Identities = 52/62 (83%), Positives = 59/62 (95%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           ++FAKDFLAGGI+AA+SKTAVAPIERVKLLLQVQH SKQIAAD++YKGIVD  VRIPKEQ
Sbjct: 6   ISFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPKEQ 65

Query: 249 GL 254
           G+
Sbjct: 66  GV 67


>AL683870-1|CAI39843.1|  298|Homo sapiens solute carrier family 25
           (mitochondrial carrier; adenine nucleotide translocato
           protein.
          Length = 298

 Score =  147 bits (357), Expect = 3e-35
 Identities = 68/91 (74%), Positives = 71/91 (78%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G LSFWRGN ANVIRYFPTQALNFAFKDKYKQ+FLGGVDK TQFWRYF        
Sbjct: 62  PKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWRYFAGNLASGG 121

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
               TSLCFVYPLDFARTRLAADVGK   +R
Sbjct: 122 AAGATSLCFVYPLDFARTRLAADVGKSGTER 152



 Score =  110 bits (265), Expect = 4e-24
 Identities = 52/62 (83%), Positives = 59/62 (95%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           ++FAKDFLAGGI+AA+SKTAVAPIERVKLLLQVQH SKQIAAD++YKGIVD  VRIPKEQ
Sbjct: 6   ISFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPKEQ 65

Query: 249 GL 254
           G+
Sbjct: 66  GV 67



 Score = 63.3 bits (147), Expect = 8e-10
 Identities = 28/40 (70%), Positives = 31/40 (77%)
 Frame = +3

Query: 573 QRFRCVRASIIIYRASYFGFYDTARGMLPDPKNTPIVISW 692
           Q F      IIIYRA+YFG YDTA+GMLPDPKNT IV+SW
Sbjct: 175 QGFSVSVQGIIIYRAAYFGVYDTAKGMLPDPKNTHIVVSW 214



 Score = 39.5 bits (88), Expect = 0.012
 Identities = 16/24 (66%), Positives = 20/24 (83%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           F GLG+C+ KI KSDG+ GLY+GF
Sbjct: 154 FRGLGDCLVKITKSDGIRGLYQGF 177


>AB209822-1|BAD93059.1|  323|Homo sapiens ADP,ATP carrier protein,
           liver isoform T2 variant protein.
          Length = 323

 Score =  147 bits (357), Expect = 3e-35
 Identities = 68/91 (74%), Positives = 71/91 (78%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G LSFWRGN ANVIRYFPTQALNFAFKDKYKQ+FLGGVDK TQFWRYF        
Sbjct: 87  PKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWRYFAGNLASGG 146

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
               TSLCFVYPLDFARTRLAADVGK   +R
Sbjct: 147 AAGATSLCFVYPLDFARTRLAADVGKSGTER 177



 Score =  110 bits (265), Expect = 4e-24
 Identities = 52/62 (83%), Positives = 59/62 (95%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           ++FAKDFLAGGI+AA+SKTAVAPIERVKLLLQVQH SKQIAAD++YKGIVD  VRIPKEQ
Sbjct: 31  ISFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPKEQ 90

Query: 249 GL 254
           G+
Sbjct: 91  GV 92



 Score = 63.3 bits (147), Expect = 8e-10
 Identities = 28/40 (70%), Positives = 31/40 (77%)
 Frame = +3

Query: 573 QRFRCVRASIIIYRASYFGFYDTARGMLPDPKNTPIVISW 692
           Q F      IIIYRA+YFG YDTA+GMLPDPKNT IV+SW
Sbjct: 200 QGFSVSVQGIIIYRAAYFGVYDTAKGMLPDPKNTHIVVSW 239



 Score = 39.5 bits (88), Expect = 0.012
 Identities = 16/24 (66%), Positives = 20/24 (83%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           F GLG+C+ KI KSDG+ GLY+GF
Sbjct: 179 FRGLGDCLVKITKSDGIRGLYQGF 202


>J04982-1|AAA51736.1|  298|Homo sapiens ANT1 protein.
          Length = 298

 Score =  147 bits (356), Expect = 4e-35
 Identities = 68/91 (74%), Positives = 71/91 (78%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G LSFWRGN ANVIRYFPTQALNFAFKDKYKQ+FLGGVD+  QFWRYF        
Sbjct: 62  PKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLASGG 121

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
               TSLCFVYPLDFARTRLAADVGKG  QR
Sbjct: 122 AAGATSLCFVYPLDFARTRLAADVGKGAAQR 152



 Score =  103 bits (247), Expect = 6e-22
 Identities = 48/60 (80%), Positives = 56/60 (93%)
 Frame = +3

Query: 72  AFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           +F KDFLAGG++AAVSKTAVAPIERVKLLLQVQH SKQI+A+++YKGI+D  VRIPKEQG
Sbjct: 7   SFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQG 66



 Score = 59.7 bits (138), Expect = 1e-08
 Identities = 26/40 (65%), Positives = 29/40 (72%)
 Frame = +3

Query: 573 QRFRCVRASIIIYRASYFGFYDTARGMLPDPKNTPIVISW 692
           Q F      IIIYRA+YFG YDTA+GMLPDPKN  I +SW
Sbjct: 175 QGFNVSVQGIIIYRAAYFGVYDTAKGMLPDPKNVHIFVSW 214



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 19/24 (79%), Positives = 21/24 (87%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           F GLG+CI KIFKSDGL GLY+GF
Sbjct: 154 FHGLGDCIIKIFKSDGLRGLYQGF 177


>BC063643-1|AAH63643.1|  298|Homo sapiens solute carrier family 25
           (mitochondrial carrier; adenine nucleotide translocato
           protein.
          Length = 298

 Score =  147 bits (356), Expect = 4e-35
 Identities = 68/91 (74%), Positives = 71/91 (78%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G LSFWRGN ANVIRYFPTQALNFAFKDKYKQ+FLGGVD+  QFWRYF        
Sbjct: 62  PKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLASGG 121

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
               TSLCFVYPLDFARTRLAADVGKG  QR
Sbjct: 122 AAGATSLCFVYPLDFARTRLAADVGKGAAQR 152



 Score =  103 bits (247), Expect = 6e-22
 Identities = 48/60 (80%), Positives = 56/60 (93%)
 Frame = +3

Query: 72  AFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           +F KDFLAGG++AAVSKTAVAPIERVKLLLQVQH SKQI+A+++YKGI+D  VRIPKEQG
Sbjct: 7   SFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQG 66



 Score = 59.7 bits (138), Expect = 1e-08
 Identities = 26/40 (65%), Positives = 29/40 (72%)
 Frame = +3

Query: 573 QRFRCVRASIIIYRASYFGFYDTARGMLPDPKNTPIVISW 692
           Q F      IIIYRA+YFG YDTA+GMLPDPKN  I +SW
Sbjct: 175 QGFNVSVQGIIIYRAAYFGVYDTAKGMLPDPKNVHIFVSW 214



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 19/24 (79%), Positives = 21/24 (87%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           F GLG+CI KIFKSDGL GLY+GF
Sbjct: 154 FHGLGDCIIKIFKSDGLRGLYQGF 177


>BC061589-1|AAH61589.1|  298|Homo sapiens solute carrier family 25
           (mitochondrial carrier; adenine nucleotide translocato
           protein.
          Length = 298

 Score =  147 bits (356), Expect = 4e-35
 Identities = 68/91 (74%), Positives = 71/91 (78%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G LSFWRGN ANVIRYFPTQALNFAFKDKYKQ+FLGGVD+  QFWRYF        
Sbjct: 62  PKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLASGG 121

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
               TSLCFVYPLDFARTRLAADVGKG  QR
Sbjct: 122 AAGATSLCFVYPLDFARTRLAADVGKGAAQR 152



 Score =  103 bits (247), Expect = 6e-22
 Identities = 48/60 (80%), Positives = 56/60 (93%)
 Frame = +3

Query: 72  AFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           +F KDFLAGG++AAVSKTAVAPIERVKLLLQVQH SKQI+A+++YKGI+D  VRIPKEQG
Sbjct: 7   SFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQG 66



 Score = 59.7 bits (138), Expect = 1e-08
 Identities = 26/40 (65%), Positives = 29/40 (72%)
 Frame = +3

Query: 573 QRFRCVRASIIIYRASYFGFYDTARGMLPDPKNTPIVISW 692
           Q F      IIIYRA+YFG YDTA+GMLPDPKN  I +SW
Sbjct: 175 QGFNVSVQGIIIYRAAYFGVYDTAKGMLPDPKNVHIFVSW 214



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 19/24 (79%), Positives = 21/24 (87%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           F GLG+CI KIFKSDGL GLY+GF
Sbjct: 154 FHGLGDCIIKIFKSDGLRGLYQGF 177


>BC008664-1|AAH08664.1|  298|Homo sapiens solute carrier family 25
           (mitochondrial carrier; adenine nucleotide translocato
           protein.
          Length = 298

 Score =  147 bits (356), Expect = 4e-35
 Identities = 68/91 (74%), Positives = 71/91 (78%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G LSFWRGN ANVIRYFPTQALNFAFKDKYKQ+FLGGVD+  QFWRYF        
Sbjct: 62  PKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLASGG 121

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
               TSLCFVYPLDFARTRLAADVGKG  QR
Sbjct: 122 AAGATSLCFVYPLDFARTRLAADVGKGAAQR 152



 Score =  103 bits (247), Expect = 6e-22
 Identities = 48/60 (80%), Positives = 56/60 (93%)
 Frame = +3

Query: 72  AFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           +F KDFLAGG++AAVSKTAVAPIERVKLLLQVQH SKQI+A+++YKGI+D  VRIPKEQG
Sbjct: 7   SFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQG 66



 Score = 59.7 bits (138), Expect = 1e-08
 Identities = 26/40 (65%), Positives = 29/40 (72%)
 Frame = +3

Query: 573 QRFRCVRASIIIYRASYFGFYDTARGMLPDPKNTPIVISW 692
           Q F      IIIYRA+YFG YDTA+GMLPDPKN  I +SW
Sbjct: 175 QGFNVSVQGIIIYRAAYFGVYDTAKGMLPDPKNVHIFVSW 214



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 19/24 (79%), Positives = 21/24 (87%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           F GLG+CI KIFKSDGL GLY+GF
Sbjct: 154 FHGLGDCIIKIFKSDGLRGLYQGF 177


>AB209764-1|BAD93001.1|  261|Homo sapiens solute carrier family 25
           member 4 variant protein.
          Length = 261

 Score =  147 bits (356), Expect = 4e-35
 Identities = 68/91 (74%), Positives = 71/91 (78%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G LSFWRGN ANVIRYFPTQALNFAFKDKYKQ+FLGGVD+  QFWRYF        
Sbjct: 95  PKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLASGG 154

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
               TSLCFVYPLDFARTRLAADVGKG  QR
Sbjct: 155 AAGATSLCFVYPLDFARTRLAADVGKGAAQR 185



 Score = 52.8 bits (121), Expect = 1e-06
 Identities = 23/32 (71%), Positives = 28/32 (87%)
 Frame = +3

Query: 156 LLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           L QVQH SKQI+A+++YKGI+D  VRIPKEQG
Sbjct: 68  LHQVQHASKQISAEKQYKGIIDCVVRIPKEQG 99



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 19/24 (79%), Positives = 21/24 (87%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           F GLG+CI KIFKSDGL GLY+GF
Sbjct: 187 FHGLGDCIIKIFKSDGLRGLYQGF 210



 Score = 35.9 bits (79), Expect = 0.15
 Identities = 16/26 (61%), Positives = 18/26 (69%)
 Frame = +3

Query: 573 QRFRCVRASIIIYRASYFGFYDTARG 650
           Q F      IIIYRA+YFG YDTA+G
Sbjct: 208 QGFNVSVQGIIIYRAAYFGVYDTAKG 233


>J03591-1|AAA36749.1|  252|Homo sapiens protein ( Human ADP/ATP
           translocase mRNA, 3' end, clone pHAT3. ).
          Length = 252

 Score =  146 bits (355), Expect = 5e-35
 Identities = 67/91 (73%), Positives = 71/91 (78%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G LSFWRGN ANVIRYFPTQALNFAFKDKYKQ+FLGGVDK+TQFW YF        
Sbjct: 16  PKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWLYFAGNLASGG 75

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
               TSLCFVYPLDFARTRLAADVGK   +R
Sbjct: 76  AAGATSLCFVYPLDFARTRLAADVGKAGAER 106



 Score = 64.5 bits (150), Expect = 4e-10
 Identities = 29/40 (72%), Positives = 31/40 (77%)
 Frame = +3

Query: 573 QRFRCVRASIIIYRASYFGFYDTARGMLPDPKNTPIVISW 692
           Q F      IIIYRA+YFG YDTA+GMLPDPKNT IVISW
Sbjct: 129 QGFNVSVQGIIIYRAAYFGIYDTAKGMLPDPKNTHIVISW 168



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 16/24 (66%), Positives = 21/24 (87%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           F GLG+C+ KI+KSDG+ GLY+GF
Sbjct: 108 FRGLGDCLGKIYKSDGIKGLYQGF 131



 Score = 37.9 bits (84), Expect = 0.036
 Identities = 15/21 (71%), Positives = 19/21 (90%)
 Frame = +3

Query: 192 ADQRYKGIVDAFVRIPKEQGL 254
           AD++YKGI+D  VRIPKEQG+
Sbjct: 1   ADKQYKGIIDCVVRIPKEQGV 21


>BC068199-1|AAH68199.1|  323|Homo sapiens SLC25A5 protein protein.
          Length = 323

 Score =  146 bits (355), Expect = 5e-35
 Identities = 67/91 (73%), Positives = 71/91 (78%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G LSFWRGN ANVIRYFPTQALNFAFKDKYKQ+FLGGVDK+TQFW YF        
Sbjct: 87  PKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWLYFAGNLASGG 146

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
               TSLCFVYPLDFARTRLAADVGK   +R
Sbjct: 147 AAGATSLCFVYPLDFARTRLAADVGKAGAER 177



 Score =  109 bits (261), Expect = 1e-23
 Identities = 52/68 (76%), Positives = 61/68 (89%), Gaps = 1/68 (1%)
 Frame = +3

Query: 54  NLADP-VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFV 230
           N+ D  V+FAKDFLAGG++AA+SKTAVAPIERVKLLLQVQH SKQI AD++YKGI+D  V
Sbjct: 25  NMTDAAVSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVV 84

Query: 231 RIPKEQGL 254
           RIPKEQG+
Sbjct: 85  RIPKEQGV 92



 Score = 64.5 bits (150), Expect = 4e-10
 Identities = 29/40 (72%), Positives = 31/40 (77%)
 Frame = +3

Query: 573 QRFRCVRASIIIYRASYFGFYDTARGMLPDPKNTPIVISW 692
           Q F      IIIYRA+YFG YDTA+GMLPDPKNT IVISW
Sbjct: 200 QGFNVSVQGIIIYRAAYFGIYDTAKGMLPDPKNTHIVISW 239



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 16/24 (66%), Positives = 21/24 (87%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           F GLG+C+ KI+KSDG+ GLY+GF
Sbjct: 179 FRGLGDCLVKIYKSDGIKGLYQGF 202


>AC004000-1|AAB96347.1|  298|Homo sapiens ADP/ATP carrier protein
           (adenine nucleotide translocator 2) protein.
          Length = 298

 Score =  146 bits (355), Expect = 5e-35
 Identities = 67/91 (73%), Positives = 71/91 (78%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G LSFWRGN ANVIRYFPTQALNFAFKDKYKQ+FLGGVDK+TQFW YF        
Sbjct: 62  PKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWLYFAGNLASGG 121

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
               TSLCFVYPLDFARTRLAADVGK   +R
Sbjct: 122 AAGATSLCFVYPLDFARTRLAADVGKAGAER 152



 Score =  108 bits (259), Expect = 2e-23
 Identities = 50/62 (80%), Positives = 58/62 (93%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           V+FAKDFLAGG++AA+SKTAVAPIERVKLLLQVQH SKQI AD++YKGI+D  VRIPKEQ
Sbjct: 6   VSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQ 65

Query: 249 GL 254
           G+
Sbjct: 66  GV 67



 Score = 64.5 bits (150), Expect = 4e-10
 Identities = 29/40 (72%), Positives = 31/40 (77%)
 Frame = +3

Query: 573 QRFRCVRASIIIYRASYFGFYDTARGMLPDPKNTPIVISW 692
           Q F      IIIYRA+YFG YDTA+GMLPDPKNT IVISW
Sbjct: 175 QGFNVSVQGIIIYRAAYFGIYDTAKGMLPDPKNTHIVISW 214



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 16/24 (66%), Positives = 21/24 (87%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           F GLG+C+ KI+KSDG+ GLY+GF
Sbjct: 154 FRGLGDCLVKIYKSDGIKGLYQGF 177


>J02683-1|AAA35579.1|  298|Homo sapiens protein ( Human ADP/ATP
           carrier protein mRNA, complete cds. ).
          Length = 298

 Score =  146 bits (354), Expect = 7e-35
 Identities = 67/91 (73%), Positives = 71/91 (78%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+    LSFWRGN ANVIRYFPTQALNFAFKDKYKQ+FLGGVDK+TQFWRYF        
Sbjct: 62  PKEQEVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGG 121

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
               TSLCFVYPLDFARTRLAADVGK   +R
Sbjct: 122 AAGATSLCFVYPLDFARTRLAADVGKAGAER 152



 Score =  104 bits (249), Expect = 4e-22
 Identities = 48/60 (80%), Positives = 56/60 (93%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           ++FAKDFLAGG++AA+SKTAVAPIERVKLLLQVQH SKQI AD++YKGI+D  VRIPKEQ
Sbjct: 6   LSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQ 65



 Score = 64.5 bits (150), Expect = 4e-10
 Identities = 29/40 (72%), Positives = 31/40 (77%)
 Frame = +3

Query: 573 QRFRCVRASIIIYRASYFGFYDTARGMLPDPKNTPIVISW 692
           Q F      IIIYRA+YFG YDTA+GMLPDPKNT IVISW
Sbjct: 175 QGFNVSVQGIIIYRAAYFGIYDTAKGMLPDPKNTHIVISW 214



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 16/24 (66%), Positives = 21/24 (87%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           F GLG+C+ KI+KSDG+ GLY+GF
Sbjct: 154 FRGLGDCLVKIYKSDGIKGLYQGF 177


>J02966-1|AAA61223.1|  297|Homo sapiens ANT1 protein.
          Length = 297

 Score =  140 bits (339), Expect = 5e-33
 Identities = 64/86 (74%), Positives = 68/86 (79%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G LSFWRGN ANVIRYFPTQALNFAFKDKYKQ+FLGGVD+  QFWRYF        
Sbjct: 62  PKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLASGG 121

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGK 493
               TSLCFVYPLDFARTRLAADVG+
Sbjct: 122 AAGATSLCFVYPLDFARTRLAADVGR 147



 Score =  101 bits (241), Expect = 3e-21
 Identities = 47/60 (78%), Positives = 55/60 (91%)
 Frame = +3

Query: 72  AFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           +F KDFLAG ++AAVSKTAVAPIERVKLLLQVQH SKQI+A+++YKGI+D  VRIPKEQG
Sbjct: 7   SFLKDFLAGAVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQG 66



 Score = 59.7 bits (138), Expect = 1e-08
 Identities = 26/40 (65%), Positives = 29/40 (72%)
 Frame = +3

Query: 573 QRFRCVRASIIIYRASYFGFYDTARGMLPDPKNTPIVISW 692
           Q F      IIIYRA+YFG YDTA+GMLPDPKN  I +SW
Sbjct: 174 QGFNVSVQGIIIYRAAYFGVYDTAKGMLPDPKNVHIFVSW 213



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 19/24 (79%), Positives = 21/24 (87%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           F GLG+CI KIFKSDGL GLY+GF
Sbjct: 153 FHGLGDCIIKIFKSDGLRGLYQGF 176


>J03592-1|AAA36750.1|  262|Homo sapiens protein ( Human ADP/ATP
           translocase mRNA, 3' end, clone pHAT8. ).
          Length = 262

 Score =  138 bits (333), Expect = 2e-32
 Identities = 65/91 (71%), Positives = 69/91 (75%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G LSFWRGN ANVIRYFPTQALNFAFKDKYKQ+FLGGVD+   FWRYF        
Sbjct: 27  PKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHA-FWRYFAGNLASGG 85

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
               TSLCFVYPLDFARTRLAADVGK   +R
Sbjct: 86  AAGATSLCFVYPLDFARTRLAADVGKSGTER 116



 Score = 63.3 bits (147), Expect = 8e-10
 Identities = 28/40 (70%), Positives = 31/40 (77%)
 Frame = +3

Query: 573 QRFRCVRASIIIYRASYFGFYDTARGMLPDPKNTPIVISW 692
           Q F      IIIYRA+YFG YDTA+GMLPDPKNT IV+SW
Sbjct: 139 QGFSVSVQGIIIYRAAYFGVYDTAKGMLPDPKNTHIVVSW 178



 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 26/32 (81%), Positives = 29/32 (90%)
 Frame = +3

Query: 159 LQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           LQVQH SKQIAAD++YKGIVD  VRIPKEQG+
Sbjct: 1   LQVQHASKQIAADKQYKGIVDCIVRIPKEQGV 32



 Score = 39.5 bits (88), Expect = 0.012
 Identities = 16/24 (66%), Positives = 20/24 (83%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           F GLG+C+ KI KSDG+ GLY+GF
Sbjct: 118 FRGLGDCLVKITKSDGIRGLYQGF 141


>BC022032-1|AAH22032.1|  315|Homo sapiens solute carrier family 25
           (mitochondrial carrier; adenine nucleotide translocato
           protein.
          Length = 315

 Score =  132 bits (319), Expect = 1e-30
 Identities = 59/91 (64%), Positives = 67/91 (73%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G  SFWRGN ANVIRYFPTQALNFAFKDKYKQ+F+ GV+K+ QFWR+F        
Sbjct: 74  PREQGFFSFWRGNLANVIRYFPTQALNFAFKDKYKQLFMSGVNKEKQFWRWFLANLASGG 133

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
               TSLC VYPLDFARTRL  D+GKG  +R
Sbjct: 134 AAGATSLCVVYPLDFARTRLGVDIGKGPEER 164



 Score = 98.3 bits (234), Expect = 2e-20
 Identities = 48/67 (71%), Positives = 55/67 (82%)
 Frame = +3

Query: 57  LADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRI 236
           L D  +F KD LAGG++AAVSKTAVAPIERVKLLLQVQ  SKQI+ + RYKG+VD  VRI
Sbjct: 14  LFDASSFGKDLLAGGVAAAVSKTAVAPIERVKLLLQVQASSKQISPEARYKGMVDCLVRI 73

Query: 237 PKEQGLF 257
           P+EQG F
Sbjct: 74  PREQGFF 80



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 20/31 (64%), Positives = 26/31 (83%)
 Frame = +3

Query: 600 IIIYRASYFGFYDTARGMLPDPKNTPIVISW 692
           II+YRASYFG YDT +G+LP PK TP ++S+
Sbjct: 196 IIVYRASYFGAYDTVKGLLPKPKKTPFLVSF 226



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 18/25 (72%), Positives = 21/25 (84%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGFG 585
           F GLG+CI KI KSDG+ GLY+GFG
Sbjct: 166 FKGLGDCIMKIAKSDGIAGLYQGFG 190


>AY550240-1|AAT42263.1|  315|Homo sapiens sperm flagellar energy
           carrier protein protein.
          Length = 315

 Score =  132 bits (319), Expect = 1e-30
 Identities = 59/91 (64%), Positives = 67/91 (73%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G  SFWRGN ANVIRYFPTQALNFAFKDKYKQ+F+ GV+K+ QFWR+F        
Sbjct: 74  PREQGFFSFWRGNLANVIRYFPTQALNFAFKDKYKQLFMSGVNKEKQFWRWFLANLASGG 133

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
               TSLC VYPLDFARTRL  D+GKG  +R
Sbjct: 134 AAGATSLCVVYPLDFARTRLGVDIGKGPEER 164



 Score = 98.3 bits (234), Expect = 2e-20
 Identities = 48/67 (71%), Positives = 55/67 (82%)
 Frame = +3

Query: 57  LADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRI 236
           L D  +F KD LAGG++AAVSKTAVAPIERVKLLLQVQ  SKQI+ + RYKG+VD  VRI
Sbjct: 14  LFDASSFGKDLLAGGVAAAVSKTAVAPIERVKLLLQVQASSKQISPEARYKGMVDCLVRI 73

Query: 237 PKEQGLF 257
           P+EQG F
Sbjct: 74  PREQGFF 80



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 20/31 (64%), Positives = 26/31 (83%)
 Frame = +3

Query: 600 IIIYRASYFGFYDTARGMLPDPKNTPIVISW 692
           II+YRASYFG YDT +G+LP PK TP ++S+
Sbjct: 196 IIVYRASYFGAYDTVKGLLPKPKKTPFLVSF 226



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 18/25 (72%), Positives = 21/25 (84%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGFG 585
           F GLG+CI KI KSDG+ GLY+GFG
Sbjct: 166 FKGLGDCIMKIAKSDGIAGLYQGFG 190


>AJ863129-1|CAI05952.1|  315|Homo sapiens ADP/ATP carrier isoform 4
           protein.
          Length = 315

 Score =  132 bits (319), Expect = 1e-30
 Identities = 59/91 (64%), Positives = 67/91 (73%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G  SFWRGN ANVIRYFPTQALNFAFKDKYKQ+F+ GV+K+ QFWR+F        
Sbjct: 74  PREQGFFSFWRGNLANVIRYFPTQALNFAFKDKYKQLFMSGVNKEKQFWRWFLANLASGG 133

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
               TSLC VYPLDFARTRL  D+GKG  +R
Sbjct: 134 AAGATSLCVVYPLDFARTRLGVDIGKGPEER 164



 Score = 98.3 bits (234), Expect = 2e-20
 Identities = 48/67 (71%), Positives = 55/67 (82%)
 Frame = +3

Query: 57  LADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRI 236
           L D  +F KD LAGG++AAVSKTAVAPIERVKLLLQVQ  SKQI+ + RYKG+VD  VRI
Sbjct: 14  LFDASSFGKDLLAGGVAAAVSKTAVAPIERVKLLLQVQASSKQISPEARYKGMVDCLVRI 73

Query: 237 PKEQGLF 257
           P+EQG F
Sbjct: 74  PREQGFF 80



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 20/31 (64%), Positives = 26/31 (83%)
 Frame = +3

Query: 600 IIIYRASYFGFYDTARGMLPDPKNTPIVISW 692
           II+YRASYFG YDT +G+LP PK TP ++S+
Sbjct: 196 IIVYRASYFGAYDTVKGLLPKPKKTPFLVSF 226



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 18/25 (72%), Positives = 21/25 (84%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGFG 585
           F GLG+CI KI KSDG+ GLY+GFG
Sbjct: 166 FKGLGDCIMKIAKSDGIAGLYQGFG 190


>AC093591-1|AAY40974.1|  315|Homo sapiens unknown protein.
          Length = 315

 Score =  132 bits (319), Expect = 1e-30
 Identities = 59/91 (64%), Positives = 67/91 (73%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G  SFWRGN ANVIRYFPTQALNFAFKDKYKQ+F+ GV+K+ QFWR+F        
Sbjct: 74  PREQGFFSFWRGNLANVIRYFPTQALNFAFKDKYKQLFMSGVNKEKQFWRWFLANLASGG 133

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
               TSLC VYPLDFARTRL  D+GKG  +R
Sbjct: 134 AAGATSLCVVYPLDFARTRLGVDIGKGPEER 164



 Score = 98.3 bits (234), Expect = 2e-20
 Identities = 48/67 (71%), Positives = 55/67 (82%)
 Frame = +3

Query: 57  LADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRI 236
           L D  +F KD LAGG++AAVSKTAVAPIERVKLLLQVQ  SKQI+ + RYKG+VD  VRI
Sbjct: 14  LFDASSFGKDLLAGGVAAAVSKTAVAPIERVKLLLQVQASSKQISPEARYKGMVDCLVRI 73

Query: 237 PKEQGLF 257
           P+EQG F
Sbjct: 74  PREQGFF 80



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 20/31 (64%), Positives = 26/31 (83%)
 Frame = +3

Query: 600 IIIYRASYFGFYDTARGMLPDPKNTPIVISW 692
           II+YRASYFG YDT +G+LP PK TP ++S+
Sbjct: 196 IIVYRASYFGAYDTVKGLLPKPKKTPFLVSF 226



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 18/25 (72%), Positives = 21/25 (84%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGFG 585
           F GLG+CI KI KSDG+ GLY+GFG
Sbjct: 166 FKGLGDCIMKIAKSDGIAGLYQGFG 190


>AF091236-1|AAC61590.1|   72|Homo sapiens ADP/ATP translocase
           protein.
          Length = 72

 Score =  102 bits (244), Expect = 1e-21
 Identities = 44/52 (84%), Positives = 46/52 (88%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYF 391
           P+  G LSFWRGN ANVIRY PTQALNFAFKDKYKQ+FLGGVDK TQFWRYF
Sbjct: 14  PKDQGVLSFWRGNLANVIRYSPTQALNFAFKDKYKQIFLGGVDKHTQFWRYF 65



 Score = 33.5 bits (73), Expect = 0.78
 Identities = 13/19 (68%), Positives = 17/19 (89%)
 Frame = +3

Query: 198 QRYKGIVDAFVRIPKEQGL 254
           ++YKGIVD  VRIPK+QG+
Sbjct: 1   KQYKGIVDCIVRIPKDQGV 19


>J03593-1|AAA36751.1|   37|Homo sapiens protein ( Human ADP/ATP
           translocase mRNA, 5' end, clone pHAT14. ).
          Length = 37

 Score = 57.2 bits (132), Expect = 6e-08
 Identities = 27/31 (87%), Positives = 30/31 (96%)
 Frame = +3

Query: 72  AFAKDFLAGGISAAVSKTAVAPIERVKLLLQ 164
           +F KDFLAGG++AAVSKTAVAPIERVKLLLQ
Sbjct: 7   SFLKDFLAGGVAAAVSKTAVAPIERVKLLLQ 37


>BC068561-1|AAH68561.1|  477|Homo sapiens solute carrier family 25
           (mitochondrial carrier; phosphate carrier), member 24
           protein.
          Length = 477

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 28/82 (34%), Positives = 40/82 (48%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G  S WRGN  NVI+  P  A+ F   ++YK++      K   F R+             
Sbjct: 246 GIRSLWRGNGTNVIKIAPETAVKFWAYEQYKKLLTEEGQKIGTFERFI-----SGSMAGA 300

Query: 428 TSLCFVYPLDFARTRLAADVGK 493
           T+  F+YP++  +TRLA  VGK
Sbjct: 301 TAQTFIYPMEVMKTRLA--VGK 320



 Score = 40.7 bits (91), Expect = 0.005
 Identities = 18/34 (52%), Positives = 28/34 (82%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSK 182
           +  LAGGI+ AVS+T+ AP++R+K+++QV H SK
Sbjct: 196 RQLLAGGIAGAVSRTSTAPLDRLKIMMQV-HGSK 228



 Score = 29.9 bits (64), Expect = 9.6
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 2/64 (3%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL--FH 260
           F++G ++ A ++T + P+E +K  L V    +       Y GI D   +I K +GL  F+
Sbjct: 292 FISGSMAGATAQTFIYPMEVMKTRLAVGKTGQ-------YSGIYDCAKKILKHEGLGAFY 344

Query: 261 SGVV 272
            G V
Sbjct: 345 KGYV 348


>BC030266-1|AAH30266.1|  332|Homo sapiens solute carrier family 25
           (mitochondrial carrier; Graves disease autoantigen), m
           protein.
          Length = 332

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 21/57 (36%), Positives = 35/57 (61%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           + FLAGGI+   +KT VAP++RVK+LLQ  +         ++ G+  A   +P+++G
Sbjct: 38  RSFLAGGIAGCCAKTTVAPLDRVKVLLQAHN------HHYKHLGVFSALRAVPQKEG 88



 Score = 39.9 bits (89), Expect = 0.009
 Identities = 30/92 (32%), Positives = 40/92 (43%)
 Frame = +2

Query: 224 LRPHPQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXX 403
           LR  PQ  G L  ++GN A +IR FP  A+ F   + YK +    +       R      
Sbjct: 80  LRAVPQKEGFLGLYKGNGAMMIRIFPYGAIQFMAFEHYKTLITTKLGISGHVHRLM---- 135

Query: 404 XXXXXXXXTSLCFVYPLDFARTRLAADVGKGD 499
                   T++   YPLD  R RLA  V KG+
Sbjct: 136 -AGSMAGMTAVICTYPLDMVRVRLAFQV-KGE 165


>BC014519-1|AAH14519.1|  477|Homo sapiens solute carrier family 25
           (mitochondrial carrier; phosphate carrier), member 24
           protein.
          Length = 477

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 28/82 (34%), Positives = 40/82 (48%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G  S WRGN  NVI+  P  A+ F   ++YK++      K   F R+             
Sbjct: 246 GIRSLWRGNGTNVIKIAPETAVKFWAYEQYKKLLTEEGQKIGTFERFI-----SGSMAGA 300

Query: 428 TSLCFVYPLDFARTRLAADVGK 493
           T+  F+YP++  +TRLA  VGK
Sbjct: 301 TAQTFIYPMEVMKTRLA--VGK 320



 Score = 40.7 bits (91), Expect = 0.005
 Identities = 18/34 (52%), Positives = 28/34 (82%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSK 182
           +  LAGGI+ AVS+T+ AP++R+K+++QV H SK
Sbjct: 196 RQLLAGGIAGAVSRTSTAPLDRLKIMMQV-HGSK 228



 Score = 29.9 bits (64), Expect = 9.6
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 2/64 (3%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL--FH 260
           F++G ++ A ++T + P+E +K  L V    +       Y GI D   +I K +GL  F+
Sbjct: 292 FISGSMAGATAQTFIYPMEVMKTRLAVGKTGQ-------YSGIYDCAKKILKHEGLGAFY 344

Query: 261 SGVV 272
            G V
Sbjct: 345 KGYV 348


>AL713888-2|CAI15116.1|  332|Homo sapiens solute carrier family 25
           (mitochondrial carrier; Graves disease autoantigen), m
           protein.
          Length = 332

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 21/57 (36%), Positives = 35/57 (61%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           + FLAGGI+   +KT VAP++RVK+LLQ  +         ++ G+  A   +P+++G
Sbjct: 38  RSFLAGGIAGCCAKTTVAPLDRVKVLLQAHN------HHYKHLGVFSALRAVPQKEG 88



 Score = 39.9 bits (89), Expect = 0.009
 Identities = 30/92 (32%), Positives = 40/92 (43%)
 Frame = +2

Query: 224 LRPHPQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXX 403
           LR  PQ  G L  ++GN A +IR FP  A+ F   + YK +    +       R      
Sbjct: 80  LRAVPQKEGFLGLYKGNGAMMIRIFPYGAIQFMAFEHYKTLITTKLGISGHVHRLM---- 135

Query: 404 XXXXXXXXTSLCFVYPLDFARTRLAADVGKGD 499
                   T++   YPLD  R RLA  V KG+
Sbjct: 136 -AGSMAGMTAVICTYPLDMVRVRLAFQV-KGE 165


>AL390036-2|CAI13623.1|  477|Homo sapiens solute carrier family 25
           (mitochondrial carrier; phosphate carrier), member 24
           protein.
          Length = 477

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 28/82 (34%), Positives = 40/82 (48%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G  S WRGN  NVI+  P  A+ F   ++YK++      K   F R+             
Sbjct: 246 GIRSLWRGNGTNVIKIAPETAVKFWAYEQYKKLLTEEGQKIGTFERFI-----SGSMAGA 300

Query: 428 TSLCFVYPLDFARTRLAADVGK 493
           T+  F+YP++  +TRLA  VGK
Sbjct: 301 TAQTFIYPMEVMKTRLA--VGK 320



 Score = 40.7 bits (91), Expect = 0.005
 Identities = 18/34 (52%), Positives = 28/34 (82%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSK 182
           +  LAGGI+ AVS+T+ AP++R+K+++QV H SK
Sbjct: 196 RQLLAGGIAGAVSRTSTAPLDRLKIMMQV-HGSK 228



 Score = 29.9 bits (64), Expect = 9.6
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 2/64 (3%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL--FH 260
           F++G ++ A ++T + P+E +K  L V    +       Y GI D   +I K +GL  F+
Sbjct: 292 FISGSMAGATAQTFIYPMEVMKTRLAVGKTGQ-------YSGIYDCAKKILKHEGLGAFY 344

Query: 261 SGVV 272
            G V
Sbjct: 345 KGYV 348


>AL359258-2|CAI14513.1|  477|Homo sapiens solute carrier family 25
           (mitochondrial carrier; phosphate carrier), member 24
           protein.
          Length = 477

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 28/82 (34%), Positives = 40/82 (48%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G  S WRGN  NVI+  P  A+ F   ++YK++      K   F R+             
Sbjct: 246 GIRSLWRGNGTNVIKIAPETAVKFWAYEQYKKLLTEEGQKIGTFERFI-----SGSMAGA 300

Query: 428 TSLCFVYPLDFARTRLAADVGK 493
           T+  F+YP++  +TRLA  VGK
Sbjct: 301 TAQTFIYPMEVMKTRLA--VGK 320



 Score = 40.7 bits (91), Expect = 0.005
 Identities = 18/34 (52%), Positives = 28/34 (82%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSK 182
           +  LAGGI+ AVS+T+ AP++R+K+++QV H SK
Sbjct: 196 RQLLAGGIAGAVSRTSTAPLDRLKIMMQV-HGSK 228



 Score = 29.9 bits (64), Expect = 9.6
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 2/64 (3%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL--FH 260
           F++G ++ A ++T + P+E +K  L V    +       Y GI D   +I K +GL  F+
Sbjct: 292 FISGSMAGATAQTFIYPMEVMKTRLAVGKTGQ-------YSGIYDCAKKILKHEGLGAFY 344

Query: 261 SGVV 272
            G V
Sbjct: 345 KGYV 348


>AJ619987-1|CAF04493.1|  477|Homo sapiens small calcium-binding
           mitochondrial carrier 1 protein.
          Length = 477

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 28/82 (34%), Positives = 40/82 (48%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G  S WRGN  NVI+  P  A+ F   ++YK++      K   F R+             
Sbjct: 246 GIRSLWRGNGTNVIKIAPETAVKFWAYEQYKKLLTEEGQKIGTFERFI-----SGSMAGA 300

Query: 428 TSLCFVYPLDFARTRLAADVGK 493
           T+  F+YP++  +TRLA  VGK
Sbjct: 301 TAQTFIYPMEVMKTRLA--VGK 320



 Score = 40.7 bits (91), Expect = 0.005
 Identities = 18/34 (52%), Positives = 28/34 (82%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSK 182
           +  LAGGI+ AVS+T+ AP++R+K+++QV H SK
Sbjct: 196 RQLLAGGIAGAVSRTSTAPLDRLKIMMQV-HGSK 228



 Score = 29.9 bits (64), Expect = 9.6
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 2/64 (3%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL--FH 260
           F++G ++ A ++T + P+E +K  L V    +       Y GI D   +I K +GL  F+
Sbjct: 292 FISGSMAGATAQTFIYPMEVMKTRLAVGKTGQ-------YSGIYDCAKKILKHEGLGAFY 344

Query: 261 SGVV 272
            G V
Sbjct: 345 KGYV 348


>AJ619961-1|CAF04058.1|  458|Homo sapiens mitochondrial ATP-Mg/Pi
           carrier protein.
          Length = 458

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 28/82 (34%), Positives = 40/82 (48%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G  S WRGN  NVI+  P  A+ F   ++YK++      K   F R+             
Sbjct: 227 GIRSLWRGNGTNVIKIAPETAVKFWAYEQYKKLLTEEGQKIGTFERFI-----SGSMAGA 281

Query: 428 TSLCFVYPLDFARTRLAADVGK 493
           T+  F+YP++  +TRLA  VGK
Sbjct: 282 TAQTFIYPMEVMKTRLA--VGK 301



 Score = 40.7 bits (91), Expect = 0.005
 Identities = 18/34 (52%), Positives = 28/34 (82%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSK 182
           +  LAGGI+ AVS+T+ AP++R+K+++QV H SK
Sbjct: 177 RQLLAGGIAGAVSRTSTAPLDRLKIMMQV-HGSK 209



 Score = 29.9 bits (64), Expect = 9.6
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 2/64 (3%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL--FH 260
           F++G ++ A ++T + P+E +K  L V    +       Y GI D   +I K +GL  F+
Sbjct: 273 FISGSMAGATAQTFIYPMEVMKTRLAVGKTGQ-------YSGIYDCAKKILKHEGLGAFY 325

Query: 261 SGVV 272
            G V
Sbjct: 326 KGYV 329


>AF123303-1|AAF28888.1|  411|Homo sapiens calcium-binding
           transporter protein.
          Length = 411

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 28/82 (34%), Positives = 40/82 (48%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G  S WRGN  NVI+  P  A+ F   ++YK++      K   F R+             
Sbjct: 239 GIRSLWRGNGTNVIKIAPETAVKFWAYEQYKKLLTEEGQKIGTFERFI-----SGSMAGA 293

Query: 428 TSLCFVYPLDFARTRLAADVGK 493
           T+  F+YP++  +TRLA  VGK
Sbjct: 294 TAQTFIYPMEVMKTRLA--VGK 313



 Score = 40.7 bits (91), Expect = 0.005
 Identities = 18/34 (52%), Positives = 28/34 (82%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSK 182
           +  LAGGI+ AVS+T+ AP++R+K+++QV H SK
Sbjct: 189 RQLLAGGIAGAVSRTSTAPLDRLKIMMQV-HGSK 221



 Score = 29.9 bits (64), Expect = 9.6
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 2/64 (3%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL--FH 260
           F++G ++ A ++T + P+E +K  L V    +       Y GI D   +I K +GL  F+
Sbjct: 285 FISGSMAGATAQTFIYPMEVMKTRLAVGKTGQ-------YSGIYDCAKKILKHEGLGAFY 337

Query: 261 SGVV 272
            G V
Sbjct: 338 KGYV 341


>Y14494-1|CAA74834.1|  678|Homo sapiens aralar1 protein.
          Length = 678

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 20/57 (35%), Positives = 30/57 (52%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLF 257
           F  G ++ AV  TAV PI+ VK  +Q Q  S  +  +  YK   D F ++ + +G F
Sbjct: 330 FTLGSVAGAVGATAVYPIDLVKTRMQNQRGSGSVVGELMYKNSFDCFKKVLRYEGFF 386


>BC016932-1|AAH16932.1|  678|Homo sapiens solute carrier family 25
           (mitochondrial carrier, Aralar), member 12 protein.
          Length = 678

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 20/57 (35%), Positives = 30/57 (52%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLF 257
           F  G ++ AV  TAV PI+ VK  +Q Q  S  +  +  YK   D F ++ + +G F
Sbjct: 330 FTLGSVAGAVGATAVYPIDLVKTRMQNQRGSGSVVGELMYKNSFDCFKKVLRYEGFF 386


>AJ496568-1|CAD43090.1|  678|Homo sapiens mitochondrial
           aspartate-glutamate carrier protein protein.
          Length = 678

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 20/57 (35%), Positives = 30/57 (52%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLF 257
           F  G ++ AV  TAV PI+ VK  +Q Q  S  +  +  YK   D F ++ + +G F
Sbjct: 330 FTLGSVAGAVGATAVYPIDLVKTRMQNQRGSGSVVGELMYKNSFDCFKKVLRYEGFF 386


>AC068039-2|AAY24134.1|  678|Homo sapiens unknown protein.
          Length = 678

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 20/57 (35%), Positives = 30/57 (52%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLF 257
           F  G ++ AV  TAV PI+ VK  +Q Q  S  +  +  YK   D F ++ + +G F
Sbjct: 330 FTLGSVAGAVGATAVYPIDLVKTRMQNQRGSGSVVGELMYKNSFDCFKKVLRYEGFF 386


>BC132739-1|AAI32740.1|  291|Homo sapiens solute carrier family 25,
           member 30 protein.
          Length = 291

 Score = 41.5 bits (93), Expect = 0.003
 Identities = 22/66 (33%), Positives = 39/66 (59%), Gaps = 3/66 (4%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQ-RYKGIVDAFVRIPKEQGL- 254
           K F+ GG+++  ++    PI+  K  LQ+Q  +      + RY+G++ A VRI +E+GL 
Sbjct: 7   KPFVYGGLASITAECGTFPIDLTKTRLQIQGQTNDAKFKEIRYRGMLHALVRIGREEGLK 66

Query: 255 -FHSGV 269
             +SG+
Sbjct: 67  ALYSGI 72


>AL627107-4|CAI23613.1|  291|Homo sapiens protein ( udogene, a novel
           gene (possible).).
          Length = 291

 Score = 41.5 bits (93), Expect = 0.003
 Identities = 22/66 (33%), Positives = 39/66 (59%), Gaps = 3/66 (4%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQ-RYKGIVDAFVRIPKEQGL- 254
           K F+ GG+++  ++    PI+  K  LQ+Q  +      + RY+G++ A VRI +E+GL 
Sbjct: 7   KPFVYGGLASITAECGTFPIDLTKTRLQIQGQTNDAKFKEIRYRGMLHALVRIGREEGLK 66

Query: 255 -FHSGV 269
             +SG+
Sbjct: 67  ALYSGI 72


>M31659-1|AAA36329.1|  349|Homo sapiens protein ( Human GT
           mitochondrial solute carrier protein homologue mRNA,
           complete cds. ).
          Length = 349

 Score = 40.3 bits (90), Expect = 0.007
 Identities = 20/57 (35%), Positives = 34/57 (59%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           + FLAG I+   +KT VAP++RVK+LLQ  +         ++ G+  A   +P+++G
Sbjct: 38  RSFLAGSIAGCCAKTTVAPLDRVKVLLQAHN------HHYKHLGVFSALRAVPQKEG 88



 Score = 34.7 bits (76), Expect = 0.34
 Identities = 28/92 (30%), Positives = 39/92 (42%)
 Frame = +2

Query: 224 LRPHPQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXX 403
           LR  PQ  G L  ++GN A +IR FP  A+ F   + YK +    +       R      
Sbjct: 80  LRAVPQKEGFLGLYKGNGAMMIRIFPYGAIQFMAFEHYKTLITTKLGISGHVHRLM---- 135

Query: 404 XXXXXXXXTSLCFVYPLDFARTRLAADVGKGD 499
                   T++    P+D  R RLA  V KG+
Sbjct: 136 -AGSMAGMTAVICTDPVDMVRVRLAFQV-KGE 165


>BC045598-1|AAH45598.1|  318|Homo sapiens solute carrier family 25,
           member 42 protein.
          Length = 318

 Score = 40.3 bits (90), Expect = 0.007
 Identities = 26/81 (32%), Positives = 38/81 (46%), Gaps = 4/81 (4%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQV---FLGGVDKKTQFW-RYFXXXXXXXX 415
           G LS WRGN A ++R  P  A+ F+  ++YK++   + G   +    W R F        
Sbjct: 85  GFLSLWRGNSATMVRVVPYAAIQFSAHEEYKRILGSYYGFRGEALPPWPRLF-----AGA 139

Query: 416 XXXXTSLCFVYPLDFARTRLA 478
               T+    YPLD  R R+A
Sbjct: 140 LAGTTAASLTYPLDLVRARMA 160



 Score = 39.1 bits (87), Expect = 0.016
 Identities = 19/57 (33%), Positives = 35/57 (61%)
 Frame = +3

Query: 39  SNKMSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYK 209
           S+ +S+  D        L G ++ A++KTAVAP++R K++ QV   SK+ +A + ++
Sbjct: 21  SSSVSSKRDHRQVLSSLLPGALAGALAKTAVAPLDRTKIIFQVS--SKRFSAKEAFR 75


>AC004143-1|AAC02758.1|  216|Homo sapiens R29893_1 protein.
          Length = 216

 Score = 40.3 bits (90), Expect = 0.007
 Identities = 26/81 (32%), Positives = 38/81 (46%), Gaps = 4/81 (4%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQV---FLGGVDKKTQFW-RYFXXXXXXXX 415
           G LS WRGN A ++R  P  A+ F+  ++YK++   + G   +    W R F        
Sbjct: 74  GFLSLWRGNSATMVRVVPYAAIQFSAHEEYKRILGSYYGFRGEALPPWPRLF-----AGA 128

Query: 416 XXXXTSLCFVYPLDFARTRLA 478
               T+    YPLD  R R+A
Sbjct: 129 LAGTTAASLTYPLDLVRARMA 149



 Score = 37.5 bits (83), Expect = 0.048
 Identities = 16/40 (40%), Positives = 30/40 (75%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYK 209
           L+G ++ A++KTAVAP++R K++ QV   SK+ +A + ++
Sbjct: 27  LSGALAGALAKTAVAPLDRTKIIFQVS--SKRFSAKEAFR 64


>AL035423-5|CAI42440.1|  353|Homo sapiens solute carrier family 25
           (mitochondrial carrier, brain), member 14 protein.
          Length = 353

 Score = 39.5 bits (88), Expect = 0.012
 Identities = 29/88 (32%), Positives = 47/88 (53%), Gaps = 3/88 (3%)
 Frame = +3

Query: 15  IHLVKIT*SNKMSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAA 194
           IH    T S++MS L       K F+ GG+++ V++    P++  K  LQVQ  S     
Sbjct: 22  IHQKSTTVSHEMSGLN-----WKPFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDARF 76

Query: 195 DQ-RYKGIVDAFVRIPKEQGL--FHSGV 269
            + +Y+G+  A  RI KE+G+   +SG+
Sbjct: 77  KEIKYRGMFHALFRICKEEGVLALYSGI 104


>AL035423-4|CAI42441.1|  322|Homo sapiens solute carrier family 25
           (mitochondrial carrier, brain), member 14 protein.
          Length = 322

 Score = 39.5 bits (88), Expect = 0.012
 Identities = 29/88 (32%), Positives = 47/88 (53%), Gaps = 3/88 (3%)
 Frame = +3

Query: 15  IHLVKIT*SNKMSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAA 194
           IH    T S++MS L       K F+ GG+++ V++    P++  K  LQVQ  S     
Sbjct: 22  IHQKSTTVSHEMSGLN-----WKPFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDARF 76

Query: 195 DQ-RYKGIVDAFVRIPKEQGL--FHSGV 269
            + +Y+G+  A  RI KE+G+   +SG+
Sbjct: 77  KEIKYRGMFHALFRICKEEGVLALYSGI 104


>AF155811-1|AAG29584.1|  322|Homo sapiens mitochondrial uncoupling
           protein 5 short form protein.
          Length = 322

 Score = 39.5 bits (88), Expect = 0.012
 Identities = 29/88 (32%), Positives = 47/88 (53%), Gaps = 3/88 (3%)
 Frame = +3

Query: 15  IHLVKIT*SNKMSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAA 194
           IH    T S++MS L       K F+ GG+++ V++    P++  K  LQVQ  S     
Sbjct: 22  IHQKSTTVSHEMSGLN-----WKPFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDARF 76

Query: 195 DQ-RYKGIVDAFVRIPKEQGL--FHSGV 269
            + +Y+G+  A  RI KE+G+   +SG+
Sbjct: 77  KEIKYRGMFHALFRICKEEGVLALYSGI 104


>AF155810-1|AAG29583.1|  353|Homo sapiens mitochondrial uncoupling
           protein 5 short form with insertion protein.
          Length = 353

 Score = 39.5 bits (88), Expect = 0.012
 Identities = 29/88 (32%), Positives = 47/88 (53%), Gaps = 3/88 (3%)
 Frame = +3

Query: 15  IHLVKIT*SNKMSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAA 194
           IH    T S++MS L       K F+ GG+++ V++    P++  K  LQVQ  S     
Sbjct: 22  IHQKSTTVSHEMSGLN-----WKPFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDARF 76

Query: 195 DQ-RYKGIVDAFVRIPKEQGL--FHSGV 269
            + +Y+G+  A  RI KE+G+   +SG+
Sbjct: 77  KEIKYRGMFHALFRICKEEGVLALYSGI 104


>Y17571-1|CAB62206.1|  675|Homo sapiens aralar2 protein.
          Length = 675

 Score = 38.7 bits (86), Expect = 0.021
 Identities = 19/57 (33%), Positives = 29/57 (50%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLF 257
           F  G ++ AV  TAV PI+ VK  +Q Q  +     +  YK   D F ++ + +G F
Sbjct: 332 FGLGSVAGAVGATAVYPIDLVKTRMQNQRSTGSFVGELMYKNSFDCFKKVLRYEGFF 388



 Score = 32.3 bits (70), Expect = 1.8
 Identities = 18/54 (33%), Positives = 29/54 (53%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           LAG I+   + + V P + +K  LQV   + Q      Y G++D F +I +E+G
Sbjct: 525 LAGAIAGTPAASLVTPADVIKTRLQVAARAGQTT----YSGVIDCFRKILREEG 574


>BC103933-1|AAI03934.1|  469|Homo sapiens solute carrier family 25
           (mitochondrial carrier; phosphate carrier), member 25
           protein.
          Length = 469

 Score = 38.7 bits (86), Expect = 0.021
 Identities = 22/57 (38%), Positives = 35/57 (61%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           +  +AGG + AVS+T  AP++R+K+L+QV H S+         GIV  F ++ +E G
Sbjct: 188 RHLVAGGGAGAVSRTCTAPLDRLKVLMQV-HASR-----SNNMGIVGGFTQMIREGG 238



 Score = 33.1 bits (72), Expect = 1.0
 Identities = 22/77 (28%), Positives = 37/77 (48%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G+ S WRGN  NV++  P  A+ F   ++ K+  L G D++T                  
Sbjct: 238 GARSLWRGNGINVLKIAPESAIKFMAYEQIKR--LVGSDQETLRIHERLVAGSLAGAIAQ 295

Query: 428 TSLCFVYPLDFARTRLA 478
           +S   +YP++  +TR+A
Sbjct: 296 SS---IYPMEVLKTRMA 309


>BC103932-1|AAI03933.1|  469|Homo sapiens solute carrier family 25
           (mitochondrial carrier; phosphate carrier), member 25
           protein.
          Length = 469

 Score = 38.7 bits (86), Expect = 0.021
 Identities = 22/57 (38%), Positives = 35/57 (61%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           +  +AGG + AVS+T  AP++R+K+L+QV H S+         GIV  F ++ +E G
Sbjct: 188 RHLVAGGGAGAVSRTCTAPLDRLKVLMQV-HASR-----SNNMGIVGGFTQMIREGG 238



 Score = 33.1 bits (72), Expect = 1.0
 Identities = 22/77 (28%), Positives = 37/77 (48%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G+ S WRGN  NV++  P  A+ F   ++ K+  L G D++T                  
Sbjct: 238 GARSLWRGNGINVLKIAPESAIKFMAYEQIKR--LVGSDQETLRIHERLVAGSLAGAIAQ 295

Query: 428 TSLCFVYPLDFARTRLA 478
           +S   +YP++  +TR+A
Sbjct: 296 SS---IYPMEVLKTRMA 309


>BC103931-1|AAI03932.1|  469|Homo sapiens solute carrier family 25
           (mitochondrial carrier; phosphate carrier), member 25
           protein.
          Length = 469

 Score = 38.7 bits (86), Expect = 0.021
 Identities = 22/57 (38%), Positives = 35/57 (61%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           +  +AGG + AVS+T  AP++R+K+L+QV H S+         GIV  F ++ +E G
Sbjct: 188 RHLVAGGGAGAVSRTCTAPLDRLKVLMQV-HASR-----SNNMGIVGGFTQMIREGG 238



 Score = 33.1 bits (72), Expect = 1.0
 Identities = 22/77 (28%), Positives = 37/77 (48%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G+ S WRGN  NV++  P  A+ F   ++ K+  L G D++T                  
Sbjct: 238 GARSLWRGNGINVLKIAPESAIKFMAYEQIKR--LVGSDQETLRIHERLVAGSLAGAIAQ 295

Query: 428 TSLCFVYPLDFARTRLA 478
           +S   +YP++  +TR+A
Sbjct: 296 SS---IYPMEVLKTRMA 309


>BC103930-1|AAI03931.1|  469|Homo sapiens solute carrier family 25
           (mitochondrial carrier; phosphate carrier), member 25
           protein.
          Length = 469

 Score = 38.7 bits (86), Expect = 0.021
 Identities = 22/57 (38%), Positives = 35/57 (61%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           +  +AGG + AVS+T  AP++R+K+L+QV H S+         GIV  F ++ +E G
Sbjct: 188 RHLVAGGGAGAVSRTCTAPLDRLKVLMQV-HASR-----SNNMGIVGGFTQMIREGG 238



 Score = 33.1 bits (72), Expect = 1.0
 Identities = 22/77 (28%), Positives = 37/77 (48%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G+ S WRGN  NV++  P  A+ F   ++ K+  L G D++T                  
Sbjct: 238 GARSLWRGNGINVLKIAPESAIKFMAYEQIKR--LVGSDQETLRIHERLVAGSLAGAIAQ 295

Query: 428 TSLCFVYPLDFARTRLA 478
           +S   +YP++  +TR+A
Sbjct: 296 SS---IYPMEVLKTRMA 309


>BC089448-1|AAH89448.1|  469|Homo sapiens solute carrier family 25
           (mitochondrial carrier; phosphate carrier), member 25
           protein.
          Length = 469

 Score = 38.7 bits (86), Expect = 0.021
 Identities = 22/57 (38%), Positives = 35/57 (61%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           +  +AGG + AVS+T  AP++R+K+L+QV H S+         GIV  F ++ +E G
Sbjct: 188 RHLVAGGGAGAVSRTCTAPLDRLKVLMQV-HASR-----SNNMGIVGGFTQMIREGG 238



 Score = 33.1 bits (72), Expect = 1.0
 Identities = 22/77 (28%), Positives = 37/77 (48%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G+ S WRGN  NV++  P  A+ F   ++ K+  L G D++T                  
Sbjct: 238 GARSLWRGNGINVLKIAPESAIKFMAYEQIKR--LVGSDQETLRIHERLVAGSLAGAIAQ 295

Query: 428 TSLCFVYPLDFARTRLA 478
           +S   +YP++  +TR+A
Sbjct: 296 SS---IYPMEVLKTRMA 309


>BC006566-1|AAH06566.1|  675|Homo sapiens solute carrier family 25,
           member 13 (citrin) protein.
          Length = 675

 Score = 38.7 bits (86), Expect = 0.021
 Identities = 19/57 (33%), Positives = 29/57 (50%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLF 257
           F  G ++ AV  TAV PI+ VK  +Q Q  +     +  YK   D F ++ + +G F
Sbjct: 332 FGLGSVAGAVGATAVYPIDLVKTRMQNQRSTGSFVGELMYKNSFDCFKKVLRYEGFF 388



 Score = 31.9 bits (69), Expect = 2.4
 Identities = 18/54 (33%), Positives = 29/54 (53%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           LAG I+   + + V P + +K  LQV   + Q      Y G++D F +I +E+G
Sbjct: 525 LAGAIAGMPAASLVTPADVIKTRLQVAARAGQTT----YSGVIDCFRKILREEG 574


>BC005163-1|AAH05163.2|  308|Homo sapiens SLC25A25 protein protein.
          Length = 308

 Score = 38.7 bits (86), Expect = 0.021
 Identities = 22/57 (38%), Positives = 35/57 (61%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           +  +AGG + AVS+T  AP++R+K+L+QV H S+         GIV  F ++ +E G
Sbjct: 27  RHLVAGGGAGAVSRTCTAPLDRLKVLMQV-HASR-----SNNMGIVGGFTQMIREGG 77



 Score = 33.1 bits (72), Expect = 1.0
 Identities = 22/77 (28%), Positives = 37/77 (48%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G+ S WRGN  NV++  P  A+ F   ++ K+  L G D++T                  
Sbjct: 77  GARSLWRGNGINVLKIAPESAIKFMAYEQIKR--LVGSDQETLRIHERLVAGSLAGAIAQ 134

Query: 428 TSLCFVYPLDFARTRLA 478
           +S   +YP++  +TR+A
Sbjct: 135 SS---IYPMEVLKTRMA 148


>AY358515-1|AAQ88879.1|  469|Homo sapiens LCLC549 protein.
          Length = 469

 Score = 38.7 bits (86), Expect = 0.021
 Identities = 22/57 (38%), Positives = 35/57 (61%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           +  +AGG + AVS+T  AP++R+K+L+QV H S+         GIV  F ++ +E G
Sbjct: 188 RHLVAGGGAGAVSRTCTAPLDRLKVLMQV-HASR-----SNNMGIVGGFTQMIREGG 238



 Score = 33.1 bits (72), Expect = 1.0
 Identities = 22/77 (28%), Positives = 37/77 (48%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G+ S WRGN  NV++  P  A+ F   ++ K+  L G D++T                  
Sbjct: 238 GARSLWRGNGINVLKIAPESAIKFMAYEQIKR--LVGSDQETLRIHERLVAGSLAGAIAQ 295

Query: 428 TSLCFVYPLDFARTRLA 478
           +S   +YP++  +TR+A
Sbjct: 296 SS---IYPMEVLKTRMA 309


>AL590708-19|CAI13838.1|  469|Homo sapiens solute carrier family 25
           (mitochondrial carrier; phosphate carrier), member 25
           protein.
          Length = 469

 Score = 38.7 bits (86), Expect = 0.021
 Identities = 22/57 (38%), Positives = 35/57 (61%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           +  +AGG + AVS+T  AP++R+K+L+QV H S+         GIV  F ++ +E G
Sbjct: 188 RHLVAGGGAGAVSRTCTAPLDRLKVLMQV-HASR-----SNNMGIVGGFTQMIREGG 238



 Score = 33.1 bits (72), Expect = 1.0
 Identities = 22/77 (28%), Positives = 37/77 (48%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G+ S WRGN  NV++  P  A+ F   ++ K+  L G D++T                  
Sbjct: 238 GARSLWRGNGINVLKIAPESAIKFMAYEQIKR--LVGSDQETLRIHERLVAGSLAGAIAQ 295

Query: 428 TSLCFVYPLDFARTRLA 478
           +S   +YP++  +TR+A
Sbjct: 296 SS---IYPMEVLKTRMA 309


>AL590708-16|CAI13836.1|  501|Homo sapiens solute carrier family 25
           (mitochondrial carrier; phosphate carrier), member 25
           protein.
          Length = 501

 Score = 38.7 bits (86), Expect = 0.021
 Identities = 22/57 (38%), Positives = 35/57 (61%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           +  +AGG + AVS+T  AP++R+K+L+QV H S+         GIV  F ++ +E G
Sbjct: 220 RHLVAGGGAGAVSRTCTAPLDRLKVLMQV-HASR-----SNNMGIVGGFTQMIREGG 270



 Score = 33.1 bits (72), Expect = 1.0
 Identities = 22/77 (28%), Positives = 37/77 (48%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G+ S WRGN  NV++  P  A+ F   ++ K+  L G D++T                  
Sbjct: 270 GARSLWRGNGINVLKIAPESAIKFMAYEQIKR--LVGSDQETLRIHERLVAGSLAGAIAQ 327

Query: 428 TSLCFVYPLDFARTRLA 478
           +S   +YP++  +TR+A
Sbjct: 328 SS---IYPMEVLKTRMA 341


>AL590708-7|CAI13827.1|  515|Homo sapiens solute carrier family 25
           (mitochondrial carrier; phosphate carrier), member 25
           protein.
          Length = 515

 Score = 38.7 bits (86), Expect = 0.021
 Identities = 22/57 (38%), Positives = 35/57 (61%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           +  +AGG + AVS+T  AP++R+K+L+QV H S+         GIV  F ++ +E G
Sbjct: 234 RHLVAGGGAGAVSRTCTAPLDRLKVLMQV-HASR-----SNNMGIVGGFTQMIREGG 284



 Score = 33.1 bits (72), Expect = 1.0
 Identities = 22/77 (28%), Positives = 37/77 (48%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G+ S WRGN  NV++  P  A+ F   ++ K+  L G D++T                  
Sbjct: 284 GARSLWRGNGINVLKIAPESAIKFMAYEQIKR--LVGSDQETLRIHERLVAGSLAGAIAQ 341

Query: 428 TSLCFVYPLDFARTRLA 478
           +S   +YP++  +TR+A
Sbjct: 342 SS---IYPMEVLKTRMA 355


>AL590708-6|CAI13826.1|  313|Homo sapiens solute carrier family 25
           (mitochondrial carrier; phosphate carrier), member 25
           protein.
          Length = 313

 Score = 38.7 bits (86), Expect = 0.021
 Identities = 22/57 (38%), Positives = 35/57 (61%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           +  +AGG + AVS+T  AP++R+K+L+QV H S+         GIV  F ++ +E G
Sbjct: 222 RHLVAGGGAGAVSRTCTAPLDRLKVLMQV-HASR-----SNNMGIVGGFTQMIREGG 272



 Score = 32.3 bits (70), Expect = 1.8
 Identities = 16/42 (38%), Positives = 25/42 (59%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKT 373
           G+ S WRGN  NV++  P  A+ F   ++ K+  L G D++T
Sbjct: 272 GARSLWRGNGINVLKIAPESAIKFMAYEQIKR--LVGSDQET 311


>AL360268-5|CAH73136.1|  469|Homo sapiens solute carrier family 25
           (mitochondrial carrier; phosphate carrier), member 25
           protein.
          Length = 469

 Score = 38.7 bits (86), Expect = 0.021
 Identities = 22/57 (38%), Positives = 35/57 (61%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           +  +AGG + AVS+T  AP++R+K+L+QV H S+         GIV  F ++ +E G
Sbjct: 188 RHLVAGGGAGAVSRTCTAPLDRLKVLMQV-HASR-----SNNMGIVGGFTQMIREGG 238



 Score = 33.1 bits (72), Expect = 1.0
 Identities = 22/77 (28%), Positives = 37/77 (48%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G+ S WRGN  NV++  P  A+ F   ++ K+  L G D++T                  
Sbjct: 238 GARSLWRGNGINVLKIAPESAIKFMAYEQIKR--LVGSDQETLRIHERLVAGSLAGAIAQ 295

Query: 428 TSLCFVYPLDFARTRLA 478
           +S   +YP++  +TR+A
Sbjct: 296 SS---IYPMEVLKTRMA 309


>AL360268-4|CAH73135.1|  501|Homo sapiens solute carrier family 25
           (mitochondrial carrier; phosphate carrier), member 25
           protein.
          Length = 501

 Score = 38.7 bits (86), Expect = 0.021
 Identities = 22/57 (38%), Positives = 35/57 (61%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           +  +AGG + AVS+T  AP++R+K+L+QV H S+         GIV  F ++ +E G
Sbjct: 220 RHLVAGGGAGAVSRTCTAPLDRLKVLMQV-HASR-----SNNMGIVGGFTQMIREGG 270



 Score = 33.1 bits (72), Expect = 1.0
 Identities = 22/77 (28%), Positives = 37/77 (48%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G+ S WRGN  NV++  P  A+ F   ++ K+  L G D++T                  
Sbjct: 270 GARSLWRGNGINVLKIAPESAIKFMAYEQIKR--LVGSDQETLRIHERLVAGSLAGAIAQ 327

Query: 428 TSLCFVYPLDFARTRLA 478
           +S   +YP++  +TR+A
Sbjct: 328 SS---IYPMEVLKTRMA 341


>AL360268-3|CAH73134.1|  515|Homo sapiens solute carrier family 25
           (mitochondrial carrier; phosphate carrier), member 25
           protein.
          Length = 515

 Score = 38.7 bits (86), Expect = 0.021
 Identities = 22/57 (38%), Positives = 35/57 (61%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           +  +AGG + AVS+T  AP++R+K+L+QV H S+         GIV  F ++ +E G
Sbjct: 234 RHLVAGGGAGAVSRTCTAPLDRLKVLMQV-HASR-----SNNMGIVGGFTQMIREGG 284



 Score = 33.1 bits (72), Expect = 1.0
 Identities = 22/77 (28%), Positives = 37/77 (48%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G+ S WRGN  NV++  P  A+ F   ++ K+  L G D++T                  
Sbjct: 284 GARSLWRGNGINVLKIAPESAIKFMAYEQIKR--LVGSDQETLRIHERLVAGSLAGAIAQ 341

Query: 428 TSLCFVYPLDFARTRLA 478
           +S   +YP++  +TR+A
Sbjct: 342 SS---IYPMEVLKTRMA 355


>AL360268-2|CAH73133.1|  313|Homo sapiens solute carrier family 25
           (mitochondrial carrier; phosphate carrier), member 25
           protein.
          Length = 313

 Score = 38.7 bits (86), Expect = 0.021
 Identities = 22/57 (38%), Positives = 35/57 (61%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           +  +AGG + AVS+T  AP++R+K+L+QV H S+         GIV  F ++ +E G
Sbjct: 222 RHLVAGGGAGAVSRTCTAPLDRLKVLMQV-HASR-----SNNMGIVGGFTQMIREGG 272



 Score = 32.3 bits (70), Expect = 1.8
 Identities = 16/42 (38%), Positives = 25/42 (59%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKT 373
           G+ S WRGN  NV++  P  A+ F   ++ K+  L G D++T
Sbjct: 272 GARSLWRGNGINVLKIAPESAIKFMAYEQIKR--LVGSDQET 311


>AK222864-1|BAD96584.1|  675|Homo sapiens solute carrier family 25,
           member 13 (citrin) variant protein.
          Length = 675

 Score = 38.7 bits (86), Expect = 0.021
 Identities = 19/57 (33%), Positives = 29/57 (50%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLF 257
           F  G ++ AV  TAV PI+ VK  +Q Q  +     +  YK   D F ++ + +G F
Sbjct: 332 FGLGSVAGAVGATAVYPIDLVKTRMQNQRSTGSFVGELMYKNSFDCFKKVLRYEGFF 388



 Score = 31.9 bits (69), Expect = 2.4
 Identities = 18/54 (33%), Positives = 29/54 (53%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           LAG I+   + + V P + +K  LQV   + Q      Y G++D F +I +E+G
Sbjct: 525 LAGAIAGMPAASLVTPADVIKTRLQVAARAGQTT----YSGVIDCFRKILREEG 574


>AJ619992-1|CAF04498.1|  366|Homo sapiens small calcium-binding
           mitochondrial carrier 2 protein.
          Length = 366

 Score = 38.7 bits (86), Expect = 0.021
 Identities = 22/57 (38%), Positives = 35/57 (61%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           +  +AGG + AVS+T  AP++R+K+L+QV H S+         GIV  F ++ +E G
Sbjct: 85  RHLVAGGGAGAVSRTCTAPLDRLKVLMQV-HASR-----SNNMGIVGGFTQMIREGG 135



 Score = 33.1 bits (72), Expect = 1.0
 Identities = 22/77 (28%), Positives = 37/77 (48%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G+ S WRGN  NV++  P  A+ F   ++ K+  L G D++T                  
Sbjct: 135 GARSLWRGNGINVLKIAPESAIKFMAYEQIKR--LVGSDQETLRIHERLVAGSLAGAIAQ 192

Query: 428 TSLCFVYPLDFARTRLA 478
           +S   +YP++  +TR+A
Sbjct: 193 SS---IYPMEVLKTRMA 206


>AJ619991-1|CAF04497.1|  489|Homo sapiens small calcium-binding
           mitochondrial carrier 2 protein.
          Length = 489

 Score = 38.7 bits (86), Expect = 0.021
 Identities = 22/57 (38%), Positives = 35/57 (61%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           +  +AGG + AVS+T  AP++R+K+L+QV H S+         GIV  F ++ +E G
Sbjct: 208 RHLVAGGGAGAVSRTCTAPLDRLKVLMQV-HASR-----SNNMGIVGGFTQMIREGG 258



 Score = 33.1 bits (72), Expect = 1.0
 Identities = 22/77 (28%), Positives = 37/77 (48%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G+ S WRGN  NV++  P  A+ F   ++ K+  L G D++T                  
Sbjct: 258 GARSLWRGNGINVLKIAPESAIKFMAYEQIKR--LVGSDQETLRIHERLVAGSLAGAIAQ 315

Query: 428 TSLCFVYPLDFARTRLA 478
           +S   +YP++  +TR+A
Sbjct: 316 SS---IYPMEVLKTRMA 329


>AJ619990-1|CAF04496.1|  503|Homo sapiens small calcium-binding
           mitochondrial carrier 2 protein.
          Length = 503

 Score = 38.7 bits (86), Expect = 0.021
 Identities = 22/57 (38%), Positives = 35/57 (61%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           +  +AGG + AVS+T  AP++R+K+L+QV H S+         GIV  F ++ +E G
Sbjct: 222 RHLVAGGGAGAVSRTCTAPLDRLKVLMQV-HASR-----SNNMGIVGGFTQMIREGG 272



 Score = 33.1 bits (72), Expect = 1.0
 Identities = 22/77 (28%), Positives = 37/77 (48%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G+ S WRGN  NV++  P  A+ F   ++ K+  L G D++T                  
Sbjct: 272 GARSLWRGNGINVLKIAPESAIKFMAYEQIKR--LVGSDQETLRIHERLVAGSLAGAIAQ 329

Query: 428 TSLCFVYPLDFARTRLA 478
           +S   +YP++  +TR+A
Sbjct: 330 SS---IYPMEVLKTRMA 343


>AJ619989-1|CAF04495.1|  469|Homo sapiens small calcium-binding
           mitochondrial carrier 2 protein.
          Length = 469

 Score = 38.7 bits (86), Expect = 0.021
 Identities = 22/57 (38%), Positives = 35/57 (61%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           +  +AGG + AVS+T  AP++R+K+L+QV H S+         GIV  F ++ +E G
Sbjct: 188 RHLVAGGGAGAVSRTCTAPLDRLKVLMQV-HASR-----SNNMGIVGGFTQMIREGG 238



 Score = 33.1 bits (72), Expect = 1.0
 Identities = 22/77 (28%), Positives = 37/77 (48%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G+ S WRGN  NV++  P  A+ F   ++ K+  L G D++T                  
Sbjct: 238 GARSLWRGNGINVLKIAPESAIKFMAYEQIKR--LVGSDQETLRIHERLVAGSLAGAIAQ 295

Query: 428 TSLCFVYPLDFARTRLA 478
           +S   +YP++  +TR+A
Sbjct: 296 SS---IYPMEVLKTRMA 309


>AJ619963-1|CAF04060.1|  489|Homo sapiens mitochondrial ATP-Mg/Pi
           carrier protein.
          Length = 489

 Score = 38.7 bits (86), Expect = 0.021
 Identities = 22/57 (38%), Positives = 35/57 (61%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           +  +AGG + AVS+T  AP++R+K+L+QV H S+         GIV  F ++ +E G
Sbjct: 208 RHLVAGGGAGAVSRTCTAPLDRLKVLMQV-HASR-----SNNMGIVGGFTQMIREGG 258



 Score = 33.1 bits (72), Expect = 1.0
 Identities = 22/77 (28%), Positives = 37/77 (48%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G+ S WRGN  NV++  P  A+ F   ++ K+  L G D++T                  
Sbjct: 258 GARSLWRGNGINVLKIAPESAIKFMAYEQIKR--LVGSDQETLRIHERLVAGSLAGAIAQ 315

Query: 428 TSLCFVYPLDFARTRLA 478
           +S   +YP++  +TR+A
Sbjct: 316 SS---IYPMEVLKTRMA 329


>AJ496569-1|CAD43091.1|  676|Homo sapiens mitochondrial
           aspartate-glutamate carrier protein protein.
          Length = 676

 Score = 38.7 bits (86), Expect = 0.021
 Identities = 19/57 (33%), Positives = 29/57 (50%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLF 257
           F  G ++ AV  TAV PI+ VK  +Q Q  +     +  YK   D F ++ + +G F
Sbjct: 333 FGLGSVAGAVGATAVYPIDLVKTRMQNQRSTGSFVGELMYKNSFDCFKKVLRYEGFF 389



 Score = 31.9 bits (69), Expect = 2.4
 Identities = 18/54 (33%), Positives = 29/54 (53%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           LAG I+   + + V P + +K  LQV   + Q      Y G++D F +I +E+G
Sbjct: 526 LAGAIAGMPAASLVTPADVIKTRLQVAARAGQTT----YSGVIDCFRKILREEG 575


>AF118838-1|AAD38501.1|  675|Homo sapiens citrin protein.
          Length = 675

 Score = 38.7 bits (86), Expect = 0.021
 Identities = 19/57 (33%), Positives = 29/57 (50%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLF 257
           F  G ++ AV  TAV PI+ VK  +Q Q  +     +  YK   D F ++ + +G F
Sbjct: 332 FGLGSVAGAVGATAVYPIDLVKTRMQNQRSTGSFVGELMYKNSFDCFKKVLRYEGFF 388



 Score = 31.9 bits (69), Expect = 2.4
 Identities = 18/54 (33%), Positives = 29/54 (53%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           LAG I+   + + V P + +K  LQV   + Q      Y G++D F +I +E+G
Sbjct: 525 LAGAIAGMPAASLVTPADVIKTRLQVAARAGQTT----YSGVIDCFRKILREEG 574


>AC002450-1|AAB67049.1|  187|Homo sapiens WUGSC:H_GS244B22.1
           protein.
          Length = 187

 Score = 38.7 bits (86), Expect = 0.021
 Identities = 19/57 (33%), Positives = 29/57 (50%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLF 257
           F  G ++ AV  TAV PI+ VK  +Q Q  +     +  YK   D F ++ + +G F
Sbjct: 82  FGLGSVAGAVGATAVYPIDLVKTRMQNQRSTGSFVGELMYKNSFDCFKKVLRYEGFF 138


>AB067483-1|BAB67789.1|  568|Homo sapiens KIAA1896 protein protein.
          Length = 568

 Score = 38.7 bits (86), Expect = 0.021
 Identities = 22/57 (38%), Positives = 35/57 (61%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           +  +AGG + AVS+T  AP++R+K+L+QV H S+         GIV  F ++ +E G
Sbjct: 287 RHLVAGGGAGAVSRTCTAPLDRLKVLMQV-HASR-----SNNMGIVGGFTQMIREGG 337



 Score = 33.1 bits (72), Expect = 1.0
 Identities = 22/77 (28%), Positives = 37/77 (48%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G+ S WRGN  NV++  P  A+ F   ++ K+  L G D++T                  
Sbjct: 337 GARSLWRGNGINVLKIAPESAIKFMAYEQIKR--LVGSDQETLRIHERLVAGSLAGAIAQ 394

Query: 428 TSLCFVYPLDFARTRLA 478
           +S   +YP++  +TR+A
Sbjct: 395 SS---IYPMEVLKTRMA 408


>BC119667-1|AAI19668.1|  325|Homo sapiens solute carrier family 25
           (mitochondrial carrier, brain), member 14 protein.
          Length = 325

 Score = 38.3 bits (85), Expect = 0.027
 Identities = 22/66 (33%), Positives = 38/66 (57%), Gaps = 3/66 (4%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQ-RYKGIVDAFVRIPKEQGL- 254
           K F+ GG+++ V++    P++  K  LQVQ  S      + +Y+G+  A  RI KE+G+ 
Sbjct: 42  KPFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGVL 101

Query: 255 -FHSGV 269
             +SG+
Sbjct: 102 ALYSGI 107


>BC119666-1|AAI19667.1|  325|Homo sapiens solute carrier family 25
           (mitochondrial carrier, brain), member 14 protein.
          Length = 325

 Score = 38.3 bits (85), Expect = 0.027
 Identities = 22/66 (33%), Positives = 38/66 (57%), Gaps = 3/66 (4%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQ-RYKGIVDAFVRIPKEQGL- 254
           K F+ GG+++ V++    P++  K  LQVQ  S      + +Y+G+  A  RI KE+G+ 
Sbjct: 42  KPFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGVL 101

Query: 255 -FHSGV 269
             +SG+
Sbjct: 102 ALYSGI 107


>AY358099-1|AAQ88466.1|  325|Homo sapiens UCP5 protein.
          Length = 325

 Score = 38.3 bits (85), Expect = 0.027
 Identities = 22/66 (33%), Positives = 38/66 (57%), Gaps = 3/66 (4%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQ-RYKGIVDAFVRIPKEQGL- 254
           K F+ GG+++ V++    P++  K  LQVQ  S      + +Y+G+  A  RI KE+G+ 
Sbjct: 42  KPFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGVL 101

Query: 255 -FHSGV 269
             +SG+
Sbjct: 102 ALYSGI 107


>AL035423-3|CAB41251.1|  325|Homo sapiens solute carrier family 25
           (mitochondrial carrier, brain), member 14 protein.
          Length = 325

 Score = 38.3 bits (85), Expect = 0.027
 Identities = 22/66 (33%), Positives = 38/66 (57%), Gaps = 3/66 (4%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQ-RYKGIVDAFVRIPKEQGL- 254
           K F+ GG+++ V++    P++  K  LQVQ  S      + +Y+G+  A  RI KE+G+ 
Sbjct: 42  KPFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGVL 101

Query: 255 -FHSGV 269
             +SG+
Sbjct: 102 ALYSGI 107


>AL035423-2|CAI42439.1|  198|Homo sapiens solute carrier family 25
           (mitochondrial carrier, brain), member 14 protein.
          Length = 198

 Score = 38.3 bits (85), Expect = 0.027
 Identities = 22/66 (33%), Positives = 38/66 (57%), Gaps = 3/66 (4%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQ-RYKGIVDAFVRIPKEQGL- 254
           K F+ GG+++ V++    P++  K  LQVQ  S      + +Y+G+  A  RI KE+G+ 
Sbjct: 42  KPFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGVL 101

Query: 255 -FHSGV 269
             +SG+
Sbjct: 102 ALYSGI 107


>AF155809-1|AAG29582.1|  325|Homo sapiens mitochondrial uncoupling
           protein 5 long form protein.
          Length = 325

 Score = 38.3 bits (85), Expect = 0.027
 Identities = 22/66 (33%), Positives = 38/66 (57%), Gaps = 3/66 (4%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQ-RYKGIVDAFVRIPKEQGL- 254
           K F+ GG+++ V++    P++  K  LQVQ  S      + +Y+G+  A  RI KE+G+ 
Sbjct: 42  KPFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGVL 101

Query: 255 -FHSGV 269
             +SG+
Sbjct: 102 ALYSGI 107


>AF078544-1|AAD04346.1|  325|Homo sapiens brain mitochondrial
           carrier protein-1 protein.
          Length = 325

 Score = 38.3 bits (85), Expect = 0.027
 Identities = 22/66 (33%), Positives = 38/66 (57%), Gaps = 3/66 (4%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQ-RYKGIVDAFVRIPKEQGL- 254
           K F+ GG+++ V++    P++  K  LQVQ  S      + +Y+G+  A  RI KE+G+ 
Sbjct: 42  KPFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGVL 101

Query: 255 -FHSGV 269
             +SG+
Sbjct: 102 ALYSGI 107


>BC001656-1|AAH01656.1|  482|Homo sapiens SLC25A23 protein protein.
          Length = 482

 Score = 37.5 bits (83), Expect = 0.048
 Identities = 16/34 (47%), Positives = 25/34 (73%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSK 182
           K  +AG ++ AVS+T  AP++R+K+ +QV H SK
Sbjct: 234 KQLVAGAVAGAVSRTGTAPLDRLKVFMQV-HASK 266



 Score = 35.1 bits (77), Expect = 0.25
 Identities = 21/76 (27%), Positives = 33/76 (43%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G  S WRGN  NV++  P  A+ F   ++ K+  LG      Q   +             
Sbjct: 284 GIRSLWRGNGINVLKIAPESAIKFMAYEQIKRAILG-----QQETLHVQERFVAGSLAGA 338

Query: 428 TSLCFVYPLDFARTRL 475
           T+   +YP++  +TRL
Sbjct: 339 TAQTIIYPMEVLKTRL 354


>AY750170-1|AAU95077.1|  468|Homo sapiens mitochondrial
           Ca2+-dependent solute carrier protein 2 protein.
          Length = 468

 Score = 37.5 bits (83), Expect = 0.048
 Identities = 16/34 (47%), Positives = 25/34 (73%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSK 182
           K  +AG ++ AVS+T  AP++R+K+ +QV H SK
Sbjct: 187 KQLVAGAVAGAVSRTGTAPLDRLKVFMQV-HASK 219



 Score = 35.1 bits (77), Expect = 0.25
 Identities = 21/76 (27%), Positives = 33/76 (43%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G  S WRGN  NV++  P  A+ F   ++ K+  LG      Q   +             
Sbjct: 237 GIRSLWRGNGINVLKIAPESAIKFMAYEQIKRAILG-----QQETLHVQERFVAGSLAGA 291

Query: 428 TSLCFVYPLDFARTRL 475
           T+   +YP++  +TRL
Sbjct: 292 TAQTIIYPMEVLKTRL 307


>AK092094-1|BAC03803.1|  138|Homo sapiens protein ( Homo sapiens
           cDNA FLJ34775 fis, clone NT2NE2003315. ).
          Length = 138

 Score = 37.5 bits (83), Expect = 0.048
 Identities = 18/27 (66%), Positives = 21/27 (77%)
 Frame = -2

Query: 139 IGATAVLETAAEIPPARKSLANATGSA 59
           +GATAVLE AA  PPARKSLA  T ++
Sbjct: 1   MGATAVLEMAAATPPARKSLAKDTAAS 27


>AK054901-1|BAB70825.1|  384|Homo sapiens protein ( Homo sapiens
           cDNA FLJ30339 fis, clone BRACE2007401, moderately
           similar to Oryctolagus cuniculus peroxisomal
           Ca-dependent solute ).
          Length = 384

 Score = 37.5 bits (83), Expect = 0.048
 Identities = 16/34 (47%), Positives = 25/34 (73%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSK 182
           K  +AG ++ AVS+T  AP++R+K+ +QV H SK
Sbjct: 103 KQLVAGAVAGAVSRTGTAPLDRLKVFMQV-HASK 135



 Score = 35.1 bits (77), Expect = 0.25
 Identities = 21/76 (27%), Positives = 33/76 (43%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G  S WRGN  NV++  P  A+ F   ++ K+  LG      Q   +             
Sbjct: 153 GIRSLWRGNGINVLKIAPESAIKFMAYEQIKRAILG-----QQETLHVQERFVAGSLAGA 207

Query: 428 TSLCFVYPLDFARTRL 475
           T+   +YP++  +TRL
Sbjct: 208 TAQTIIYPMEVLKTRL 223


>AJ619988-1|CAF04494.1|  468|Homo sapiens small calcium-binding
           mitochondrial carrier 3 protein.
          Length = 468

 Score = 37.5 bits (83), Expect = 0.048
 Identities = 16/34 (47%), Positives = 25/34 (73%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSK 182
           K  +AG ++ AVS+T  AP++R+K+ +QV H SK
Sbjct: 187 KQLVAGAVAGAVSRTGTAPLDRLKVFMQV-HASK 219



 Score = 35.1 bits (77), Expect = 0.25
 Identities = 21/76 (27%), Positives = 33/76 (43%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G  S WRGN  NV++  P  A+ F   ++ K+  LG      Q   +             
Sbjct: 237 GIRSLWRGNGINVLKIAPESAIKFMAYEQIKRAILG-----QQETLHVQERFVAGSLAGA 291

Query: 428 TSLCFVYPLDFARTRL 475
           T+   +YP++  +TRL
Sbjct: 292 TAQTIIYPMEVLKTRL 307


>AJ619962-1|CAF04059.1|  468|Homo sapiens mitochondrial ATP-Mg/Pi
           carrier protein.
          Length = 468

 Score = 37.5 bits (83), Expect = 0.048
 Identities = 16/34 (47%), Positives = 25/34 (73%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSK 182
           K  +AG ++ AVS+T  AP++R+K+ +QV H SK
Sbjct: 187 KQLVAGAVAGAVSRTGTAPLDRLKVFMQV-HASK 219



 Score = 35.1 bits (77), Expect = 0.25
 Identities = 21/76 (27%), Positives = 33/76 (43%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G  S WRGN  NV++  P  A+ F   ++ K+  LG      Q   +             
Sbjct: 237 GIRSLWRGNGINVLKIAPESAIKFMAYEQIKRAILG-----QQETLHVQERFVAGSLAGA 291

Query: 428 TSLCFVYPLDFARTRL 475
           T+   +YP++  +TRL
Sbjct: 292 TAQTIIYPMEVLKTRL 307


>AJ512835-1|CAD55563.1|  438|Homo sapiens putative calcium binding
           transporter protein.
          Length = 438

 Score = 37.5 bits (83), Expect = 0.048
 Identities = 16/34 (47%), Positives = 25/34 (73%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSK 182
           K  +AG ++ AVS+T  AP++R+K+ +QV H SK
Sbjct: 187 KQLVAGAVAGAVSRTGTAPLDRLKVFMQV-HASK 219



 Score = 35.1 bits (77), Expect = 0.25
 Identities = 21/76 (27%), Positives = 33/76 (43%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G  S WRGN  NV++  P  A+ F   ++ K+  LG      Q   +             
Sbjct: 237 GIRSLWRGNGINVLKIAPESAIKFMAYEQIKRAILG-----QQETLHVQERFVAGSLAGA 291

Query: 428 TSLCFVYPLDFARTRL 475
           T+   +YP++  +TRL
Sbjct: 292 TAQTIIYPMEVLKTRL 307


>U84763-1|AAC51367.1|  312|Homo sapiens UCP3 protein.
          Length = 312

 Score = 35.5 bits (78), Expect = 0.19
 Identities = 19/65 (29%), Positives = 33/65 (50%)
 Frame = +3

Query: 60  ADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIP 239
           AD  +     LAG  + A++ T   P + VK+  Q         +D++Y G +DA+  I 
Sbjct: 111 ADNSSLTTRILAGCTTGAMAVTCAQPTDVVKVRFQASIHLGPSRSDRKYSGTMDAYRTIA 170

Query: 240 KEQGL 254
           +E+G+
Sbjct: 171 REEGV 175


>U82818-1|AAC51356.1|  275|Homo sapiens UCP3S protein.
          Length = 275

 Score = 35.5 bits (78), Expect = 0.19
 Identities = 19/65 (29%), Positives = 33/65 (50%)
 Frame = +3

Query: 60  ADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIP 239
           AD  +     LAG  + A++ T   P + VK+  Q         +D++Y G +DA+  I 
Sbjct: 111 ADNSSLTTRILAGCTTGAMAVTCAQPTDVVKVRFQASIHLGPSRSDRKYSGTMDAYRTIA 170

Query: 240 KEQGL 254
           +E+G+
Sbjct: 171 REEGV 175


>AF050113-1|AAG02284.1|  312|Homo sapiens uncoupling protein-3
           protein.
          Length = 312

 Score = 35.5 bits (78), Expect = 0.19
 Identities = 19/65 (29%), Positives = 33/65 (50%)
 Frame = +3

Query: 60  ADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIP 239
           AD  +     LAG  + A++ T   P + VK+  Q         +D++Y G +DA+  I 
Sbjct: 111 ADNSSLTTRILAGCTTGAMAVTCAQPTDVVKVRFQASIHLGPSRSDRKYSGTMDAYRTIA 170

Query: 240 KEQGL 254
           +E+G+
Sbjct: 171 REEGV 175


>AF026958-1|AAC18822.1|  312|Homo sapiens uncoupling protein 3
           protein.
          Length = 312

 Score = 35.5 bits (78), Expect = 0.19
 Identities = 19/65 (29%), Positives = 33/65 (50%)
 Frame = +3

Query: 60  ADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIP 239
           AD  +     LAG  + A++ T   P + VK+  Q         +D++Y G +DA+  I 
Sbjct: 111 ADNSSLTTRILAGCTTGAMAVTCAQPTDVVKVRFQASIHLGPSRSDRKYSGTMDAYRTIA 170

Query: 240 KEQGL 254
           +E+G+
Sbjct: 171 REEGV 175


>AF012202-1|AAC51785.1|  300|Homo sapiens uncoupling protein 3
           protein.
          Length = 300

 Score = 35.5 bits (78), Expect = 0.19
 Identities = 19/65 (29%), Positives = 33/65 (50%)
 Frame = +3

Query: 60  ADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIP 239
           AD  +     LAG  + A++ T   P + VK+  Q         +D++Y G +DA+  I 
Sbjct: 99  ADNSSLTTRILAGCTTGAMAVTCAQPTDVVKVRFQASIHLGPSRSDRKYSGTMDAYRTIA 158

Query: 240 KEQGL 254
           +E+G+
Sbjct: 159 REEGV 163


>AF011449-1|AAC51767.1|  312|Homo sapiens uncoupling protein-3
           protein.
          Length = 312

 Score = 35.5 bits (78), Expect = 0.19
 Identities = 19/65 (29%), Positives = 33/65 (50%)
 Frame = +3

Query: 60  ADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIP 239
           AD  +     LAG  + A++ T   P + VK+  Q         +D++Y G +DA+  I 
Sbjct: 111 ADNSSLTTRILAGCTTGAMAVTCAQPTDVVKVRFQASIHLGPSRSDRKYSGTMDAYRTIA 170

Query: 240 KEQGL 254
           +E+G+
Sbjct: 171 REEGV 175


>AF001787-1|AAC51369.1|  312|Homo sapiens uncoupling protein 3
           protein.
          Length = 312

 Score = 35.5 bits (78), Expect = 0.19
 Identities = 19/65 (29%), Positives = 33/65 (50%)
 Frame = +3

Query: 60  ADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIP 239
           AD  +     LAG  + A++ T   P + VK+  Q         +D++Y G +DA+  I 
Sbjct: 111 ADNSSLTTRILAGCTTGAMAVTCAQPTDVVKVRFQASIHLGPSRSDRKYSGTMDAYRTIA 170

Query: 240 KEQGL 254
           +E+G+
Sbjct: 171 REEGV 175


>CR456578-1|CAG30464.1|  315|Homo sapiens SLC25A18 protein.
          Length = 315

 Score = 34.7 bits (76), Expect = 0.34
 Identities = 18/54 (33%), Positives = 27/54 (50%)
 Frame = +3

Query: 96  GGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLF 257
           GG++  V  T V PI+  K  LQ QH          YKG++D  ++  + +G F
Sbjct: 15  GGVAGLVGVTCVFPIDLAKTRLQNQH------GKAMYKGMIDCLMKTARAEGFF 62


>BC071871-1|AAH71871.1|  341|Homo sapiens solute carrier family 25,
           member 43 protein.
          Length = 341

 Score = 34.7 bits (76), Expect = 0.34
 Identities = 21/66 (31%), Positives = 34/66 (51%), Gaps = 2/66 (3%)
 Frame = +3

Query: 63  DPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ--HVSKQIAADQRYKGIVDAFVRI 236
           D  +  ++F    ++AAV++T   P E VK  +Q Q  ++      D  + G VD F +I
Sbjct: 197 DQFSLPQNFANVCLAAAVTQTLSFPFETVKRKMQAQSPYLPHSGGVDVHFSGAVDCFRQI 256

Query: 237 PKEQGL 254
            K QG+
Sbjct: 257 VKAQGV 262


>BC031644-1|AAH31644.1|  315|Homo sapiens SLC25A18 protein protein.
          Length = 315

 Score = 34.7 bits (76), Expect = 0.34
 Identities = 18/54 (33%), Positives = 27/54 (50%)
 Frame = +3

Query: 96  GGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLF 257
           GG++  V  T V PI+  K  LQ QH          YKG++D  ++  + +G F
Sbjct: 15  GGVAGLVGVTCVFPIDLAKTRLQNQH------GKAMYKGMIDCLMKTARAEGFF 62


>BC019584-1|AAH19584.1|  341|Homo sapiens solute carrier family 25,
           member 43 protein.
          Length = 341

 Score = 34.7 bits (76), Expect = 0.34
 Identities = 21/66 (31%), Positives = 34/66 (51%), Gaps = 2/66 (3%)
 Frame = +3

Query: 63  DPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ--HVSKQIAADQRYKGIVDAFVRI 236
           D  +  ++F    ++AAV++T   P E VK  +Q Q  ++      D  + G VD F +I
Sbjct: 197 DQFSLPQNFANVCLAAAVTQTLSFPFETVKRKMQAQSPYLPHSGGVDVHFSGAVDCFRQI 256

Query: 237 PKEQGL 254
            K QG+
Sbjct: 257 VKAQGV 262


>AY008285-1|AAG22855.1|  315|Homo sapiens solute carrier protein.
          Length = 315

 Score = 34.7 bits (76), Expect = 0.34
 Identities = 18/54 (33%), Positives = 27/54 (50%)
 Frame = +3

Query: 96  GGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLF 257
           GG++  V  T V PI+  K  LQ QH          YKG++D  ++  + +G F
Sbjct: 15  GGVAGLVGVTCVFPIDLAKTRLQNQH------GKAMYKGMIDCLMKTARAEGFF 62


>AK094254-1|BAC04318.1|  289|Homo sapiens protein ( Homo sapiens
           cDNA FLJ36935 fis, clone BRACE2005363, weakly similar to
           BRITTLE-1 PROTEIN PRECURSOR. ).
          Length = 289

 Score = 34.7 bits (76), Expect = 0.34
 Identities = 21/66 (31%), Positives = 34/66 (51%), Gaps = 2/66 (3%)
 Frame = +3

Query: 63  DPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ--HVSKQIAADQRYKGIVDAFVRI 236
           D  +  ++F    ++AAV++T   P E VK  +Q Q  ++      D  + G VD F +I
Sbjct: 145 DQFSLPQNFANVCLAAAVTQTLSFPFETVKRKMQAQSPYLPHSGGVDVHFSGAVDCFRQI 204

Query: 237 PKEQGL 254
            K QG+
Sbjct: 205 VKAQGV 210


>AJ428203-1|CAD21008.1|  315|Homo sapiens glutamate carrier protein.
          Length = 315

 Score = 34.7 bits (76), Expect = 0.34
 Identities = 18/54 (33%), Positives = 27/54 (50%)
 Frame = +3

Query: 96  GGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLF 257
           GG++  V  T V PI+  K  LQ QH          YKG++D  ++  + +G F
Sbjct: 15  GGVAGLVGVTCVFPIDLAKTRLQNQH------GKAMYKGMIDCLMKTARAEGFF 62


>Y17775-1|CAB55356.1|  301|Homo sapiens carnitine/acylcarnitine
           translocase protein.
          Length = 301

 Score = 33.9 bits (74), Expect = 0.59
 Identities = 19/64 (29%), Positives = 35/64 (54%)
 Frame = +3

Query: 63  DPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPK 242
           D +++ + F AG +S   +   + P ER+K LLQ+Q  S     + +Y G +D   ++ +
Sbjct: 106 DVLSYPQLFAAGMLSGVFTTGIMTPGERIKCLLQIQASS----GESKYTGTLDCAKKLYQ 161

Query: 243 EQGL 254
           E G+
Sbjct: 162 EFGI 165


>Y10319-1|CAA71367.1|  301|Homo sapiens carnitine carrier protein.
          Length = 301

 Score = 33.9 bits (74), Expect = 0.59
 Identities = 19/64 (29%), Positives = 35/64 (54%)
 Frame = +3

Query: 63  DPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPK 242
           D +++ + F AG +S   +   + P ER+K LLQ+Q  S     + +Y G +D   ++ +
Sbjct: 106 DVLSYPQLFAAGMLSGVFTTGIMTPGERIKCLLQIQASS----GESKYTGTLDCAKKLYQ 161

Query: 243 EQGL 254
           E G+
Sbjct: 162 EFGI 165


>BC031671-1|AAH31671.1|  251|Homo sapiens SLC25A41 protein protein.
          Length = 251

 Score = 33.9 bits (74), Expect = 0.59
 Identities = 15/39 (38%), Positives = 21/39 (53%)
 Frame = +2

Query: 239 QGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLG 355
           Q  G  S WRGN  NV++  P  A+ F+  ++ K  F G
Sbjct: 22  QEGGFRSLWRGNGINVLKIAPEYAIKFSVFEQCKNYFCG 60



 Score = 31.1 bits (67), Expect = 4.1
 Identities = 17/59 (28%), Positives = 33/59 (55%)
 Frame = +3

Query: 75  FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           F +  LAG ++ A+S+T + P+E +K  L ++          +YKG++D   +I + +G
Sbjct: 67  FQERLLAGSLAVAISQTLINPMEVLKTRLTLRRTG-------QYKGLLDCARQILQREG 118


>BC001689-1|AAH01689.1|  301|Homo sapiens solute carrier family 25
           (carnitine/acylcarnitine translocase), member 20
           protein.
          Length = 301

 Score = 33.9 bits (74), Expect = 0.59
 Identities = 19/64 (29%), Positives = 35/64 (54%)
 Frame = +3

Query: 63  DPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPK 242
           D +++ + F AG +S   +   + P ER+K LLQ+Q  S     + +Y G +D   ++ +
Sbjct: 106 DVLSYPQLFAAGMLSGVFTTGIMTPGERIKCLLQIQASS----GESKYTGTLDCAKKLYQ 161

Query: 243 EQGL 254
           E G+
Sbjct: 162 EFGI 165


>AK097761-1|BAC05163.1|  232|Homo sapiens protein ( Homo sapiens
           cDNA FLJ40442 fis, clone TESTI2040102, moderately
           similar to Oryctolagus cuniculus peroxisomal
           Ca-dependent solute ).
          Length = 232

 Score = 33.9 bits (74), Expect = 0.59
 Identities = 15/39 (38%), Positives = 21/39 (53%)
 Frame = +2

Query: 239 QGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLG 355
           Q  G  S WRGN  NV++  P  A+ F+  ++ K  F G
Sbjct: 3   QEGGFRSLWRGNGINVLKIAPEYAIKFSVFEQCKNYFCG 41



 Score = 31.1 bits (67), Expect = 4.1
 Identities = 17/59 (28%), Positives = 33/59 (55%)
 Frame = +3

Query: 75  FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           F +  LAG ++ A+S+T + P+E +K  L ++          +YKG++D   +I + +G
Sbjct: 48  FQERLLAGSLAVAISQTLINPMEVLKTRLTLRRTG-------QYKGLLDCTRQILQREG 99


>BC105995-1|AAI05996.1|  300|Homo sapiens SLC25A35 protein protein.
          Length = 300

 Score = 33.5 bits (73), Expect = 0.78
 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 1/58 (1%)
 Frame = +3

Query: 84  DFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQR-YKGIVDAFVRIPKEQGL 254
           DFL  G++A  +     P+E VK  +Q+Q   +     QR Y+ +  AF+ I K  GL
Sbjct: 2   DFLMSGLAACGACVFTNPLEVVKTRMQLQGELQAPGTYQRHYRNVFHAFITIGKVDGL 59


>BC101330-1|AAI01331.1|  291|Homo sapiens SLC25A35 protein protein.
          Length = 291

 Score = 33.5 bits (73), Expect = 0.78
 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 1/58 (1%)
 Frame = +3

Query: 84  DFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQR-YKGIVDAFVRIPKEQGL 254
           DFL  G++A  +     P+E VK  +Q+Q   +     QR Y+ +  AF+ I K  GL
Sbjct: 2   DFLMSGLAACGACVFTNPLEVVKTRMQLQGELQAPGTYQRHYRNVFHAFITIGKVDGL 59


>BC101329-1|AAI01330.2|  295|Homo sapiens SLC25A35 protein protein.
          Length = 295

 Score = 33.5 bits (73), Expect = 0.78
 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 1/58 (1%)
 Frame = +3

Query: 84  DFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQR-YKGIVDAFVRIPKEQGL 254
           DFL  G++A  +     P+E VK  +Q+Q   +     QR Y+ +  AF+ I K  GL
Sbjct: 2   DFLMSGLAACGACVFTNPLEVVKTRMQLQGELQAPGTYQRHYRNVFHAFITIGKVDGL 59


>BC005120-1|AAH05120.1|  320|Homo sapiens solute carrier family 25
           (mitochondrial thiamine pyrophosphate carrier), member
           protein.
          Length = 320

 Score = 33.5 bits (73), Expect = 0.78
 Identities = 17/60 (28%), Positives = 32/60 (53%), Gaps = 3/60 (5%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQV---QHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           ++ L G  +  +SKT   P++  K  LQV   +H        +RYKG++D   ++ +++G
Sbjct: 218 QNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEG 277


>BC001075-1|AAH01075.1|  320|Homo sapiens solute carrier family 25
           (mitochondrial thiamine pyrophosphate carrier), member
           protein.
          Length = 320

 Score = 33.5 bits (73), Expect = 0.78
 Identities = 17/60 (28%), Positives = 32/60 (53%), Gaps = 3/60 (5%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQV---QHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           ++ L G  +  +SKT   P++  K  LQV   +H        +RYKG++D   ++ +++G
Sbjct: 218 QNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEG 277


>AY498866-1|AAR92153.1|  287|Homo sapiens unknown protein protein.
          Length = 287

 Score = 33.5 bits (73), Expect = 0.78
 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 1/58 (1%)
 Frame = +3

Query: 84  DFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQR-YKGIVDAFVRIPKEQGL 254
           DFL  G++A  +     P+E VK  +Q+Q   +     QR Y+ +  AF+ I K  GL
Sbjct: 2   DFLMSGLAACGACVFTNPLEVVKTRMQLQGELQAPGTYQRHYRNVFHAFITIGKVDGL 59


>AY346372-1|AAQ54327.1|  263|Homo sapiens solute carrier family 25
           member 19 protein.
          Length = 263

 Score = 33.5 bits (73), Expect = 0.78
 Identities = 17/60 (28%), Positives = 32/60 (53%), Gaps = 3/60 (5%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQV---QHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           ++ L G  +  +SKT   P++  K  LQV   +H        +RYKG++D   ++ +++G
Sbjct: 161 QNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEG 220


>AK097536-1|BAC05091.1|  295|Homo sapiens protein ( Homo sapiens
           cDNA FLJ40217 fis, clone TESTI2021425, weakly similar to
           MITOCHONDRIAL CARRIER PROTEIN PMT. ).
          Length = 295

 Score = 33.5 bits (73), Expect = 0.78
 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 1/58 (1%)
 Frame = +3

Query: 84  DFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQR-YKGIVDAFVRIPKEQGL 254
           DFL  G++A  +     P+E VK  +Q+Q   +     QR Y+ +  AF+ I K  GL
Sbjct: 2   DFLMSGLAACGACVFTNPLEVVKTRMQLQGELQAPGTYQRHYRNVFHAFITIGKVDGL 59


>AK075239-1|BAC11492.1|  320|Homo sapiens protein ( Homo sapiens
           cDNA FLJ90758 fis, clone SKNMC1000082, highly similar to
           Mitochondrial deoxynucleotide carrier. ).
          Length = 320

 Score = 33.5 bits (73), Expect = 0.78
 Identities = 17/60 (28%), Positives = 32/60 (53%), Gaps = 3/60 (5%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQV---QHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           ++ L G  +  +SKT   P++  K  LQV   +H        +RYKG++D   ++ +++G
Sbjct: 218 QNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEG 277


>AJ301616-1|CAC37793.1|  320|Homo sapiens deoxynucleotide carrier
           protein.
          Length = 320

 Score = 33.5 bits (73), Expect = 0.78
 Identities = 17/60 (28%), Positives = 32/60 (53%), Gaps = 3/60 (5%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQV---QHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           ++ L G  +  +SKT   P++  K  LQV   +H        +RYKG++D   ++ +++G
Sbjct: 218 QNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEG 277


>AJ251857-1|CAC27560.1|  320|Homo sapiens thiamine pyrophosphate
           carrier protein.
          Length = 320

 Score = 33.5 bits (73), Expect = 0.78
 Identities = 17/60 (28%), Positives = 32/60 (53%), Gaps = 3/60 (5%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQV---QHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           ++ L G  +  +SKT   P++  K  LQV   +H        +RYKG++D   ++ +++G
Sbjct: 218 QNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEG 277


>AF182404-1|AAG16903.1|  320|Homo sapiens mitochondrial uncoupling
           protein 1 protein.
          Length = 320

 Score = 33.5 bits (73), Expect = 0.78
 Identities = 17/60 (28%), Positives = 32/60 (53%), Gaps = 3/60 (5%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQV---QHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           ++ L G  +  +SKT   P++  K  LQV   +H        +RYKG++D   ++ +++G
Sbjct: 218 QNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEG 277


>Z98048-2|CAI20491.1|  307|Homo sapiens solute carrier family 25
           (mitochondrial carrier; peroxisomal membrane protein,
           protein.
          Length = 307

 Score = 32.7 bits (71), Expect = 1.4
 Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 2/60 (3%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAP--IERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           KD + G ++  V+     P  +   +L LQ      +      YKGI+DAF +I +++G+
Sbjct: 103 KDLVVGFVAGVVNVLLTTPLWVVNTRLKLQGAKFRNEDIVPTNYKGIIDAFHQIIRDEGI 162


>Y12860-1|CAA73367.1|  307|Homo sapiens peroxisomal integral
           membrane protein protein.
          Length = 307

 Score = 32.7 bits (71), Expect = 1.4
 Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 2/60 (3%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAP--IERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           KD + G ++  V+     P  +   +L LQ      +      YKGI+DAF +I +++G+
Sbjct: 103 KDLVVGFVAGVVNVLLTTPLWVVNTRLKLQGAKFRNEDIVPTNYKGIIDAFHQIIRDEGI 162


>CR456577-1|CAG30463.1|  307|Homo sapiens SLC25A17 protein.
          Length = 307

 Score = 32.7 bits (71), Expect = 1.4
 Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 2/60 (3%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAP--IERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           KD + G ++  V+     P  +   +L LQ      +      YKGI+DAF +I +++G+
Sbjct: 103 KDLVVGFVAGVVNVLLTTPLWVVNTRLKLQGAKFRNEDIVPTNYKGIIDAFHQIIRDEGI 162


>BC012998-1|AAH12998.1|  307|Homo sapiens solute carrier family 25
           (mitochondrial carrier; peroxisomal membrane protein,
           protein.
          Length = 307

 Score = 32.7 bits (71), Expect = 1.4
 Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 2/60 (3%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAP--IERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           KD + G ++  V+     P  +   +L LQ      +      YKGI+DAF +I +++G+
Sbjct: 103 KDLVVGFVAGVVNVLLTTPLWVVNTRLKLQGAKFRNEDIVPTNYKGIIDAFHQIIRDEGI 162


>BC005957-1|AAH05957.1|  307|Homo sapiens solute carrier family 25
           (mitochondrial carrier; peroxisomal membrane protein,
           protein.
          Length = 307

 Score = 32.7 bits (71), Expect = 1.4
 Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 2/60 (3%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAP--IERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           KD + G ++  V+     P  +   +L LQ      +      YKGI+DAF +I +++G+
Sbjct: 103 KDLVVGFVAGVVNVLLTTPLWVVNTRLKLQGAKFRNEDIVPTNYKGIIDAFHQIIRDEGI 162


>AL049764-1|CAI20333.1|  307|Homo sapiens solute carrier family 25
           (mitochondrial carrier; peroxisomal membrane protein,
           protein.
          Length = 307

 Score = 32.7 bits (71), Expect = 1.4
 Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 2/60 (3%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAP--IERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           KD + G ++  V+     P  +   +L LQ      +      YKGI+DAF +I +++G+
Sbjct: 103 KDLVVGFVAGVVNVLLTTPLWVVNTRLKLQGAKFRNEDIVPTNYKGIIDAFHQIIRDEGI 162


>X96924-1|CAA65633.1|  318|Homo sapiens mitochondrial citrate
           transport protein protein.
          Length = 318

 Score = 31.9 bits (69), Expect = 2.4
 Identities = 10/23 (43%), Positives = 18/23 (78%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRG 579
           + G+G+C+ +  +S G++GLYRG
Sbjct: 71  YRGIGDCVRQTVRSHGVLGLYRG 93


>U25147-1|AAB08515.1|  311|Homo sapiens citrate transporter protein
           protein.
          Length = 311

 Score = 31.9 bits (69), Expect = 2.4
 Identities = 10/23 (43%), Positives = 18/23 (78%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRG 579
           + G+G+C+ +  +S G++GLYRG
Sbjct: 64  YRGIGDCVRQTVRSHGVLGLYRG 86


>L76134-1|AAL40091.1|  311|Homo sapiens citrate transport protein
           protein.
          Length = 311

 Score = 31.9 bits (69), Expect = 2.4
 Identities = 10/23 (43%), Positives = 18/23 (78%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRG 579
           + G+G+C+ +  +S G++GLYRG
Sbjct: 64  YRGIGDCVRQTVRSHGVLGLYRG 86


>L75823-1|AAL40090.1|  311|Homo sapiens citrate transport protein
           protein.
          Length = 311

 Score = 31.9 bits (69), Expect = 2.4
 Identities = 10/23 (43%), Positives = 18/23 (78%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRG 579
           + G+G+C+ +  +S G++GLYRG
Sbjct: 64  YRGIGDCVRQTVRSHGVLGLYRG 86


>BC113365-1|AAI13366.1|  299|Homo sapiens solute carrier family 25
           (mitochondrial oxodicarboxylate carrier), member 21
           protein.
          Length = 299

 Score = 31.9 bits (69), Expect = 2.4
 Identities = 18/60 (30%), Positives = 31/60 (51%)
 Frame = +3

Query: 78  AKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLF 257
           ++  +AGG +  V    + P++ VK   Q+Q  +        YK +VD+F  I + +GLF
Sbjct: 14  SRQIVAGGSAGLVEICLMHPLDVVKTRFQIQRCATD---PNSYKSLVDSFRMIFQMEGLF 70


>BC101521-1|AAI01522.1|  299|Homo sapiens solute carrier family 25
           (mitochondrial oxodicarboxylate carrier), member 21
           protein.
          Length = 299

 Score = 31.9 bits (69), Expect = 2.4
 Identities = 18/60 (30%), Positives = 31/60 (51%)
 Frame = +3

Query: 78  AKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLF 257
           ++  +AGG +  V    + P++ VK   Q+Q  +        YK +VD+F  I + +GLF
Sbjct: 14  SRQIVAGGSAGLVEICLMHPLDVVKTRFQIQRCATD---PNSYKSLVDSFRMIFQMEGLF 70


>BC008061-1|AAH08061.1|  311|Homo sapiens solute carrier family 25
           (mitochondrial carrier; citrate transporter), member 1
           protein.
          Length = 311

 Score = 31.9 bits (69), Expect = 2.4
 Identities = 10/23 (43%), Positives = 18/23 (78%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRG 579
           + G+G+C+ +  +S G++GLYRG
Sbjct: 64  YRGIGDCVRQTVRSHGVLGLYRG 86


>BC004980-1|AAH04980.1|  311|Homo sapiens solute carrier family 25
           (mitochondrial carrier; citrate transporter), member 1
           protein.
          Length = 311

 Score = 31.9 bits (69), Expect = 2.4
 Identities = 10/23 (43%), Positives = 18/23 (78%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRG 579
           + G+G+C+ +  +S G++GLYRG
Sbjct: 64  YRGIGDCVRQTVRSHGVLGLYRG 86


>AJ278148-1|CAC27562.1|  299|Homo sapiens oxodicarboxylate carrier
           protein.
          Length = 299

 Score = 31.9 bits (69), Expect = 2.4
 Identities = 18/60 (30%), Positives = 31/60 (51%)
 Frame = +3

Query: 78  AKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLF 257
           ++  +AGG +  V    + P++ VK   Q+Q  +        YK +VD+F  I + +GLF
Sbjct: 14  SRQIVAGGSAGLVEICLMHPLDVVKTRFQIQRCATD---PNSYKSLVDSFRMIFQMEGLF 70


>AC002540-1|AAB70112.1|  238|Homo sapiens unknown protein.
          Length = 238

 Score = 31.9 bits (69), Expect = 2.4
 Identities = 18/54 (33%), Positives = 29/54 (53%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           LAG I+   + + V P + +K  LQV   + Q      Y G++D F +I +E+G
Sbjct: 88  LAGAIAGMPAASLVTPADVIKTRLQVAARAGQTT----YSGVIDCFRKILREEG 137


>AB058756-1|BAB47482.1|  708|Homo sapiens KIAA1853 protein protein.
          Length = 708

 Score = 31.5 bits (68), Expect = 3.1
 Identities = 21/81 (25%), Positives = 36/81 (44%), Gaps = 2/81 (2%)
 Frame = -1

Query: 584 PKPLYRPIRPSDLKILLMQ-FPRPENYAGHLPYRHRRRDGYVRSRGGTRSTERWLRRHHR 408
           P P+ +  + S  K    + F +   ++   P   RR +   + +  +R  +    RHHR
Sbjct: 225 PSPVKKKKKKSSKKHKRRRSFSKKRRHSSSSPKSKRRDEKRHKKQSRSRPRKSHRHRHHR 284

Query: 407 RPDYQRSNARTASSCQ-RRRG 348
            P   +S+    SSC+ R RG
Sbjct: 285 CPSRSQSSESRPSSCESRHRG 305


>X77337-1|CAB56611.1|  362|Homo sapiens phosphate carrier protein.
          Length = 362

 Score = 31.1 bits (67), Expect = 4.1
 Identities = 20/55 (36%), Positives = 28/55 (50%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           L G IS   + TA+ P++ VK  +QV          Q+YKGI + F    KE G+
Sbjct: 70  LGGIISCGTTHTALVPLDLVKCRMQVD--------PQKYKGIFNGFSVTLKEDGV 116


>M74089-1|AAA03587.1|  434|Homo sapiens TB1 protein.
          Length = 434

 Score = 31.1 bits (67), Expect = 4.1
 Identities = 10/25 (40%), Positives = 18/25 (72%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGFG 585
           + G+ +CI+ I + +G+ G Y+GFG
Sbjct: 385 YEGMRDCINTIRQEEGVFGFYKGFG 409


>BC017169-1|AAH17169.1|  418|Homo sapiens solute carrier family 25,
           member 46 protein.
          Length = 418

 Score = 31.1 bits (67), Expect = 4.1
 Identities = 10/25 (40%), Positives = 18/25 (72%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGFG 585
           + G+ +CI+ I + +G+ G Y+GFG
Sbjct: 366 YEGMRDCINTIRQEEGVFGFYKGFG 390


>AK172788-1|BAD18767.1|  303|Homo sapiens protein ( Homo sapiens
           cDNA FLJ23949 fis, clone HEP08438. ).
          Length = 303

 Score = 31.1 bits (67), Expect = 4.1
 Identities = 20/59 (33%), Positives = 28/59 (47%)
 Frame = +3

Query: 78  AKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           A DFLAG            P + VK+ LQVQ V K      +Y+G +  F  I K++ +
Sbjct: 2   ALDFLAGCAGGVAGVLVGHPFDTVKVRLQVQSVEK-----PQYRGTLHCFKSIIKQESV 55



 Score = 30.3 bits (65), Expect = 7.3
 Identities = 18/56 (32%), Positives = 26/56 (46%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           FLAG  + A+      P+E  K  LQ+Q         + YKG +D   +I   +GL
Sbjct: 96  FLAGAAAGAIQCVICCPMELAKTRLQLQDAGPA----RTYKGSLDCLAQIYGHEGL 147


>X77337-2|CAB56612.1|  361|Homo sapiens phosphate carrier protein.
          Length = 361

 Score = 30.7 bits (66), Expect = 5.5
 Identities = 19/53 (35%), Positives = 28/53 (52%)
 Frame = +3

Query: 96  GGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           G +S  ++ TAV P++ VK  +QV          Q+YKGI + F    KE G+
Sbjct: 71  GVLSCGLTHTAVVPLDLVKCRMQVD--------PQKYKGIFNGFSVTLKEDGV 115


>X60036-1|CAA42641.1|  361|Homo sapiens phosphate carrier protein
           protein.
          Length = 361

 Score = 30.7 bits (66), Expect = 5.5
 Identities = 19/53 (35%), Positives = 28/53 (52%)
 Frame = +3

Query: 96  GGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           G +S  ++ TAV P++ VK  +QV          Q+YKGI + F    KE G+
Sbjct: 71  GVLSCGLTHTAVVPLDLVKCRMQVD--------PQKYKGIFNGFSVTLKEDGV 115


>BC051367-1|AAH51367.2|  361|Homo sapiens solute carrier family 25
           (mitochondrial carrier; phosphate carrier), member 3
           protein.
          Length = 361

 Score = 30.7 bits (66), Expect = 5.5
 Identities = 19/53 (35%), Positives = 28/53 (52%)
 Frame = +3

Query: 96  GGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           G +S  ++ TAV P++ VK  +QV          Q+YKGI + F    KE G+
Sbjct: 71  GVLSCGLTHTAVVPLDLVKCRMQVD--------PQKYKGIFNGFSVTLKEDGV 115


>BC015379-1|AAH15379.2|  360|Homo sapiens SLC25A3 protein protein.
          Length = 360

 Score = 30.7 bits (66), Expect = 5.5
 Identities = 19/53 (35%), Positives = 28/53 (52%)
 Frame = +3

Query: 96  GGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           G +S  ++ TAV P++ VK  +QV          Q+YKGI + F    KE G+
Sbjct: 70  GVLSCGLTHTAVVPLDLVKCRMQVD--------PQKYKGIFNGFSVTLKEDGV 114


>BC014019-1|AAH14019.1|  361|Homo sapiens solute carrier family 25
           (mitochondrial carrier; phosphate carrier), member 3
           protein.
          Length = 361

 Score = 30.7 bits (66), Expect = 5.5
 Identities = 19/53 (35%), Positives = 28/53 (52%)
 Frame = +3

Query: 96  GGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           G +S  ++ TAV P++ VK  +QV          Q+YKGI + F    KE G+
Sbjct: 71  GVLSCGLTHTAVVPLDLVKCRMQVD--------PQKYKGIFNGFSVTLKEDGV 115


>BC011641-1|AAH11641.1|  361|Homo sapiens solute carrier family 25
           (mitochondrial carrier; phosphate carrier), member 3
           protein.
          Length = 361

 Score = 30.7 bits (66), Expect = 5.5
 Identities = 19/53 (35%), Positives = 28/53 (52%)
 Frame = +3

Query: 96  GGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           G +S  ++ TAV P++ VK  +QV          Q+YKGI + F    KE G+
Sbjct: 71  GVLSCGLTHTAVVPLDLVKCRMQVD--------PQKYKGIFNGFSVTLKEDGV 115


>BC011574-1|AAH11574.1|  361|Homo sapiens solute carrier family 25
           (mitochondrial carrier; phosphate carrier), member 3
           protein.
          Length = 361

 Score = 30.7 bits (66), Expect = 5.5
 Identities = 19/53 (35%), Positives = 28/53 (52%)
 Frame = +3

Query: 96  GGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           G +S  ++ TAV P++ VK  +QV          Q+YKGI + F    KE G+
Sbjct: 71  GVLSCGLTHTAVVPLDLVKCRMQVD--------PQKYKGIFNGFSVTLKEDGV 115


>BC006455-1|AAH06455.1|  361|Homo sapiens solute carrier family 25
           (mitochondrial carrier; phosphate carrier), member 3
           protein.
          Length = 361

 Score = 30.7 bits (66), Expect = 5.5
 Identities = 19/53 (35%), Positives = 28/53 (52%)
 Frame = +3

Query: 96  GGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           G +S  ++ TAV P++ VK  +QV          Q+YKGI + F    KE G+
Sbjct: 71  GVLSCGLTHTAVVPLDLVKCRMQVD--------PQKYKGIFNGFSVTLKEDGV 115


>BC004345-1|AAH04345.1|  361|Homo sapiens solute carrier family 25
           (mitochondrial carrier; phosphate carrier), member 3
           protein.
          Length = 361

 Score = 30.7 bits (66), Expect = 5.5
 Identities = 19/53 (35%), Positives = 28/53 (52%)
 Frame = +3

Query: 96  GGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           G +S  ++ TAV P++ VK  +QV          Q+YKGI + F    KE G+
Sbjct: 71  GVLSCGLTHTAVVPLDLVKCRMQVD--------PQKYKGIFNGFSVTLKEDGV 115


>BC003504-1|AAH03504.1|  361|Homo sapiens solute carrier family 25
           (mitochondrial carrier; phosphate carrier), member 3
           protein.
          Length = 361

 Score = 30.7 bits (66), Expect = 5.5
 Identities = 19/53 (35%), Positives = 28/53 (52%)
 Frame = +3

Query: 96  GGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           G +S  ++ TAV P++ VK  +QV          Q+YKGI + F    KE G+
Sbjct: 71  GVLSCGLTHTAVVPLDLVKCRMQVD--------PQKYKGIFNGFSVTLKEDGV 115


>BC001328-1|AAH01328.1|  361|Homo sapiens solute carrier family 25
           (mitochondrial carrier; phosphate carrier), member 3
           protein.
          Length = 361

 Score = 30.7 bits (66), Expect = 5.5
 Identities = 19/53 (35%), Positives = 28/53 (52%)
 Frame = +3

Query: 96  GGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           G +S  ++ TAV P++ VK  +QV          Q+YKGI + F    KE G+
Sbjct: 71  GVLSCGLTHTAVVPLDLVKCRMQVD--------PQKYKGIFNGFSVTLKEDGV 115


>BC000998-1|AAH00998.1|  361|Homo sapiens solute carrier family 25
           (mitochondrial carrier; phosphate carrier), member 3
           protein.
          Length = 361

 Score = 30.7 bits (66), Expect = 5.5
 Identities = 19/53 (35%), Positives = 28/53 (52%)
 Frame = +3

Query: 96  GGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           G +S  ++ TAV P++ VK  +QV          Q+YKGI + F    KE G+
Sbjct: 71  GVLSCGLTHTAVVPLDLVKCRMQVD--------PQKYKGIFNGFSVTLKEDGV 115


>AY261384-1|AAO84265.1|  370|Homo sapiens lysosome-associated
           transmembrane protein 4 beta protein.
          Length = 370

 Score = 30.7 bits (66), Expect = 5.5
 Identities = 20/65 (30%), Positives = 29/65 (44%)
 Frame = -1

Query: 458 SRGGTRSTERWLRRHHRRPDYQRSNARTASSCQRRRGTPACTCP*RRS*APGSGST**RW 279
           SRG   +  R   R  R P+ +RS  +     Q RR T   TC   R+ APG+      W
Sbjct: 92  SRGIEEAGPRAHGRAGREPERRRSRQQRRGGLQARRSTLLKTCARARATAPGAMKMVAPW 151

Query: 278 RSYHA 264
             +++
Sbjct: 152 TRFYS 156


>AY219177-1|AAO64359.1|  124|Homo sapiens lysosome-associated
           protein transmembrane 4 beta protein.
          Length = 124

 Score = 30.7 bits (66), Expect = 5.5
 Identities = 20/65 (30%), Positives = 29/65 (44%)
 Frame = -1

Query: 458 SRGGTRSTERWLRRHHRRPDYQRSNARTASSCQRRRGTPACTCP*RRS*APGSGST**RW 279
           SRG   +  R   R  R P+ +RS  +     Q RR T   TC   R+ APG+      W
Sbjct: 39  SRGIEEAGPRAHGRAGREPERRRSRQQRRGGLQARRSTLLKTCARARATAPGAMKMVAPW 98

Query: 278 RSYHA 264
             +++
Sbjct: 99  TRFYS 103


>AY219176-1|AAO64358.1|  124|Homo sapiens lysosome-associated
           protein transmembrane 4 beta protein.
          Length = 124

 Score = 30.7 bits (66), Expect = 5.5
 Identities = 20/65 (30%), Positives = 29/65 (44%)
 Frame = -1

Query: 458 SRGGTRSTERWLRRHHRRPDYQRSNARTASSCQRRRGTPACTCP*RRS*APGSGST**RW 279
           SRG   +  R   R  R P+ +RS  +     Q RR T   TC   R+ APG+      W
Sbjct: 39  SRGIEEAGPRAHGRAGREPERRRSRQQRRGGLQARRSTLLKTCARARATAPGAMKMVAPW 98

Query: 278 RSYHA 264
             +++
Sbjct: 99  TRFYS 103


>AY198226-1|AAO63563.1|  124|Homo sapiens LAPTM4B protein.
          Length = 124

 Score = 30.7 bits (66), Expect = 5.5
 Identities = 20/65 (30%), Positives = 29/65 (44%)
 Frame = -1

Query: 458 SRGGTRSTERWLRRHHRRPDYQRSNARTASSCQRRRGTPACTCP*RRS*APGSGST**RW 279
           SRG   +  R   R  R P+ +RS  +     Q RR T   TC   R+ APG+      W
Sbjct: 39  SRGIEEAGPRAHGRAGREPERRRSRQQRRGGLQARRSTLLKTCARARATAPGAMKMVAPW 98

Query: 278 RSYHA 264
             +++
Sbjct: 99  TRFYS 103


>AY057051-1|AAL17908.2|  317|Homo sapiens lysosomal associated
           transmembrane protein 4 beta, variant 1 protein.
          Length = 317

 Score = 30.7 bits (66), Expect = 5.5
 Identities = 20/65 (30%), Positives = 29/65 (44%)
 Frame = -1

Query: 458 SRGGTRSTERWLRRHHRRPDYQRSNARTASSCQRRRGTPACTCP*RRS*APGSGST**RW 279
           SRG   +  R   R  R P+ +RS  +     Q RR T   TC   R+ APG+      W
Sbjct: 39  SRGIEEAGPRAHGRAGREPERRRSRQQRRGGLQARRSTLLKTCARARATAPGAMKMVAPW 98

Query: 278 RSYHA 264
             +++
Sbjct: 99  TRFYS 103


>AK222658-1|BAD96378.1|  361|Homo sapiens solute carrier family 25
           member 3 isoform b precursor variant protein.
          Length = 361

 Score = 30.7 bits (66), Expect = 5.5
 Identities = 19/53 (35%), Positives = 28/53 (52%)
 Frame = +3

Query: 96  GGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           G +S  ++ TAV P++ VK  +QV          Q+YKGI + F    KE G+
Sbjct: 71  GVLSCGLTHTAVVPLDLVKCRMQVD--------PQKYKGIFNGFSVTLKEDGV 115


>AK074759-1|BAC11187.1|  361|Homo sapiens protein ( Homo sapiens
           cDNA FLJ90278 fis, clone NT2RP1000325, highly similar to
           Phosphate carrier protein, mitochondrialprecursor. ).
          Length = 361

 Score = 30.7 bits (66), Expect = 5.5
 Identities = 19/53 (35%), Positives = 28/53 (52%)
 Frame = +3

Query: 96  GGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           G +S  ++ TAV P++ VK  +QV          Q+YKGI + F    KE G+
Sbjct: 71  GVLSCGLTHTAVVPLDLVKCRMQVD--------PQKYKGIFNGFSVTLKEDGV 115


>AF527412-1|AAP14034.1|  317|Homo sapiens lysosomal associated
           transmembrane protein 4 beta variant 2 protein.
          Length = 317

 Score = 30.7 bits (66), Expect = 5.5
 Identities = 20/65 (30%), Positives = 29/65 (44%)
 Frame = -1

Query: 458 SRGGTRSTERWLRRHHRRPDYQRSNARTASSCQRRRGTPACTCP*RRS*APGSGST**RW 279
           SRG   +  R   R  R P+ +RS  +     Q RR T   TC   R+ APG+      W
Sbjct: 39  SRGIEEAGPRAHGRAGREPERRRSRQQRRGGLQARRSTLLKTCARARATAPGAMKMVAPW 98

Query: 278 RSYHA 264
             +++
Sbjct: 99  TRFYS 103


>AB064666-1|BAB93517.1|  361|Homo sapiens OK/SW-CL.48 protein.
          Length = 361

 Score = 30.7 bits (66), Expect = 5.5
 Identities = 19/53 (35%), Positives = 28/53 (52%)
 Frame = +3

Query: 96  GGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           G +S  ++ TAV P++ VK  +QV          Q+YKGI + F    KE G+
Sbjct: 71  GVLSCGLTHTAVVPLDLVKCRMQVD--------PQKYKGIFNGFSVTLKEDGV 115


>U70824-1|AAC24726.1|  440|Homo sapiens BLu protein protein.
          Length = 440

 Score = 30.3 bits (65), Expect = 7.3
 Identities = 9/16 (56%), Positives = 12/16 (75%)
 Frame = +2

Query: 602 HHLPCLILRFLRHCPW 649
           H+LPCL++  L H PW
Sbjct: 213 HNLPCLLVELLEHSPW 228


>BC132966-1|AAI32967.1|  237|Homo sapiens SLC25A29 protein protein.
          Length = 237

 Score = 30.3 bits (65), Expect = 7.3
 Identities = 18/56 (32%), Positives = 26/56 (46%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           FLAG  + A+      P+E  K  LQ+Q         + YKG +D   +I   +GL
Sbjct: 30  FLAGAAAGAIQCVICCPMELAKTRLQLQDAGPA----RTYKGSLDCLAQIYGHEGL 81


>BC132964-1|AAI32965.1|  237|Homo sapiens SLC25A29 protein protein.
          Length = 237

 Score = 30.3 bits (65), Expect = 7.3
 Identities = 18/56 (32%), Positives = 26/56 (46%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           FLAG  + A+      P+E  K  LQ+Q         + YKG +D   +I   +GL
Sbjct: 30  FLAGAAAGAIQCVICCPMELAKTRLQLQDAGPA----RTYKGSLDCLAQIYGHEGL 81


>BC033732-1|AAH33732.1|  440|Homo sapiens zinc finger, MYND-type
           containing 10 protein.
          Length = 440

 Score = 30.3 bits (65), Expect = 7.3
 Identities = 9/16 (56%), Positives = 12/16 (75%)
 Frame = +2

Query: 602 HHLPCLILRFLRHCPW 649
           H+LPCL++  L H PW
Sbjct: 213 HNLPCLLVELLEHSPW 228


>BC021893-1|AAH21893.1|  315|Homo sapiens solute carrier family 25,
           member 32 protein.
          Length = 315

 Score = 30.3 bits (65), Expect = 7.3
 Identities = 11/23 (47%), Positives = 19/23 (82%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRG 579
           ++G+ +C++ I+K DGL GLY+G
Sbjct: 62  YNGILHCLTTIWKLDGLRGLYQG 84


>AL833828-1|CAD38688.1|  440|Homo sapiens hypothetical protein
           protein.
          Length = 440

 Score = 30.3 bits (65), Expect = 7.3
 Identities = 9/16 (56%), Positives = 12/16 (75%)
 Frame = +2

Query: 602 HHLPCLILRFLRHCPW 649
           H+LPCL++  L H PW
Sbjct: 213 HNLPCLLVELLEHSPW 228


>AK223343-1|BAD97063.1|  440|Homo sapiens zinc finger, MYND
           domain-containing 10 variant protein.
          Length = 440

 Score = 30.3 bits (65), Expect = 7.3
 Identities = 9/16 (56%), Positives = 12/16 (75%)
 Frame = +2

Query: 602 HHLPCLILRFLRHCPW 649
           H+LPCL++  L H PW
Sbjct: 213 HNLPCLLVELLEHSPW 228


>AK096294-1|BAC04751.1|  237|Homo sapiens protein ( Homo sapiens
           cDNA FLJ38975 fis, clone NT2RI2004093, weakly similar to
           MITOCHONDRIAL CARRIER PROTEIN YMC2 PRECURSOR. ).
          Length = 237

 Score = 30.3 bits (65), Expect = 7.3
 Identities = 18/56 (32%), Positives = 26/56 (46%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           FLAG  + A+      P+E  K  LQ+Q         + YKG +D   +I   +GL
Sbjct: 30  FLAGAAAGAIQCVICCPMELAKTRLQLQDAGPA----RTYKGSLDCLAQIYGHEGL 81


>AK027787-1|BAB55368.1|  315|Homo sapiens protein ( Homo sapiens
           cDNA FLJ14881 fis, clone PLACE1003420, weakly similar to
           PUTATIVE MITOCHONDRIAL CARRIER YIL006W. ).
          Length = 315

 Score = 30.3 bits (65), Expect = 7.3
 Identities = 11/23 (47%), Positives = 19/23 (82%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRG 579
           ++G+ +C++ I+K DGL GLY+G
Sbjct: 62  YNGILHCLTTIWKLDGLRGLYQG 84


>AK027531-1|BAB55180.1|  315|Homo sapiens protein ( Homo sapiens
           cDNA FLJ14625 fis, clone NT2RP2000257, weakly similar to
           PUTATIVE MITOCHONDRIAL CARRIER YIL006W. ).
          Length = 315

 Score = 30.3 bits (65), Expect = 7.3
 Identities = 11/23 (47%), Positives = 19/23 (82%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRG 579
           ++G+ +C++ I+K DGL GLY+G
Sbjct: 62  YNGILHCLTTIWKLDGLRGLYQG 84


>AF283645-1|AAG37834.1|  315|Homo sapiens folate transporter/carrier
           protein.
          Length = 315

 Score = 30.3 bits (65), Expect = 7.3
 Identities = 11/23 (47%), Positives = 19/23 (82%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRG 579
           ++G+ +C++ I+K DGL GLY+G
Sbjct: 62  YNGILHCLTTIWKLDGLRGLYQG 84


>U53209-1|AAC50658.1|  282|Homo sapiens transformer-2 alpha protein.
          Length = 282

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 17/46 (36%), Positives = 22/46 (47%)
 Frame = -1

Query: 488 RHRRRDGYVRSRGGTRSTERWLRRHHRRPDYQRSNARTASSCQRRR 351
           RH  R  Y RSR  + S  R  R     P+Y+R  +R+ S    RR
Sbjct: 62  RHSHRR-YTRSRSHSHSHRRRSRSRSYTPEYRRRRSRSHSPMSNRR 106


>BC117184-1|AAI17185.1| 1388|Homo sapiens retrotransposon gag domain
           containing 1 protein.
          Length = 1388

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 23/77 (29%), Positives = 35/77 (45%)
 Frame = -2

Query: 286 DVGEVTTPE*KRPCSLGMRTKASTIPL*RWSAAICLLTCCTWSSSLTRSIGATAVLETAA 107
           D G ++TP    P S  M T   T+P    +    L+T  +     T  + ATA    +A
Sbjct: 407 DSGAMSTPLMGAPASGNMSTLQKTVPA-SGAMTTSLMTVPSSGVMSTEQMSATASRVMSA 465

Query: 106 EIPPARKSLANATGSAR 56
           ++  A+ S A  TGS +
Sbjct: 466 QLTMAKTSGAMPTGSMK 482


>BC113670-1|AAI13671.1| 1388|Homo sapiens retrotransposon gag domain
           containing 1 protein.
          Length = 1388

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 23/77 (29%), Positives = 35/77 (45%)
 Frame = -2

Query: 286 DVGEVTTPE*KRPCSLGMRTKASTIPL*RWSAAICLLTCCTWSSSLTRSIGATAVLETAA 107
           D G ++TP    P S  M T   T+P    +    L+T  +     T  + ATA    +A
Sbjct: 407 DSGAMSTPLMGAPASGNMSTLQKTVPA-SGAMTTSLMTVPSSGVMSTEQMSATASRVMSA 465

Query: 106 EIPPARKSLANATGSAR 56
           ++  A+ S A  TGS +
Sbjct: 466 QLTMAKTSGAMPTGSMK 482


>BC105006-1|AAI05007.1|  312|Homo sapiens PRP38 pre-mRNA processing
           factor 38 (yeast) domain containing A, isoform 2
           protein.
          Length = 312

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 21/60 (35%), Positives = 28/60 (46%), Gaps = 1/60 (1%)
 Frame = -1

Query: 524 PRPENYAGHLPYRHRRRDGYVRSRGGTRSTERWLRRHHRRPDYQRSNARTASSCQR-RRG 348
           PR E +    P RHR R    R R  +RS      R HR   + +S  R+  S ++ RRG
Sbjct: 253 PRRERHRSKSPRRHRSRSRDRRHR--SRSKSPGHHRSHRHRSHSKSPERSKKSHKKSRRG 310


>BC105004-1|AAI05005.1|  312|Homo sapiens PRP38 pre-mRNA processing
           factor 38 (yeast) domain containing A protein.
          Length = 312

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 21/60 (35%), Positives = 28/60 (46%), Gaps = 1/60 (1%)
 Frame = -1

Query: 524 PRPENYAGHLPYRHRRRDGYVRSRGGTRSTERWLRRHHRRPDYQRSNARTASSCQR-RRG 348
           PR E +    P RHR R    R R  +RS      R HR   + +S  R+  S ++ RRG
Sbjct: 253 PRRERHRSKSPRRHRSRSRDRRHR--SRSKSPGHHRSHRHRSHSKSPERSKKSHKKSRRG 310


>BC063655-1|AAH63655.1|  125|Homo sapiens PRP38 pre-mRNA processing
           factor 38 (yeast) domain containing A protein.
          Length = 125

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 21/60 (35%), Positives = 28/60 (46%), Gaps = 1/60 (1%)
 Frame = -1

Query: 524 PRPENYAGHLPYRHRRRDGYVRSRGGTRSTERWLRRHHRRPDYQRSNARTASSCQR-RRG 348
           PR E +    P RHR R    R R  +RS      R HR   + +S  R+  S ++ RRG
Sbjct: 66  PRRERHRSKSPRRHRSRSRDRRHR--SRSKSPGHHRSHRHRSHSKSPERSKKSHKKSRRG 123


>BC041100-1|AAH41100.1|  335|Homo sapiens SLC25A45 protein protein.
          Length = 335

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 21/79 (26%), Positives = 38/79 (48%), Gaps = 2/79 (2%)
 Frame = +3

Query: 21  LVKIT*SNKMSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHV--SKQIAA 194
           L+ +T ++     A P ++   FLAG     +    +AP + +K+ LQ Q    ++  + 
Sbjct: 57  LLVLTATSHQERRAQPPSYMHIFLAGCTGGFLQAYCLAPFDLIKVRLQNQTEPRAQPGSP 116

Query: 195 DQRYKGIVDAFVRIPKEQG 251
             RY+G V     I +E+G
Sbjct: 117 PPRYQGPVHCAASIFREEG 135


>BC036869-1|AAH36869.1|  246|Homo sapiens solute carrier family 25,
           member 45 protein.
          Length = 246

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 21/79 (26%), Positives = 38/79 (48%), Gaps = 2/79 (2%)
 Frame = +3

Query: 21  LVKIT*SNKMSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHV--SKQIAA 194
           L+ +T ++     A P ++   FLAG     +    +AP + +K+ LQ Q    ++  + 
Sbjct: 39  LLVLTATSHQERRAQPPSYMHIFLAGCTGGFLQAYCLAPFDLIKVRLQNQTEPRAQPGSP 98

Query: 195 DQRYKGIVDAFVRIPKEQG 251
             RY+G V     I +E+G
Sbjct: 99  PPRYQGPVHCAASIFREEG 117


>BC027998-1|AAH27998.1|  304|Homo sapiens solute carrier family 25,
           member 34 protein.
          Length = 304

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 10/25 (40%), Positives = 18/25 (72%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGFG 585
           + GL +C+ KI++ +G + LY+G G
Sbjct: 248 YGGLTDCMVKIWRQEGPLALYKGLG 272


>BC017094-1|AAH17094.1|  282|Homo sapiens transformer-2 alpha
           protein.
          Length = 282

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 17/46 (36%), Positives = 22/46 (47%)
 Frame = -1

Query: 488 RHRRRDGYVRSRGGTRSTERWLRRHHRRPDYQRSNARTASSCQRRR 351
           RH  R  Y RSR  + S  R  R     P+Y+R  +R+ S    RR
Sbjct: 62  RHSHRR-YTRSRSHSHSHRRRSRSRSYTPEYRRRRSRSHSPMSNRR 106


>BC000777-1|AAH00777.2|  125|Homo sapiens PRP38 pre-mRNA processing
           factor 38 (yeast) domain containing A protein.
          Length = 125

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 21/60 (35%), Positives = 28/60 (46%), Gaps = 1/60 (1%)
 Frame = -1

Query: 524 PRPENYAGHLPYRHRRRDGYVRSRGGTRSTERWLRRHHRRPDYQRSNARTASSCQR-RRG 348
           PR E +    P RHR R    R R  +RS      R HR   + +S  R+  S ++ RRG
Sbjct: 66  PRRERHRSKSPRRHRSRSRDRRHR--SRSKSPGHHRSHRHRSHSKSPERSKKSHKKSRRG 123


>AY121804-1|AAM82752.1| 1388|Homo sapiens BJ-HCC-23 tumor antigen
           protein.
          Length = 1388

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 23/77 (29%), Positives = 35/77 (45%)
 Frame = -2

Query: 286 DVGEVTTPE*KRPCSLGMRTKASTIPL*RWSAAICLLTCCTWSSSLTRSIGATAVLETAA 107
           D G ++TP    P S  M T   T+P    +    L+T  +     T  + ATA    +A
Sbjct: 407 DSGAMSTPLMGAPASGNMSTLQKTVPA-SGAMTTSLMTVPSSGVMSTEQMSATASRVMSA 465

Query: 106 EIPPARKSLANATGSAR 56
           ++  A+ S A  TGS +
Sbjct: 466 QLTMAKTSGAMPTGSMK 482


>AL513218-9|CAI12289.1|  312|Homo sapiens PRP38 pre-mRNA processing
           factor 38 (yeast) domain containing A protein.
          Length = 312

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 21/60 (35%), Positives = 28/60 (46%), Gaps = 1/60 (1%)
 Frame = -1

Query: 524 PRPENYAGHLPYRHRRRDGYVRSRGGTRSTERWLRRHHRRPDYQRSNARTASSCQR-RRG 348
           PR E +    P RHR R    R R  +RS      R HR   + +S  R+  S ++ RRG
Sbjct: 253 PRRERHRSKSPRRHRSRSRDRRHR--SRSKSPGHHRSHRHRSHSKSPERSKKSHKKSRRG 310


>AL450998-1|CAH70849.1|  304|Homo sapiens solute carrier family 25,
           member 34 protein.
          Length = 304

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 10/25 (40%), Positives = 18/25 (72%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGFG 585
           + GL +C+ KI++ +G + LY+G G
Sbjct: 248 YGGLTDCMVKIWRQEGPLALYKGLG 272


>AK092038-1|BAC03796.1|  312|Homo sapiens protein ( Homo sapiens
           cDNA FLJ34719 fis, clone MESAN2005689, weakly similar to
           SPLICING FACTOR, ARGININE/SERINE-RICH 2. ).
          Length = 312

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 21/60 (35%), Positives = 28/60 (46%), Gaps = 1/60 (1%)
 Frame = -1

Query: 524 PRPENYAGHLPYRHRRRDGYVRSRGGTRSTERWLRRHHRRPDYQRSNARTASSCQR-RRG 348
           PR E +    P RHR R    R R  +RS      R HR   + +S  R+  S ++ RRG
Sbjct: 253 PRRERHRSKSPRRHRSRSRDRRHR--SRSKSPGHHRSHRHRSHSKSPERSKKSHKKSRRG 310


>AK027842-1|BAB55405.1|  236|Homo sapiens protein ( Homo sapiens
           cDNA FLJ14936 fis, clone PLACE1010194, weakly similar to
           SPLICING FACTOR, ARGININE/SERINE-RICH 2. ).
          Length = 236

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 21/60 (35%), Positives = 28/60 (46%), Gaps = 1/60 (1%)
 Frame = -1

Query: 524 PRPENYAGHLPYRHRRRDGYVRSRGGTRSTERWLRRHHRRPDYQRSNARTASSCQR-RRG 348
           PR E +    P RHR R    R R  +RS      R HR   + +S  R+  S ++ RRG
Sbjct: 177 PRRERHRSKSPRRHRSRSRDRRHR--SRSKSPGHHRSHRHRSHSKSPERSKKSHKKSRRG 234


>AC023105-1|AAQ96870.1|  282|Homo sapiens unknown protein.
          Length = 282

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 17/46 (36%), Positives = 22/46 (47%)
 Frame = -1

Query: 488 RHRRRDGYVRSRGGTRSTERWLRRHHRRPDYQRSNARTASSCQRRR 351
           RH  R  Y RSR  + S  R  R     P+Y+R  +R+ S    RR
Sbjct: 62  RHSHRR-YTRSRSHSHSHRRRSRSRSYTPEYRRRRSRSHSPMSNRR 106


>AB097048-1|BAC77401.1|  282|Homo sapiens putative MAPK activating
           protein protein.
          Length = 282

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 17/46 (36%), Positives = 22/46 (47%)
 Frame = -1

Query: 488 RHRRRDGYVRSRGGTRSTERWLRRHHRRPDYQRSNARTASSCQRRR 351
           RH  R  Y RSR  + S  R  R     P+Y+R  +R+ S    RR
Sbjct: 62  RHSHRR-YTRSRSHSHSHRRRSRSRSYTPEYRRRRSRSHSPMSNRR 106


>AB037739-1|BAA92556.1| 1418|Homo sapiens KIAA1318 protein protein.
          Length = 1418

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 23/77 (29%), Positives = 35/77 (45%)
 Frame = -2

Query: 286 DVGEVTTPE*KRPCSLGMRTKASTIPL*RWSAAICLLTCCTWSSSLTRSIGATAVLETAA 107
           D G ++TP    P S  M T   T+P    +    L+T  +     T  + ATA    +A
Sbjct: 437 DSGAMSTPLMGAPASGNMSTLQKTVPA-SGAMTTSLMTVPSSGVMSTEQMSATASRVMSA 495

Query: 106 EIPPARKSLANATGSAR 56
           ++  A+ S A  TGS +
Sbjct: 496 QLTMAKTSGAMPTGSMK 512


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 93,003,775
Number of Sequences: 237096
Number of extensions: 1858853
Number of successful extensions: 5761
Number of sequences better than 10.0: 197
Number of HSP's better than 10.0 without gapping: 4856
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5690
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8455186714
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -