SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20005
         (763 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X56741-1|CAA40065.1|  207|Homo sapiens rab8 small GTP binding  p...   154   3e-37
CR542274-1|CAG47070.1|  207|Homo sapiens RAB8A protein.               154   3e-37
CR536583-1|CAG38820.1|  207|Homo sapiens RAB8A protein.               154   3e-37
BT007184-1|AAP35848.1|  207|Homo sapiens mel transforming oncoge...   154   3e-37
BC002977-1|AAH02977.1|  207|Homo sapiens RAB8A, member RAS oncog...   154   3e-37
AF498943-1|AAM21091.1|  207|Homo sapiens small GTP binding prote...   154   3e-37
BC020654-1|AAH20654.1|  207|Homo sapiens RAB8B, member RAS oncog...   149   1e-35
AB038995-1|BAA92249.1|  207|Homo sapiens RAB-8b protein protein.      149   1e-35
S53268-1|AAB19681.1|  206|Homo sapiens RAS-related protein MEL p...   149   1e-35
CR457303-1|CAG33584.1|  200|Homo sapiens RAB10 protein.               138   3e-32
BC000896-1|AAH00896.1|  200|Homo sapiens RAB10, member RAS oncog...   138   3e-32
AK023223-1|BAB14474.1|  200|Homo sapiens protein ( Homo sapiens ...   138   3e-32
AF498945-1|AAM21093.1|  200|Homo sapiens small GTP binding prote...   138   3e-32
AF297660-1|AAG13413.1|  200|Homo sapiens RAB10 protein.               138   3e-32
AF106681-1|AAD43034.1|  200|Homo sapiens ras-related GTP-binding...   138   3e-32
AF086917-1|AAP97147.1|  200|Homo sapiens rab10 protein.               138   3e-32
AB209767-1|BAD93004.1|  152|Homo sapiens mel transforming oncoge...   137   3e-32
BC094846-1|AAH94846.1|  244|Homo sapiens RAB13 protein protein.       135   1e-31
X75593-1|CAA53266.1|  203|Homo sapiens rab 13 protein.                135   2e-31
BT019701-1|AAV38507.1|  203|Homo sapiens RAB13, member RAS oncog...   135   2e-31
BT019700-1|AAV38506.1|  203|Homo sapiens RAB13, member RAS oncog...   135   2e-31
BC073168-1|AAH73168.2|  203|Homo sapiens RAB13, member RAS oncog...   135   2e-31
BC000799-1|AAH00799.1|  203|Homo sapiens RAB13, member RAS oncog...   135   2e-31
AY423722-1|AAS00485.1|  203|Homo sapiens growth-inhibiting gene ...   135   2e-31
AL358472-17|CAI14031.1|  203|Homo sapiens RAB13, member RAS onco...   135   2e-31
AF498948-1|AAM21096.1|  203|Homo sapiens small GTP binding prote...   135   2e-31
X79781-1|CAA56177.1|  201|Homo sapiens ray protein.                   124   5e-28
M28209-1|AAA60240.1|  205|Homo sapiens GTP-binding protein protein.   124   5e-28
CR541683-1|CAG46484.1|  201|Homo sapiens RAB35 protein.               124   5e-28
CR536488-1|CAG38727.1|  205|Homo sapiens RAB1A protein.               124   5e-28
CR536486-1|CAG38725.1|  201|Homo sapiens RAB35 protein.               124   5e-28
BT020024-1|AAV38827.1|  201|Homo sapiens RAB35, member RAS oncog...   124   5e-28
BT019529-1|AAV38336.1|  205|Homo sapiens RAB1A, member RAS oncog...   124   5e-28
BT019528-1|AAV38335.1|  205|Homo sapiens RAB1A, member RAS oncog...   124   5e-28
BC071169-1|AAH71169.1|  201|Homo sapiens RAB1B, member RAS oncog...   124   5e-28
BC015931-1|AAH15931.1|  201|Homo sapiens RAB35, member RAS oncog...   124   5e-28
BC009227-1|AAH09227.2|  195|Homo sapiens RAB13 protein protein.       124   5e-28
BC000905-1|AAH00905.1|  205|Homo sapiens RAB1A, member RAS oncog...   124   5e-28
AJ245875-1|CAC21570.1|  163|Homo sapiens putative small GTP-bind...   124   5e-28
AF498960-1|AAM21108.1|  201|Homo sapiens small GTP binding prote...   124   5e-28
AF498929-1|AAM21077.1|  205|Homo sapiens small GTP binding prote...   124   5e-28
AF092437-1|AAP97212.1|  201|Homo sapiens rab1B protein.               124   5e-28
AC011742-1|AAX93140.1|  157|Homo sapiens unknown protein.             124   5e-28
AC004812-2|AAC83182.1|  201|Homo sapiens GTP-binding protein H-r...   124   5e-28
CR533462-1|CAG38493.1|  201|Homo sapiens RAB1B protein.               122   1e-27
BC040679-1|AAH40679.2|  208|Homo sapiens RAB15, member RAS onoco...   116   9e-26
AF254795-1|AAF67748.1|  220|Homo sapiens GTP-binding protein RAB...   113   5e-25
BC016471-1|AAH16471.1|  219|Homo sapiens RAB3D, member RAS oncog...   113   9e-25
BC013033-1|AAH13033.1|  227|Homo sapiens RAB3C, member RAS oncog...   113   9e-25
AY026936-1|AAK08968.1|  227|Homo sapiens Rab3c protein.               113   9e-25
AF498933-1|AAM21081.1|  219|Homo sapiens small GTP binding prote...   113   9e-25
AF081353-1|AAC72918.1|  219|Homo sapiens GTP-binding protein pro...   113   9e-25
M28210-1|AAA60242.1|  220|Homo sapiens GTP-binding protein protein.   112   1e-24
BC011782-1|AAH11782.1|  220|Homo sapiens RAB3A, member RAS oncog...   112   1e-24
AF498931-1|AAM21079.1|  220|Homo sapiens small GTP binding prote...   112   1e-24
AF157809-1|AAD46811.1|  220|Homo sapiens GTP-binding protein pro...   112   1e-24
AC068499-1|AAF67385.1|  220|Homo sapiens RAB3A, member RAS oncog...   112   1e-24
BC005035-1|AAH05035.1|  219|Homo sapiens RAB3B, member RAS oncog...   111   2e-24
AL589663-2|CAH74098.1|  219|Homo sapiens RAB3B, member RAS oncog...   111   2e-24
AL445685-1|CAI17027.1|  219|Homo sapiens RAB3B, member RAS oncog...   111   2e-24
AF498932-1|AAM21080.1|  219|Homo sapiens small GTP binding prote...   111   2e-24
M28214-1|AAA60243.1|  219|Homo sapiens GTP-binding protein protein.   109   1e-23
BC066913-1|AAH66913.1|  256|Homo sapiens RAB26, member RAS oncog...   104   3e-22
AY646153-1|AAU88191.1|  256|Homo sapiens Ras-related oncogene pr...   104   3e-22
X56740-1|CAA40064.1|  216|Homo sapiens H rab11 small GTP  bindin...   103   7e-22
X53143-1|CAA37300.1|  216|Homo sapiens protein ( Human YL8 mRNA ...   103   7e-22
EF560724-1|ABQ59034.1|  218|Homo sapiens RAB11B protein protein.      103   7e-22
CR541691-1|CAG46492.1|  218|Homo sapiens RAB11B protein.              103   7e-22
CR536494-1|CAG38733.1|  218|Homo sapiens RAB11B protein.              103   7e-22
CR536493-1|CAG38732.1|  216|Homo sapiens RAB11A protein.              103   7e-22
CR407669-1|CAG28597.1|  216|Homo sapiens RAB11A protein.              103   7e-22
BT020154-1|AAV38956.1|  216|Homo sapiens RAB11A, member RAS onco...   103   7e-22
BT020151-1|AAV38953.1|  216|Homo sapiens RAB11A, member RAS onco...   103   7e-22
BT019536-1|AAV38343.1|  218|Homo sapiens RAB11B, member RAS onco...   103   7e-22
BT019535-1|AAV38342.1|  218|Homo sapiens RAB11B, member RAS onco...   103   7e-22
BC110081-1|AAI10082.1|  218|Homo sapiens RAB11B, member RAS onco...   103   7e-22
BC013348-1|AAH13348.1|  216|Homo sapiens RAB11A protein protein.      103   7e-22
AF498947-1|AAM21095.1|  218|Homo sapiens small GTP binding prote...   103   7e-22
AF498946-1|AAM21094.1|  216|Homo sapiens small GTP binding prote...   103   7e-22
AF000231-1|AAC32887.1|  216|Homo sapiens rab11a protein.              103   7e-22
X79780-1|CAA56176.1|  218|Homo sapiens YPT3 protein.                  103   9e-22
CR533455-1|CAG38486.1|  206|Homo sapiens RAB18 protein.               101   4e-21
BT009840-1|AAP88842.1|  206|Homo sapiens RAB18, member RAS oncog...   101   4e-21
BC062319-1|AAH62319.1|  212|Homo sapiens RAB43, member RAS oncog...   101   4e-21
BC029350-1|AAH29350.1|  206|Homo sapiens RAB18, member RAS oncog...   101   4e-21
BC015014-1|AAH15014.1|  206|Homo sapiens RAB18, member RAS oncog...   101   4e-21
AY166852-1|AAO17291.1|  212|Homo sapiens RAB43 protein.               101   4e-21
AL138920-1|CAH70590.1|  206|Homo sapiens RAB18, member RAS oncog...   101   4e-21
AJ277145-1|CAB86486.1|  206|Homo sapiens ras-related small GTPas...   101   4e-21
AF498950-1|AAM21098.1|  206|Homo sapiens small GTP binding prote...   101   4e-21
AF137372-1|AAF61433.1|  206|Homo sapiens ras-related protein RAB...   101   4e-21
AF136974-1|AAG49435.1|  206|Homo sapiens ras-related protein 18 ...   101   4e-21
AF087860-1|AAP97170.1|  206|Homo sapiens rab18 protein.               101   4e-21
AK223153-1|BAD96873.1|  206|Homo sapiens RAB18, member RAS oncog...   100   6e-21
CR542106-1|CAG46903.1|  203|Homo sapiens RAB30 protein.                98   3e-20
BX641138-1|CAE46061.1|  164|Homo sapiens hypothetical protein pr...    98   3e-20
BC014213-1|AAH14213.1|  203|Homo sapiens RAB30, member RAS oncog...    98   3e-20
AF498956-1|AAM21104.1|  203|Homo sapiens small GTP binding prote...    98   3e-20
U57092-1|AAC50774.1|  203|Homo sapiens Rab30 protein.                  95   2e-19
AF498952-1|AAM21100.1|  190|Homo sapiens small GTP binding prote...    95   2e-19
AB027137-1|BAA84707.1|  190|Homo sapiens RAB-26 protein.               95   2e-19
BC016615-1|AAH16615.1|  223|Homo sapiens RAB37, member RAS oncog...    95   3e-19
AK098068-1|BAC05227.1|  223|Homo sapiens protein ( Homo sapiens ...    95   3e-19
BC046927-1|AAH46927.1|  213|Homo sapiens RAB4B, member RAS oncog...    94   6e-19
BC040547-1|AAH40547.1|  216|Homo sapiens RAB37, member RAS oncog...    94   6e-19
BC033081-1|AAH33081.1|  121|Homo sapiens RAB4B protein protein.        94   6e-19
AF498935-1|AAM21083.1|  213|Homo sapiens small GTP binding prote...    94   6e-19
AF165522-1|AAD45923.1|  213|Homo sapiens ras-related GTP-binding...    94   6e-19
CR533479-1|CAG38510.1|  129|Homo sapiens RAB1A protein.                91   3e-18
M28211-1|AAA60244.1|  213|Homo sapiens GTP-binding protein protein.    91   5e-18
BC004309-1|AAH04309.1|  218|Homo sapiens RAB4A, member RAS oncog...    91   5e-18
BC002438-1|AAH02438.1|  218|Homo sapiens RAB4A, member RAS oncog...    91   5e-18
AY585832-1|AAT91347.1|  218|Homo sapiens HRES-1 antisense Rab pr...    91   5e-18
AL162595-3|CAI19037.1|  218|Homo sapiens RAB4A, member RAS oncog...    91   5e-18
AL117350-4|CAI22870.1|  218|Homo sapiens RAB4A, member RAS oncog...    91   5e-18
AF498934-1|AAM21082.1|  218|Homo sapiens small GTP binding prote...    91   5e-18
BC020839-1|AAH20839.1|  216|Homo sapiens RAB2B, member RAS oncog...    90   7e-18
AK223009-1|BAD96729.1|  218|Homo sapiens RAB4A, member RAS oncog...    90   7e-18
AF468652-1|AAN86142.1|  216|Homo sapiens RAB2B protein.                90   7e-18
U57093-1|AAC51194.2|  218|Homo sapiens small GTP-binding protein...    89   2e-17
CR457394-1|CAG33675.1|  215|Homo sapiens RAB14 protein.                89   2e-17
BC027474-1|AAH27474.1|  218|Homo sapiens RAB27B, member RAS onco...    89   2e-17
BC006081-1|AAH06081.1|  215|Homo sapiens RAB14, member RAS oncog...    89   2e-17
AY553875-1|AAS64573.1|  215|Homo sapiens F protein-binding prote...    89   2e-17
AL137068-10|CAD20124.1|  215|Homo sapiens RAB14, member RAS onco...    89   2e-17
AL137068-9|CAI12361.1|  181|Homo sapiens RAB14, member RAS oncog...    89   2e-17
AK023524-1|BAB14598.1|  215|Homo sapiens protein ( Homo sapiens ...    89   2e-17
AF498954-1|AAM21102.1|  218|Homo sapiens small GTP binding prote...    89   2e-17
AF498949-1|AAM21097.1|  215|Homo sapiens small GTP binding prote...    89   2e-17
AF329499-1|AAK11243.1|  218|Homo sapiens RAS-related protein RAB...    89   2e-17
AF203689-1|AAF19400.1|  215|Homo sapiens GTPase Rab14 protein.         89   2e-17
AF152463-1|AAF00150.1|  215|Homo sapiens RAB14 protein protein.        89   2e-17
AF112206-1|AAF17194.1|  215|Homo sapiens ras-related protein rab...    89   2e-17
X12953-1|CAA31411.1|  212|Homo sapiens protein ( Human rab2 mRNA...    88   4e-17
M28213-1|AAA60241.1|  212|Homo sapiens GTP-binding protein protein.    88   4e-17
BT019695-1|AAV38501.1|  212|Homo sapiens RAB2, member RAS oncoge...    88   4e-17
BC009714-1|AAH09714.1|  213|Homo sapiens RAB39B, member RAS onco...    88   4e-17
BC008929-1|AAH08929.1|  212|Homo sapiens RAB2A, member RAS oncog...    88   4e-17
AY052478-1|AAL12244.1|  213|Homo sapiens RAB39 protein.                88   4e-17
AL356738-7|CAI41468.1|  213|Homo sapiens RAB39B, member RAS onco...    88   4e-17
AF498930-1|AAM21078.1|  212|Homo sapiens small GTP binding prote...    88   4e-17
BC066366-1|AAH66366.1|  151|Homo sapiens RAB2B protein protein.        87   5e-17
AK027730-1|BAB55326.1|  148|Homo sapiens protein ( Homo sapiens ...    87   5e-17
U57094-1|AAC51195.1|  221|Homo sapiens Rab27a protein.                 87   9e-17
U38654-1|AAC50271.2|  221|Homo sapiens Rab27a protein.                 87   9e-17
CR541693-1|CAG46494.1|  221|Homo sapiens RAB27A protein.               87   9e-17
CR536496-1|CAG38735.1|  221|Homo sapiens RAB27A protein.               87   9e-17
BC132800-1|AAI32801.1|  221|Homo sapiens RAB27A, member RAS onco...    87   9e-17
BC107680-1|AAI07681.1|  221|Homo sapiens RAB27A, member RAS onco...    87   9e-17
AF498953-1|AAM21101.1|  221|Homo sapiens small GTP binding prote...    87   9e-17
AF443871-1|AAL39097.1|  221|Homo sapiens Ras-like GTP-binding pr...    87   9e-17
AF154840-1|AAD47629.1|  221|Homo sapiens Ras-like GTP-binding pr...    87   9e-17
AF125393-1|AAD43049.1|  213|Homo sapiens Rab27 isoform protein.        87   9e-17
BC033322-1|AAH33322.1|  213|Homo sapiens RAB25, member RAS oncog...    86   1e-16
BC009831-1|AAH09831.1|  213|Homo sapiens RAB25, member RAS oncog...    86   1e-16
AL355388-18|CAH72638.1|  213|Homo sapiens RAB25, member RAS onco...    86   1e-16
AF274025-1|AAM69362.1|  217|Homo sapiens GTP-binding protein Rab...    86   1e-16
AF083124-1|AAF98238.1|  256|Homo sapiens unknown protein.              86   1e-16
BC028064-1|AAH28064.1|  217|Homo sapiens RAB39, member RAS oncog...    85   2e-16
CR457076-1|CAG33357.1|  221|Homo sapiens RAB27A protein.               85   3e-16
AF217985-1|AAG17228.1|  248|Homo sapiens unknown protein.              85   3e-16
AF087861-1|AAP97171.1|  213|Homo sapiens rab4b protein.                85   3e-16
D14889-1|BAA03606.1|  237|Homo sapiens small GTP-binding protein...    85   3e-16
BT007038-1|AAP35687.1|  237|Homo sapiens RAB33A, member RAS onco...    85   3e-16
BC009996-1|AAH09996.1|  237|Homo sapiens RAB33A, member RAS onco...    85   3e-16
BC001157-1|AAH01157.1|  237|Homo sapiens RAB33A, member RAS onco...    85   3e-16
AL139234-4|CAI42781.1|  237|Homo sapiens RAB33A, member RAS onco...    85   3e-16
AF498959-1|AAM21107.1|  237|Homo sapiens small GTP binding prote...    85   3e-16
M28212-1|AAA60246.1|  208|Homo sapiens GTP-binding protein protein.    83   1e-15
BT019698-1|AAV38504.1|  208|Homo sapiens RAB6A, member RAS oncog...    83   1e-15
BT007263-1|AAP35927.1|  208|Homo sapiens RAB6B, member RAS oncog...    83   1e-15
BC111977-1|AAI11978.1|  229|Homo sapiens RAB33B, member RAS onco...    83   1e-15
BC096818-1|AAH96818.1|  208|Homo sapiens RAB6A, member RAS oncog...    83   1e-15
BC078662-1|AAH78662.1|  208|Homo sapiens RAB6B protein protein.        83   1e-15
BC036064-1|AAH36064.1|  229|Homo sapiens RAB33B, member RAS onco...    83   1e-15
BC002510-1|AAH02510.1|  208|Homo sapiens RAB6B, member RAS oncog...    83   1e-15
AF498940-1|AAM21088.1|  208|Homo sapiens small GTP binding prote...    83   1e-15
AF498939-1|AAM21087.1|  208|Homo sapiens small GTP binding prote...    83   1e-15
AF350420-1|AAL83916.1|  229|Homo sapiens RAB33B protein.               83   1e-15
AF166492-1|AAF61637.1|  208|Homo sapiens small GTPase RAB6B prot...    83   1e-15
AF130986-1|AAD25535.1|  208|Homo sapiens RAS-related protein RAB...    83   1e-15
AC114743-1|AAY40936.1|  229|Homo sapiens unknown protein.              83   1e-15
CR541984-1|CAG46781.1|  208|Homo sapiens RAB6A protein.                82   2e-15
BC068486-1|AAH68486.1|  208|Homo sapiens RAB6A protein protein.        82   2e-15
BC003617-1|AAH03617.1|  208|Homo sapiens RAB6A, member RAS oncog...    82   2e-15
AK223551-1|BAD97271.1|  208|Homo sapiens RAB6A, member RAS oncog...    82   2e-15
AK057157-1|BAB71371.1|  208|Homo sapiens protein ( Homo sapiens ...    82   2e-15
AF498941-1|AAM21089.1|  208|Homo sapiens small GTP binding prote...    82   2e-15
AF198616-1|AAF73841.1|  208|Homo sapiens Rab GTPase RAB6A' protein.    82   2e-15
AF130122-1|AAD27707.1|  208|Homo sapiens small GTP binding prote...    82   2e-15
AF119836-1|AAF23593.1|  208|Homo sapiens GTP-binding protein RAB...    82   2e-15
BC023566-1|AAH23566.1|  740|Homo sapiens RAS and EF-hand domain ...    81   4e-15
AL499602-1|CAH70678.1|  740|Homo sapiens RAS and EF-hand domain ...    81   4e-15
U66624-1|AAC51199.1|   53|Homo sapiens small GTP-binding protein...    81   6e-15
AF274957-1|AAK07532.1|   70|Homo sapiens PNAS-32 protein.              81   6e-15
Z98883-3|CAM26443.1|  281|Homo sapiens RAB40C, member RAS oncoge...    80   7e-15
Z84479-1|CAB06484.2|  281|Homo sapiens RAB40C, member RAS oncoge...    80   7e-15
U44103-1|AAC51200.1|  201|Homo sapiens small GTP binding protein...    80   7e-15
D84488-1|BAA22160.1|  203|Homo sapiens small GTP-binding protein...    80   7e-15
CR542010-1|CAG46807.1|  203|Homo sapiens RAB7L1 protein.               80   7e-15
CR450362-1|CAG29358.1|  201|Homo sapiens RAB9A protein.                80   7e-15
BT019540-1|AAV38347.1|  203|Homo sapiens RAB7, member RAS oncoge...    80   7e-15
BC018039-1|AAH18039.1|  278|Homo sapiens RAB40B, member RAS onco...    80   7e-15
BC017265-1|AAH17265.1|  201|Homo sapiens RAB9A, member RAS oncog...    80   7e-15
BC002585-1|AAH02585.1|  203|Homo sapiens RAB7, member RAS oncoge...    80   7e-15
AY823398-1|AAV83924.1|  262|Homo sapiens RAR-like GTPase variant...    80   7e-15
AF498944-1|AAM21092.1|  201|Homo sapiens small GTP binding prote...    80   7e-15
AE006464-4|AAK61236.1|  281|Homo sapiens RAR (RAS like GTPase) l...    80   7e-15
X99962-1|CAA68227.1|  217|Homo sapiens rab-related GTP-binding p...    80   1e-14
U05227-1|AAA17031.1|  278|Homo sapiens Rar protein protein.            79   1e-14
AB209711-1|BAD92948.1|  380|Homo sapiens RAB40B, member RAS onco...    79   1e-14
BC028696-1|AAH28696.1|  281|Homo sapiens RAB40C, member RAS onco...    79   2e-14
BC093758-1|AAH93758.1|  201|Homo sapiens RAB9B, member RAS oncog...    79   2e-14
BC093756-1|AAH93756.1|  201|Homo sapiens RAB9B, member RAS oncog...    79   2e-14
AL139228-1|CAB76967.1|  201|Homo sapiens RAB9B, member RAS oncog...    79   2e-14
AF091032-1|AAF00045.1|   43|Homo sapiens GTP-binding protein RAB...    79   2e-14
AB036693-1|BAA89542.1|  201|Homo sapiens RAB9-like protein protein.    79   2e-14
BC117239-1|AAI17240.1|  221|Homo sapiens RAB41, member RAS oncog...    78   3e-14
AL357752-5|CAI41489.1|  212|Homo sapiens novel protein similar t...    78   3e-14
AK223514-1|BAD97234.1|  203|Homo sapiens RAB7, member RAS oncoge...    78   3e-14
CR456553-1|CAG30439.1|  333|Homo sapiens RAB36 protein.                77   7e-14
BC104991-1|AAI04992.1|  333|Homo sapiens RAB36, member RAS oncog...    77   7e-14
BC104989-1|AAI04990.1|  333|Homo sapiens RAB36, member RAS oncog...    77   7e-14
AY574034-1|AAU08232.1|  235|Homo sapiens RAB18 long isoform 1 pr...    77   7e-14
AF133588-1|AAF02485.1|  333|Homo sapiens RAB36 protein.                77   7e-14
AB023061-1|BAA75195.1|  333|Homo sapiens small GTP-binding prote...    77   7e-14
U71127-1|AAB09599.1|  225|Homo sapiens low Mr GTP-binding protei...    77   9e-14
U59878-1|AAB02833.1|  210|Homo sapiens low-Mr GTP-binding protei...    77   9e-14
BT020016-1|AAV38819.1|  225|Homo sapiens RAB32, member RAS oncog...    77   9e-14
BC015061-1|AAH15061.1|  225|Homo sapiens RAB32, member RAS oncog...    77   9e-14
AL133539-1|CAC34968.1|  225|Homo sapiens RAB32, member RAS oncog...    77   9e-14
AF498958-1|AAM21106.1|  225|Homo sapiens small GTP binding prote...    77   9e-14
AF050175-1|AAD02565.1|  207|Homo sapiens Rab7 protein.                 76   1e-13
M28215-1|AAA60245.1|  215|Homo sapiens GTP-binding protein protein.    76   2e-13
CR536492-1|CAG38731.1|  215|Homo sapiens RAB5A protein.                76   2e-13
BC018288-1|AAH18288.1|  215|Homo sapiens RAB5A, member RAS oncog...    76   2e-13
BC001267-1|AAH01267.1|  215|Homo sapiens RAB5A, member RAS oncog...    76   2e-13
AF498936-1|AAM21084.1|  215|Homo sapiens small GTP binding prote...    76   2e-13
AF464088-1|AAO15677.1|  215|Homo sapiens cervical cancer oncogen...    76   2e-13
Z69733-1|CAI41993.1|  277|Homo sapiens RAB40A, member RAS oncoge...    75   2e-13
BC117232-1|AAI17233.1|  277|Homo sapiens RAB40A, member RAS onco...    75   2e-13
BC113501-1|AAI13502.1|  277|Homo sapiens RAB40A, member RAS onco...    75   2e-13
BC074855-1|AAH74855.1|  277|Homo sapiens RAB40A, member RAS onco...    75   2e-13
BC074854-1|AAH74854.1|  277|Homo sapiens RAB40A, member RAS onco...    75   2e-13
AF422143-1|AAL60514.1|  278|Homo sapiens SOCS box containing pro...    75   2e-13
AF132748-1|AAL75949.1|  277|Homo sapiens Rar-2 protein protein.        75   2e-13
AB232637-1|BAF02899.1|  277|Homo sapiens Rab40A protein.               75   2e-13
DQ178619-1|ABA03166.1|  211|Homo sapiens RAB38, member RAS oncog...    75   3e-13
BT009842-1|AAP88844.1|  211|Homo sapiens RAB38, member RAS oncog...    75   3e-13
BC015808-1|AAH15808.1|  211|Homo sapiens RAB38, member RAS oncog...    75   3e-13
AF235022-1|AAG30731.1|  211|Homo sapiens Rab-related GTP-binding...    75   3e-13
AF136172-1|AAP97262.1|  212|Homo sapiens rab-related GTP-binding...    75   3e-13
X93499-1|CAA63763.1|  207|Homo sapiens RAB7 protein protein.           74   5e-13
U44104-1|AAA86640.1|  207|Homo sapiens small GTP binding protein...    74   5e-13
BC013728-1|AAH13728.2|  207|Homo sapiens RAB7A, member RAS oncog...    74   5e-13
BC008721-1|AAH08721.2|  207|Homo sapiens RAB7A, member RAS oncog...    74   5e-13
AK074689-1|BAC11141.1|  259|Homo sapiens protein ( Homo sapiens ...    74   5e-13
AF498942-1|AAM21090.1|  207|Homo sapiens small GTP binding prote...    74   5e-13
Z95624-1|CAB09136.1|  278|Homo sapiens novel protein protein.          74   6e-13
U18420-1|AAB08927.1|  216|Homo sapiens ras-related small GTP bin...    74   6e-13
U11293-1|AAA74081.1|  216|Homo sapiens protein ( Human Rab5c-lik...    74   6e-13
CR541901-1|CAG46699.1|  216|Homo sapiens RAB5C protein.                74   6e-13
BT019484-1|AAV38291.1|  216|Homo sapiens RAB5C, member RAS oncog...    74   6e-13
BT007046-1|AAP35695.1|  194|Homo sapiens RAB22A, member RAS onco...    74   6e-13
BT006702-1|AAP35348.1|  251|Homo sapiens RAB34, member RAS oncog...    74   6e-13
BC114439-1|AAI14440.1|  216|Homo sapiens RAB5C, member RAS oncog...    74   6e-13
BC106039-1|AAI06040.1|  216|Homo sapiens RAB5C, member RAS oncog...    74   6e-13
BC101172-1|AAI01173.1|  278|Homo sapiens Ras-like GTPase-like pr...    74   6e-13
BC101171-1|AAI01172.1|  278|Homo sapiens Ras-like GTPase-like pr...    74   6e-13
BC101170-1|AAI01171.1|  278|Homo sapiens Ras-like GTPase-like pr...    74   6e-13
BC101169-1|AAI01170.1|  278|Homo sapiens Ras-like GTPase-like pr...    74   6e-13
BC091510-1|AAH91510.1|  259|Homo sapiens RAB34, member RAS oncog...    74   6e-13
BC066904-1|AAH66904.1|  259|Homo sapiens RAB34 protein protein.        74   6e-13
BC063457-1|AAH63457.1|  194|Homo sapiens RAB22A, member RAS onco...    74   6e-13
BC016841-1|AAH16841.1|  251|Homo sapiens RAB34 protein protein.        74   6e-13
BC015710-1|AAH15710.1|  194|Homo sapiens RAB22A, member RAS onco...    74   6e-13
AL035455-1|CAC15020.1|  194|Homo sapiens RAB22A, member RAS onco...    74   6e-13
AK027312-1|BAB55034.1|  259|Homo sapiens protein ( Homo sapiens ...    74   6e-13
AJ277106-1|CAC81760.1|  259|Homo sapiens GTP-binding protein rah...    74   6e-13
AJ276210-1|CAC10538.1|  194|Homo sapiens GTP-binding protein RAB...    74   6e-13
AF498938-1|AAM21086.1|  216|Homo sapiens small GTP binding prote...    74   6e-13
AF327350-1|AAL05587.1|  211|Homo sapiens Ras-related GTP-binding...    74   6e-13
AF322067-1|AAK09397.1|  259|Homo sapiens RAB39 protein.                74   6e-13
AF141304-1|AAF66594.1|  216|Homo sapiens small GTPase protein.         74   6e-13
AF125104-1|AAL75941.1|  194|Homo sapiens RAB22 protein.                74   6e-13
AF091034-1|AAF00047.2|  194|Homo sapiens GTP-binding protein RAB...    74   6e-13
BC092475-1|AAH92475.1|  225|Homo sapiens RAB21, member RAS oncog...    73   1e-12
BC021901-1|AAH21901.1|  225|Homo sapiens RAB21, member RAS oncog...    73   1e-12
AF091035-1|AAF00048.1|  225|Homo sapiens GTP-binding protein RAB...    73   1e-12
X54871-1|CAA38653.1|  215|Homo sapiens ras related protein Rab5b...    72   2e-12
M31468-1|AAA36545.1|  203|Homo sapiens protein ( Human ras-like ...    72   2e-12
CR541690-1|CAG46491.1|  215|Homo sapiens RAB5B protein.                72   2e-12
BX537408-1|CAD97650.1|  215|Homo sapiens hypothetical protein pr...    72   2e-12
BC065298-1|AAH65298.2|  215|Homo sapiens RAB5B, member RAS oncog...    72   2e-12
BC056422-1|AAH56422.2|  215|Homo sapiens RAB5B, member RAS oncog...    72   2e-12
BC050558-1|AAH50558.2|  215|Homo sapiens RAB5B, member RAS oncog...    72   2e-12
BC040143-1|AAH40143.1|  267|Homo sapiens RAB5B protein protein.        72   2e-12
BC032740-1|AAH32740.1|  215|Homo sapiens RAB5B protein protein.        72   2e-12
BC013106-1|AAH13106.1|  204|Homo sapiens related RAS viral (r-ra...    72   2e-12
AF498937-1|AAM21085.1|  215|Homo sapiens small GTP binding prote...    72   2e-12
AF493924-1|AAM12638.1|  203|Homo sapiens Ras family small GTP bi...    72   2e-12
AC013449-2|AAY24262.1|   42|Homo sapiens unknown protein.              72   2e-12
U59877-1|AAB02832.1|  194|Homo sapiens low-Mr GTP-binding protei...    71   5e-12
U57091-1|AAC50773.1|  194|Homo sapiens Rab22b protein.                 71   5e-12
CR536482-1|CAG38721.1|  215|Homo sapiens RAB5B protein.                71   5e-12
CR407659-1|CAG28587.1|  194|Homo sapiens RAB31 protein.                71   5e-12
BT020028-1|AAV38831.1|  194|Homo sapiens RAB31, member RAS oncog...    71   5e-12
BT020027-1|AAV38830.1|  194|Homo sapiens RAB31, member RAS oncog...    71   5e-12
BC001148-1|AAH01148.1|  195|Homo sapiens RAB31, member RAS oncog...    71   5e-12
AK223505-1|BAD97225.1|  195|Homo sapiens RAB31, member RAS oncog...    71   5e-12
AF498957-1|AAM21105.1|  194|Homo sapiens small GTP binding prote...    71   5e-12
AF234995-1|AAG13847.1|  194|Homo sapiens small GTPase RAB22B pro...    71   5e-12
AF183421-1|AAG09690.1|  195|Homo sapiens small GTP-binding prote...    71   5e-12
AC073869-1|AAX93251.1|  254|Homo sapiens unknown protein.              71   5e-12
AB232598-1|BAF02860.1|  254|Homo sapiens Rab6C protein.                71   5e-12
CR533469-1|CAG38500.1|  254|Homo sapiens RAB6C protein.                70   8e-12
BC120999-1|AAI21000.1|  254|Homo sapiens RAB6C, member RAS oncog...    70   8e-12
AF309646-1|AAN39685.1|  254|Homo sapiens Rab6-like protein WTH3 ...    70   8e-12
AF124200-1|AAF28422.1|  175|Homo sapiens Rab6-like protein protein.    70   8e-12
D42087-1|BAA07682.1|  161|Homo sapiens KIAA0118 protein.               70   1e-11
BC009109-1|AAH09109.1|  175|Homo sapiens KIAA0118 protein protein.     70   1e-11
AC079776-1|AAY15045.1|  254|Homo sapiens unknown protein.              70   1e-11
BC015021-1|AAH15021.1|  237|Homo sapiens RAB23, member RAS oncog...    68   3e-11
BC004416-1|AAH04416.1|  127|Homo sapiens Unknown (protein for IM...    68   3e-11
AY585189-1|AAT79492.1|  237|Homo sapiens RAB family small GTP bi...    68   3e-11
AL031321-1|CAI21564.1|  237|Homo sapiens RAB23, member RAS oncog...    68   3e-11
AF498951-1|AAM21099.1|  237|Homo sapiens small GTP binding prote...    68   3e-11
AB034244-1|BAA87324.1|  237|Homo sapiens RAB23 protein protein.        68   3e-11
AB025427-1|BAB40309.1|  237|Homo sapiens hRAB-23 protein protein.      68   3e-11
AK055927-1|BAB71048.1|  141|Homo sapiens protein ( Homo sapiens ...    68   4e-11
CR533454-1|CAG38485.1|  212|Homo sapiens RAB17 protein.                66   1e-10
Z85996-3|CAD92808.1|  154|Homo sapiens RAB44, member RAS oncogen...    66   2e-10
CR457282-1|CAG33563.1|  212|Homo sapiens RAB17 protein.                66   2e-10
BC050426-1|AAH50426.1|  212|Homo sapiens RAB17, member RAS oncog...    66   2e-10
AL138920-3|CAH70592.1|  290|Homo sapiens RAB18, member RAS oncog...    66   2e-10
AK022600-1|BAB14121.1|  212|Homo sapiens protein ( Homo sapiens ...    66   2e-10
AC104667-3|AAY24047.1|  212|Homo sapiens unknown protein.              66   2e-10
L00048-1|AAB59445.1|  189|Homo sapiens cellular transforming pro...    64   4e-10
AF070629-1|AAC25389.1|  118|Homo sapiens RAB2 protein.                 64   5e-10
M54968-1|AAB41942.1|  188|Homo sapiens K-ras oncogene protein pr...    63   9e-10
L00049-1|AAB59444.1|  188|Homo sapiens cellular transforming pro...    63   9e-10
BT007153-1|AAP35817.1|  188|Homo sapiens v-Ki-ras2 Kirsten rat s...    63   9e-10
BC013572-1|AAH13572.1|  188|Homo sapiens v-Ki-ras2 Kirsten rat s...    63   9e-10
AF493917-1|AAM12631.1|  188|Homo sapiens Ras family small GTP bi...    63   9e-10
CR456554-1|CAG30440.1|  229|Homo sapiens RABL2B protein.               63   1e-09
BC126129-1|AAI26130.1|  224|Homo sapiens RABL2A protein protein.       63   1e-09
AL078621-8|CAB81644.1|  229|Homo sapiens RAB, member of RAS onco...    63   1e-09
AL078621-7|CAB81645.1|  228|Homo sapiens RAB, member of RAS onco...    63   1e-09
AF095351-1|AAD51378.1|  228|Homo sapiens RAB-like protein 2A pro...    63   1e-09
AF095350-1|AAD51377.1|  228|Homo sapiens RAB-like protein 2A pro...    63   1e-09
BC017092-1|AAH17092.1|  199|Homo sapiens RAB7B protein protein.        62   2e-09
AY094596-1|AAM22519.1|  199|Homo sapiens Ras-related protein Rab...    62   2e-09
X12533-1|CAA31051.1|  184|Homo sapiens protein ( Human rap1A mRN...    62   3e-09
M22995-1|AAA36150.1|  184|Homo sapiens ras-related protein protein.    62   3e-09
BT020037-1|AAV38840.1|  229|Homo sapiens RAB, member of RAS onco...    62   3e-09
BC024281-1|AAH24281.1|  229|Homo sapiens RABL2B protein protein.       62   3e-09
BC020495-1|AAH20495.1|   99|Homo sapiens RABL2B protein protein.       62   3e-09
BC014879-1|AAH14879.1|  229|Homo sapiens RAB, member of RAS onco...    62   3e-09
BC014086-1|AAH14086.1|  184|Homo sapiens RAP1A, member of RAS on...    62   3e-09
AL049557-5|CAI22712.1|  184|Homo sapiens RAP1A, member of RAS on...    62   3e-09
AF493912-1|AAM12626.1|  184|Homo sapiens Ras family small GTP bi...    62   3e-09
AF095352-1|AAD51379.1|  228|Homo sapiens RAB-like protein 2B pro...    62   3e-09
AB051846-1|BAB61868.1|  758|Homo sapiens Raichu404X protein.           62   3e-09
X08004-1|CAB46488.1|  184|Homo sapiens protein ( Human mRNA for ...    61   4e-09
J00277-1|AAB02605.1|  189|Homo sapiens c-Ha-ras1 p21 protein pro...    61   4e-09
EF581377-1|ABQ52130.1|  184|Homo sapiens RAP1B, member of RAS on...    61   4e-09
CR542271-1|CAG47067.1|  189|Homo sapiens HRAS protein.                 61   4e-09
CR536579-1|CAG38816.1|  189|Homo sapiens HRAS protein.                 61   4e-09
CR407689-1|CAG28617.1|  184|Homo sapiens RAP1B protein.                61   4e-09
BT020093-1|AAV38896.1|  184|Homo sapiens RAP1B, member of RAS on...    61   4e-09
BT019421-1|AAV38228.1|  189|Homo sapiens v-Ha-ras Harvey rat sar...    61   4e-09
BC095471-1|AAH95471.1|  189|Homo sapiens v-Ha-ras Harvey rat sar...    61   4e-09
BC095467-1|AAH95467.1|  184|Homo sapiens RAP1B, member of RAS on...    61   4e-09
BC078173-1|AAH78173.1|  184|Homo sapiens RAP1B, member of RAS on...    61   4e-09
BC000176-1|AAH00176.1|  184|Homo sapiens RAP1B, member of RAS on...    61   4e-09
AL080212-1|CAB45777.1|  184|Homo sapiens hypothetical protein pr...    61   4e-09
AF493916-1|AAM12630.1|  189|Homo sapiens Ras family small GTP bi...    61   4e-09
AF493913-1|AAM12627.1|  184|Homo sapiens Ras family small GTP bi...    61   4e-09
AB062128-1|BAB93460.1|  184|Homo sapiens RAS oncogene family mem...    61   4e-09
X52987-1|CAA37178.1|  183|Homo sapiens protein ( Human mRNA for ...    60   6e-09
X12534-1|CAA31052.1|  183|Homo sapiens protein ( Human rap2 mRNA...    60   6e-09
CR542067-1|CAG46864.1|  208|Homo sapiens MRAS protein.                 60   6e-09
BT020057-1|AAV38860.1|  208|Homo sapiens muscle RAS oncogene hom...    60   6e-09
BC070031-1|AAH70031.1|  183|Homo sapiens RAP2A, member of RAS on...    60   6e-09
BC041333-1|AAH41333.1|  183|Homo sapiens RAP2A, member of RAS on...    60   6e-09
BC012362-1|AAH12362.1|  183|Homo sapiens RAP2B, member of RAS on...    60   6e-09
AL442067-4|CAI39499.1|  183|Homo sapiens RAP2A, member of RAS on...    60   6e-09
AF493918-1|AAM12632.1|  208|Homo sapiens Ras family small GTP bi...    60   6e-09
AF493915-1|AAM12629.1|  183|Homo sapiens Ras family small GTP bi...    60   6e-09
AF493914-1|AAM12628.1|  183|Homo sapiens Ras family small GTP bi...    60   6e-09
AF205602-1|AAN71845.1|  183|Homo sapiens RbBP-30 protein.              60   6e-09
AF043938-1|AAD02287.1|  208|Homo sapiens Ras-related protein M-R...    60   6e-09
AF022080-1|AAC52085.1|  208|Homo sapiens R-ras3 protein.               60   6e-09
X06821-1|CAA29969.1|  193|Homo sapiens protein ( Human rhoC mRNA...    60   8e-09
L25081-1|AAC33179.1|  193|Homo sapiens GTPase protein.                 60   8e-09
CR450360-1|CAG29356.1|  193|Homo sapiens ARHC protein.                 60   8e-09
BT019448-1|AAV38255.1|  193|Homo sapiens hypothetical protein MG...    60   8e-09
BC052808-1|AAH52808.1|  193|Homo sapiens ras homolog gene family...    60   8e-09
BC009177-1|AAH09177.1|  193|Homo sapiens ras homolog gene family...    60   8e-09
BC007245-1|AAH07245.1|  193|Homo sapiens ras homolog gene family...    60   8e-09
AL603832-8|CAI14061.1|   92|Homo sapiens ras homolog gene family...    60   8e-09
AL603832-7|CAI14060.1|  127|Homo sapiens ras homolog gene family...    60   8e-09
AL603832-6|CAI14059.1|  189|Homo sapiens ras homolog gene family...    60   8e-09
AL603832-5|CAI14058.1|  193|Homo sapiens ras homolog gene family...    60   8e-09
AL603832-4|CAI14057.1|  199|Homo sapiens ras homolog gene family...    60   8e-09
AF498972-1|AAM21119.1|  193|Homo sapiens small GTP binding prote...    60   8e-09
X05026-1|CAA28690.1|  193|Homo sapiens protein ( Human rho mRNA ...    60   1e-08
X02751-1|CAA26529.1|  189|Homo sapiens protein ( Human N-ras mRN...    60   1e-08
L25080-1|AAC33178.1|  193|Homo sapiens GTP-binding protein protein.    60   1e-08
L09159-1|AAA50612.1|  189|Homo sapiens multidrug resistance prot...    60   1e-08
L00043-1|AAA60255.1|  189|Homo sapiens NRAS protein.                   60   1e-08
BX647063-1|CAE46190.1|  193|Homo sapiens hypothetical protein pr...    60   1e-08
BT019870-1|AAV38673.1|  193|Homo sapiens ras homolog gene family...    60   1e-08
BT019735-1|AAV38540.1|  189|Homo sapiens neuroblastoma RAS viral...    60   1e-08
BT019734-1|AAV38539.1|  189|Homo sapiens neuroblastoma RAS viral...    60   1e-08
BC007997-1|AAH07997.1|  199|Homo sapiens RAS-like, estrogen-regu...    60   1e-08
BC005976-1|AAH05976.1|  193|Homo sapiens ras homolog gene family...    60   1e-08
BC005219-1|AAH05219.1|  189|Homo sapiens neuroblastoma RAS viral...    60   1e-08
BC001360-1|AAH01360.1|  193|Homo sapiens ras homolog gene family...    60   1e-08
AY428630-1|AAQ94397.1|  189|Homo sapiens neuroblastoma RAS viral...    60   1e-08
AL096773-6|CAI18827.1|  189|Homo sapiens neuroblastoma RAS viral...    60   1e-08
AF498970-1|AAM21117.1|  193|Homo sapiens small GTP binding prote...    60   1e-08
AF493919-1|AAM12633.1|  189|Homo sapiens Ras family small GTP bi...    60   1e-08
AF339750-1|AAK98530.1|  199|Homo sapiens ras-related estrogen-re...    60   1e-08
X06820-1|CAA29968.1|  196|Homo sapiens rhoB protein.                   59   1e-08
CR542272-1|CAG47068.1|  196|Homo sapiens ARHB protein.                 59   1e-08
BT019666-1|AAV38472.1|  184|Homo sapiens RAP1A, member of RAS on...    59   1e-08
BT019547-1|AAV38354.1|  196|Homo sapiens ras homolog gene family...    59   1e-08
BT019546-1|AAV38353.1|  196|Homo sapiens ras homolog gene family...    59   1e-08
BC066954-1|AAH66954.1|  196|Homo sapiens ras homolog gene family...    59   1e-08
AF498971-1|AAM21118.1|  196|Homo sapiens small GTP binding prote...    59   1e-08
AC023137-1|AAY24345.1|  196|Homo sapiens unknown protein.              59   1e-08
AK222556-1|BAD96276.1|  193|Homo sapiens ras homolog gene family...    59   2e-08
M35505-1|AAA35690.1|  150|Homo sapiens protein ( Human PR371 c-K...    58   3e-08
M35504-1|AAA35689.1|  150|Homo sapiens protein ( Human PR310 c-K...    58   3e-08
M31469-1|AAA36546.1|  216|Homo sapiens protein ( Human ras-like ...    58   3e-08
CR450347-1|CAG29343.1|  216|Homo sapiens RAN protein.                  58   3e-08
BT007271-1|AAP35935.1|  216|Homo sapiens RAN, member RAS oncogen...    58   3e-08
BC072000-1|AAH72000.1|  216|Homo sapiens RAN, member RAS oncogen...    58   3e-08
BC051908-1|AAH51908.2|  216|Homo sapiens RAN, member RAS oncogen...    58   3e-08
BC016654-1|AAH16654.1|  216|Homo sapiens RAN protein protein.          58   3e-08
BC014901-1|AAH14901.1|  216|Homo sapiens RAN, member RAS oncogen...    58   3e-08
BC014518-1|AAH14518.1|  216|Homo sapiens RAN, member RAS oncogen...    58   3e-08
BC004272-1|AAH04272.3|  216|Homo sapiens RAN, member RAS oncogen...    58   3e-08
AF501887-1|AAM15923.1|  216|Homo sapiens RAN small GTP binding p...    58   3e-08
AF052578-1|AAC05840.1|  216|Homo sapiens androgen receptor assoc...    58   3e-08
BC018067-1|AAH18067.1|   95|Homo sapiens RAB28 protein protein.        58   5e-08
Z35227-1|CAA84538.1|  191|Homo sapiens small G protein protein.        56   1e-07
EF015887-1|ABI97389.1|  170|Homo sapiens v-Ha-ras Harvey rat sar...    56   1e-07
CR450349-1|CAG29345.1|  191|Homo sapiens ARHH protein.                 56   1e-07
BC014261-1|AAH14261.1|  191|Homo sapiens ras homolog gene family...    56   1e-07
BC006499-1|AAH06499.1|  170|Homo sapiens v-Ha-ras Harvey rat sar...    56   1e-07
AJ437024-1|CAD24594.1|  170|Homo sapiens p19 H-RasIDX protein pr...    56   1e-07
AF498975-1|AAM21122.1|  191|Homo sapiens small GTP binding prote...    56   1e-07
Z78022-1|CAI42719.1|  183|Homo sapiens RAP2C, member of RAS onco...    56   1e-07
D85815-1|BAA19652.1|  210|Homo sapiens rhoHP1 protein.                 56   1e-07
BC035054-1|AAH35054.1|  221|Homo sapiens RAB28, member RAS oncog...    56   1e-07
BC001338-1|AAH01338.1|  210|Homo sapiens ras homolog gene family...    56   1e-07
AY336745-1|AAQ16115.1|  311|Homo sapiens RAB36 protein.                56   1e-07
AY298955-1|AAP55684.1|  183|Homo sapiens small GTPase RAP2C prot...    56   1e-07
AL049685-1|CAB41256.1|  183|Homo sapiens hypothetical protein pr...    56   1e-07
AF498973-1|AAM21120.1|  210|Homo sapiens small GTP binding prote...    56   1e-07
AF498955-1|AAM21103.1|  220|Homo sapiens small GTP binding prote...    56   1e-07
Y07565-1|CAA68850.1|  217|Homo sapiens RIN (Ric-related gene exp...    56   2e-07
U78164-1|AAB64245.1|  217|Homo sapiens RIBA protein.                   56   2e-07
U71204-1|AAB42214.1|  217|Homo sapiens rin protein.                    56   2e-07
BC018060-1|AAH18060.1|  217|Homo sapiens Ras-like without CAAX 2...    56   2e-07
AY563951-1|AAS75332.1|  217|Homo sapiens Ras family small GTP bi...    56   2e-07
AF493922-1|AAM12636.1|  217|Homo sapiens Ras family small GTP bi...    56   2e-07
X94703-1|CAA64364.1|  220|Homo sapiens rab28 protein.                  55   2e-07
BT020079-1|AAV38882.1|  298|Homo sapiens RAS (RAD and GEM)-like ...    55   2e-07
BT020078-1|AAV38881.1|  298|Homo sapiens RAS (RAD and GEM)-like ...    55   2e-07
BC039813-1|AAH39813.1|  298|Homo sapiens RAS (RAD and GEM)-like ...    55   2e-07
AL138920-2|CAH70591.1|  161|Homo sapiens RAB18, member RAS oncog...    55   2e-07
AL121751-5|CAB90274.1|  298|Homo sapiens RAS (RAD and GEM)-like ...    55   2e-07
AF152863-1|AAF74212.1|  298|Homo sapiens GTPase GES protein.           55   2e-07
X15015-1|CAA33119.1|  206|Homo sapiens protein ( Human RAL B gen...    55   3e-07
M35416-1|AAA60250.1|  206|Homo sapiens RALB protein.                   55   3e-07
BT006953-1|AAP35599.1|  206|Homo sapiens v-ral simian leukemia v...    55   3e-07
BC018163-1|AAH18163.1|  206|Homo sapiens v-ral simian leukemia v...    55   3e-07
AK127675-1|BAC87080.1|  227|Homo sapiens protein ( Homo sapiens ...    55   3e-07
AF493911-1|AAM12625.1|  206|Homo sapiens Ras family small GTP bi...    55   3e-07
AC012363-3|AAY14800.1|  206|Homo sapiens unknown protein.              55   3e-07
X61587-1|CAA43784.1|  191|Homo sapiens GTPase protein.                 54   4e-07
L11317-1|AAA60268.1|  191|Homo sapiens rhoG protein.                   54   4e-07
CR542105-1|CAG46902.1|  191|Homo sapiens ARHG protein.                 54   4e-07
CR450335-1|CAG29331.1|  191|Homo sapiens ARHG protein.                 54   4e-07
BT019872-1|AAV38675.1|  191|Homo sapiens ras homolog gene family...    54   4e-07
BC104178-1|AAI04179.1|  191|Homo sapiens ras homolog gene family...    54   4e-07
BC104177-1|AAI04178.1|  191|Homo sapiens ras homolog gene family...    54   4e-07
BC008065-1|AAH08065.1|  199|Homo sapiens DIRAS family, GTP-bindi...    54   4e-07
BC003403-1|AAH03403.1|  183|Homo sapiens RAP2C, member of RAS on...    54   4e-07
BA000025-79|BAB63329.1|  109|Homo sapiens TC4 protein.                 54   4e-07
AY563952-1|AAS75333.1|  191|Homo sapiens Rho family small GTP bi...    54   4e-07
AL353619-1|CAI15748.1|  199|Homo sapiens DIRAS family, GTP-bindi...    54   4e-07
AF498974-1|AAM21121.1|  191|Homo sapiens small GTP binding prote...    54   4e-07
AB209698-1|BAD92935.1|  127|Homo sapiens RAB18, member RAS oncog...    54   4e-07
AB088093-1|BAC54924.1|  109|Homo sapiens RAN protein.                  54   4e-07
AB076889-1|BAC01116.1|  199|Homo sapiens Di-Ras2 protein.              54   4e-07
Z80897-1|CAB62968.1|  185|Homo sapiens RAB, member of RAS oncoge...    54   6e-07

>X56741-1|CAA40065.1|  207|Homo sapiens rab8 small GTP binding
           protein protein.
          Length = 207

 Score =  154 bits (374), Expect = 3e-37
 Identities = 89/191 (46%), Positives = 118/191 (61%), Gaps = 3/191 (1%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           MAKTYD LFKLLLIGDSGVGKT +LFRFSEDAFN +FISTIGIDFKIRTI+LDGK++KLQ
Sbjct: 1   MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ 60

Query: 203 IWDTAGQERFRTITTAYSVVLWELCLSTMLRMRRALKTLRIGLGTLKRMPVLMLRK*YLE 382
           IWDTAGQERFRTITTAY      + L   +   ++   +R  +  ++      + K  L 
Sbjct: 61  IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG 120

Query: 383 ISVT*ILKDRYQRSEVNN*P*NIR*NLWRHQQKTR*MLNMH---FHFSQGLKAKMEKKQE 553
                 + D+ Q S+       +   +   +   +  +N+    F  ++ +KAKM+KK E
Sbjct: 121 NKCD--VNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLE 178

Query: 554 ASNPSGGRSGV 586
            ++P G   GV
Sbjct: 179 GNSPQGSNQGV 189



 Score =  146 bits (353), Expect = 1e-34
 Identities = 66/84 (78%), Positives = 80/84 (95%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+MGIMLVYD+TNEKSF+NI+NWIRNIEE+ASADVEKMILGNKCD++ +RQVSKERGE+
Sbjct: 79  RGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEK 138

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
           LA++Y IKF+ETSAK ++NVE AF
Sbjct: 139 LALDYGIKFMETSAKANINVENAF 162


>CR542274-1|CAG47070.1|  207|Homo sapiens RAB8A protein.
          Length = 207

 Score =  154 bits (374), Expect = 3e-37
 Identities = 89/191 (46%), Positives = 118/191 (61%), Gaps = 3/191 (1%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           MAKTYD LFKLLLIGDSGVGKT +LFRFSEDAFN +FISTIGIDFKIRTI+LDGK++KLQ
Sbjct: 1   MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ 60

Query: 203 IWDTAGQERFRTITTAYSVVLWELCLSTMLRMRRALKTLRIGLGTLKRMPVLMLRK*YLE 382
           IWDTAGQERFRTITTAY      + L   +   ++   +R  +  ++      + K  L 
Sbjct: 61  IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG 120

Query: 383 ISVT*ILKDRYQRSEVNN*P*NIR*NLWRHQQKTR*MLNMH---FHFSQGLKAKMEKKQE 553
                 + D+ Q S+       +   +   +   +  +N+    F  ++ +KAKM+KK E
Sbjct: 121 NKCD--VNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLE 178

Query: 554 ASNPSGGRSGV 586
            ++P G   GV
Sbjct: 179 GNSPQGSNQGV 189



 Score =  146 bits (353), Expect = 1e-34
 Identities = 66/84 (78%), Positives = 80/84 (95%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+MGIMLVYD+TNEKSF+NI+NWIRNIEE+ASADVEKMILGNKCD++ +RQVSKERGE+
Sbjct: 79  RGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEK 138

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
           LA++Y IKF+ETSAK ++NVE AF
Sbjct: 139 LALDYGIKFMETSAKANINVENAF 162


>CR536583-1|CAG38820.1|  207|Homo sapiens RAB8A protein.
          Length = 207

 Score =  154 bits (374), Expect = 3e-37
 Identities = 89/191 (46%), Positives = 118/191 (61%), Gaps = 3/191 (1%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           MAKTYD LFKLLLIGDSGVGKT +LFRFSEDAFN +FISTIGIDFKIRTI+LDGK++KLQ
Sbjct: 1   MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ 60

Query: 203 IWDTAGQERFRTITTAYSVVLWELCLSTMLRMRRALKTLRIGLGTLKRMPVLMLRK*YLE 382
           IWDTAGQERFRTITTAY      + L   +   ++   +R  +  ++      + K  L 
Sbjct: 61  IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG 120

Query: 383 ISVT*ILKDRYQRSEVNN*P*NIR*NLWRHQQKTR*MLNMH---FHFSQGLKAKMEKKQE 553
                 + D+ Q S+       +   +   +   +  +N+    F  ++ +KAKM+KK E
Sbjct: 121 NKCD--VNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLE 178

Query: 554 ASNPSGGRSGV 586
            ++P G   GV
Sbjct: 179 GNSPQGSNQGV 189



 Score =  146 bits (353), Expect = 1e-34
 Identities = 66/84 (78%), Positives = 80/84 (95%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+MGIMLVYD+TNEKSF+NI+NWIRNIEE+ASADVEKMILGNKCD++ +RQVSKERGE+
Sbjct: 79  RGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEK 138

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
           LA++Y IKF+ETSAK ++NVE AF
Sbjct: 139 LALDYGIKFMETSAKANINVENAF 162


>BT007184-1|AAP35848.1|  207|Homo sapiens mel transforming oncogene
           (derived from cell line NK14)- RAB8 homolog protein.
          Length = 207

 Score =  154 bits (374), Expect = 3e-37
 Identities = 89/191 (46%), Positives = 118/191 (61%), Gaps = 3/191 (1%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           MAKTYD LFKLLLIGDSGVGKT +LFRFSEDAFN +FISTIGIDFKIRTI+LDGK++KLQ
Sbjct: 1   MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ 60

Query: 203 IWDTAGQERFRTITTAYSVVLWELCLSTMLRMRRALKTLRIGLGTLKRMPVLMLRK*YLE 382
           IWDTAGQERFRTITTAY      + L   +   ++   +R  +  ++      + K  L 
Sbjct: 61  IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG 120

Query: 383 ISVT*ILKDRYQRSEVNN*P*NIR*NLWRHQQKTR*MLNMH---FHFSQGLKAKMEKKQE 553
                 + D+ Q S+       +   +   +   +  +N+    F  ++ +KAKM+KK E
Sbjct: 121 NKCD--VNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLE 178

Query: 554 ASNPSGGRSGV 586
            ++P G   GV
Sbjct: 179 GNSPQGSNQGV 189



 Score =  146 bits (353), Expect = 1e-34
 Identities = 66/84 (78%), Positives = 80/84 (95%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+MGIMLVYD+TNEKSF+NI+NWIRNIEE+ASADVEKMILGNKCD++ +RQVSKERGE+
Sbjct: 79  RGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEK 138

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
           LA++Y IKF+ETSAK ++NVE AF
Sbjct: 139 LALDYGIKFMETSAKANINVENAF 162


>BC002977-1|AAH02977.1|  207|Homo sapiens RAB8A, member RAS oncogene
           family protein.
          Length = 207

 Score =  154 bits (374), Expect = 3e-37
 Identities = 89/191 (46%), Positives = 118/191 (61%), Gaps = 3/191 (1%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           MAKTYD LFKLLLIGDSGVGKT +LFRFSEDAFN +FISTIGIDFKIRTI+LDGK++KLQ
Sbjct: 1   MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ 60

Query: 203 IWDTAGQERFRTITTAYSVVLWELCLSTMLRMRRALKTLRIGLGTLKRMPVLMLRK*YLE 382
           IWDTAGQERFRTITTAY      + L   +   ++   +R  +  ++      + K  L 
Sbjct: 61  IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG 120

Query: 383 ISVT*ILKDRYQRSEVNN*P*NIR*NLWRHQQKTR*MLNMH---FHFSQGLKAKMEKKQE 553
                 + D+ Q S+       +   +   +   +  +N+    F  ++ +KAKM+KK E
Sbjct: 121 NKCD--VNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLE 178

Query: 554 ASNPSGGRSGV 586
            ++P G   GV
Sbjct: 179 GNSPQGSNQGV 189



 Score =  146 bits (353), Expect = 1e-34
 Identities = 66/84 (78%), Positives = 80/84 (95%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+MGIMLVYD+TNEKSF+NI+NWIRNIEE+ASADVEKMILGNKCD++ +RQVSKERGE+
Sbjct: 79  RGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEK 138

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
           LA++Y IKF+ETSAK ++NVE AF
Sbjct: 139 LALDYGIKFMETSAKANINVENAF 162


>AF498943-1|AAM21091.1|  207|Homo sapiens small GTP binding protein
           RAB8 protein.
          Length = 207

 Score =  154 bits (374), Expect = 3e-37
 Identities = 89/191 (46%), Positives = 118/191 (61%), Gaps = 3/191 (1%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           MAKTYD LFKLLLIGDSGVGKT +LFRFSEDAFN +FISTIGIDFKIRTI+LDGK++KLQ
Sbjct: 1   MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ 60

Query: 203 IWDTAGQERFRTITTAYSVVLWELCLSTMLRMRRALKTLRIGLGTLKRMPVLMLRK*YLE 382
           IWDTAGQERFRTITTAY      + L   +   ++   +R  +  ++      + K  L 
Sbjct: 61  IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG 120

Query: 383 ISVT*ILKDRYQRSEVNN*P*NIR*NLWRHQQKTR*MLNMH---FHFSQGLKAKMEKKQE 553
                 + D+ Q S+       +   +   +   +  +N+    F  ++ +KAKM+KK E
Sbjct: 121 NKCD--VNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLE 178

Query: 554 ASNPSGGRSGV 586
            ++P G   GV
Sbjct: 179 GNSPQGSNQGV 189



 Score =  146 bits (353), Expect = 1e-34
 Identities = 66/84 (78%), Positives = 80/84 (95%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+MGIMLVYD+TNEKSF+NI+NWIRNIEE+ASADVEKMILGNKCD++ +RQVSKERGE+
Sbjct: 79  RGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEK 138

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
           LA++Y IKF+ETSAK ++NVE AF
Sbjct: 139 LALDYGIKFMETSAKANINVENAF 162


>BC020654-1|AAH20654.1|  207|Homo sapiens RAB8B, member RAS oncogene
           family protein.
          Length = 207

 Score =  149 bits (361), Expect = 1e-35
 Identities = 70/77 (90%), Positives = 74/77 (96%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           MAKTYD LFKLLLIGDSGVGKT +LFRFSEDAFN +FISTIGIDFKIRTI+LDGKK+KLQ
Sbjct: 1   MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQ 60

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFRTITTAY
Sbjct: 61  IWDTAGQERFRTITTAY 77



 Score =  147 bits (355), Expect = 6e-35
 Identities = 67/84 (79%), Positives = 79/84 (94%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+MGIMLVYD+TNEKSF+NIKNWIRNIEE+AS+DVE+MILGNKCD++ +RQVSKERGE+
Sbjct: 79  RGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEK 138

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
           LAI+Y IKF+ETSAK S NVE AF
Sbjct: 139 LAIDYGIKFLETSAKSSANVEEAF 162


>AB038995-1|BAA92249.1|  207|Homo sapiens RAB-8b protein protein.
          Length = 207

 Score =  149 bits (361), Expect = 1e-35
 Identities = 70/77 (90%), Positives = 74/77 (96%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           MAKTYD LFKLLLIGDSGVGKT +LFRFSEDAFN +FISTIGIDFKIRTI+LDGKK+KLQ
Sbjct: 1   MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQ 60

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFRTITTAY
Sbjct: 61  IWDTAGQERFRTITTAY 77



 Score =  147 bits (355), Expect = 6e-35
 Identities = 67/84 (79%), Positives = 79/84 (94%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+MGIMLVYD+TNEKSF+NIKNWIRNIEE+AS+DVE+MILGNKCD++ +RQVSKERGE+
Sbjct: 79  RGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEK 138

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
           LAI+Y IKF+ETSAK S NVE AF
Sbjct: 139 LAIDYGIKFLETSAKSSANVEEAF 162


>S53268-1|AAB19681.1|  206|Homo sapiens RAS-related protein MEL
           protein.
          Length = 206

 Score =  149 bits (360), Expect = 1e-35
 Identities = 89/191 (46%), Positives = 118/191 (61%), Gaps = 3/191 (1%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           MAKTYD LFKLLLIGDSGVGKT +LFRFSEDAFN +FISTIGIDFKIRTI+LDGK++KLQ
Sbjct: 1   MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ 60

Query: 203 IWDTAGQERFRTITTAYSVVLWELCLSTMLRMRRALKTLRIGLGTLKRMPVLMLRK*YLE 382
           IWDTAGQERFRTITTAY      + L   +   ++   +R  +  ++      + K  L 
Sbjct: 61  IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG 120

Query: 383 ISVT*ILKDRYQRSEVNN*P*NIR*NLWRHQQKTR*MLNMH---FHFSQGLKAKMEKKQE 553
                 + D+ Q S+       +   +   +   +  +N+    F  ++ +KAKM+KK +
Sbjct: 121 NKCD--VNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKWK 178

Query: 554 ASNPSGGRSGV 586
           A+ P G   GV
Sbjct: 179 ATAP-GSNQGV 188



 Score =  146 bits (353), Expect = 1e-34
 Identities = 66/84 (78%), Positives = 80/84 (95%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+MGIMLVYD+TNEKSF+NI+NWIRNIEE+ASADVEKMILGNKCD++ +RQVSKERGE+
Sbjct: 79  RGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEK 138

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
           LA++Y IKF+ETSAK ++NVE AF
Sbjct: 139 LALDYGIKFMETSAKANINVENAF 162


>CR457303-1|CAG33584.1|  200|Homo sapiens RAB10 protein.
          Length = 200

 Score =  138 bits (333), Expect = 3e-32
 Identities = 62/75 (82%), Positives = 70/75 (93%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           KTYD LFKLLLIGDSGVGKT +LFRFS+DAFN +FISTIGIDFKI+T++L GKK+KLQIW
Sbjct: 4   KTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIW 63

Query: 209 DTAGQERFRTITTAY 253
           DTAGQERF TITT+Y
Sbjct: 64  DTAGQERFHTITTSY 78



 Score =  124 bits (298), Expect = 5e-28
 Identities = 55/87 (63%), Positives = 72/87 (82%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+MGIMLVYD+TN KSFENI  W+RNI+E+A+ DVE+M+LGNKCD+D +R V K +
Sbjct: 77  SYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGK 136

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GEQ+A E+ I+F ETSAK ++N+E AF
Sbjct: 137 GEQIAREHGIRFFETSAKANINIEKAF 163


>BC000896-1|AAH00896.1|  200|Homo sapiens RAB10, member RAS oncogene
           family protein.
          Length = 200

 Score =  138 bits (333), Expect = 3e-32
 Identities = 62/75 (82%), Positives = 70/75 (93%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           KTYD LFKLLLIGDSGVGKT +LFRFS+DAFN +FISTIGIDFKI+T++L GKK+KLQIW
Sbjct: 4   KTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIW 63

Query: 209 DTAGQERFRTITTAY 253
           DTAGQERF TITT+Y
Sbjct: 64  DTAGQERFHTITTSY 78



 Score =  124 bits (298), Expect = 5e-28
 Identities = 55/87 (63%), Positives = 72/87 (82%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+MGIMLVYD+TN KSFENI  W+RNI+E+A+ DVE+M+LGNKCD+D +R V K +
Sbjct: 77  SYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGK 136

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GEQ+A E+ I+F ETSAK ++N+E AF
Sbjct: 137 GEQIAREHGIRFFETSAKANINIEKAF 163


>AK023223-1|BAB14474.1|  200|Homo sapiens protein ( Homo sapiens
           cDNA FLJ13161 fis, clone NT2RP3003589, highly similar to
           Homo sapiens ras-related GTP-binding protein mRNA. ).
          Length = 200

 Score =  138 bits (333), Expect = 3e-32
 Identities = 62/75 (82%), Positives = 70/75 (93%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           KTYD LFKLLLIGDSGVGKT +LFRFS+DAFN +FISTIGIDFKI+T++L GKK+KLQIW
Sbjct: 4   KTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIW 63

Query: 209 DTAGQERFRTITTAY 253
           DTAGQERF TITT+Y
Sbjct: 64  DTAGQERFHTITTSY 78



 Score =  124 bits (298), Expect = 5e-28
 Identities = 55/87 (63%), Positives = 72/87 (82%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+MGIMLVYD+TN KSFENI  W+RNI+E+A+ DVE+M+LGNKCD+D +R V K +
Sbjct: 77  SYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGK 136

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GEQ+A E+ I+F ETSAK ++N+E AF
Sbjct: 137 GEQIAREHGIRFFETSAKANINIEKAF 163


>AF498945-1|AAM21093.1|  200|Homo sapiens small GTP binding protein
           RAB10 protein.
          Length = 200

 Score =  138 bits (333), Expect = 3e-32
 Identities = 62/75 (82%), Positives = 70/75 (93%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           KTYD LFKLLLIGDSGVGKT +LFRFS+DAFN +FISTIGIDFKI+T++L GKK+KLQIW
Sbjct: 4   KTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIW 63

Query: 209 DTAGQERFRTITTAY 253
           DTAGQERF TITT+Y
Sbjct: 64  DTAGQERFHTITTSY 78



 Score =  124 bits (298), Expect = 5e-28
 Identities = 55/87 (63%), Positives = 72/87 (82%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+MGIMLVYD+TN KSFENI  W+RNI+E+A+ DVE+M+LGNKCD+D +R V K +
Sbjct: 77  SYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGK 136

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GEQ+A E+ I+F ETSAK ++N+E AF
Sbjct: 137 GEQIAREHGIRFFETSAKANINIEKAF 163


>AF297660-1|AAG13413.1|  200|Homo sapiens RAB10 protein.
          Length = 200

 Score =  138 bits (333), Expect = 3e-32
 Identities = 62/75 (82%), Positives = 70/75 (93%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           KTYD LFKLLLIGDSGVGKT +LFRFS+DAFN +FISTIGIDFKI+T++L GKK+KLQIW
Sbjct: 4   KTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIW 63

Query: 209 DTAGQERFRTITTAY 253
           DTAGQERF TITT+Y
Sbjct: 64  DTAGQERFHTITTSY 78



 Score =  124 bits (298), Expect = 5e-28
 Identities = 55/87 (63%), Positives = 72/87 (82%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+MGIMLVYD+TN KSFENI  W+RNI+E+A+ DVE+M+LGNKCD+D +R V K +
Sbjct: 77  SYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGK 136

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GEQ+A E+ I+F ETSAK ++N+E AF
Sbjct: 137 GEQIAREHGIRFFETSAKANINIEKAF 163


>AF106681-1|AAD43034.1|  200|Homo sapiens ras-related GTP-binding
           protein protein.
          Length = 200

 Score =  138 bits (333), Expect = 3e-32
 Identities = 62/75 (82%), Positives = 70/75 (93%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           KTYD LFKLLLIGDSGVGKT +LFRFS+DAFN +FISTIGIDFKI+T++L GKK+KLQIW
Sbjct: 4   KTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIW 63

Query: 209 DTAGQERFRTITTAY 253
           DTAGQERF TITT+Y
Sbjct: 64  DTAGQERFHTITTSY 78



 Score =  124 bits (298), Expect = 5e-28
 Identities = 55/87 (63%), Positives = 72/87 (82%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+MGIMLVYD+TN KSFENI  W+RNI+E+A+ DVE+M+LGNKCD+D +R V K +
Sbjct: 77  SYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGK 136

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GEQ+A E+ I+F ETSAK ++N+E AF
Sbjct: 137 GEQIAREHGIRFFETSAKANINIEKAF 163


>AF086917-1|AAP97147.1|  200|Homo sapiens rab10 protein.
          Length = 200

 Score =  138 bits (333), Expect = 3e-32
 Identities = 62/75 (82%), Positives = 70/75 (93%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           KTYD LFKLLLIGDSGVGKT +LFRFS+DAFN +FISTIGIDFKI+T++L GKK+KLQIW
Sbjct: 4   KTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIW 63

Query: 209 DTAGQERFRTITTAY 253
           DTAGQERF TITT+Y
Sbjct: 64  DTAGQERFHTITTSY 78



 Score =  124 bits (298), Expect = 5e-28
 Identities = 55/87 (63%), Positives = 72/87 (82%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+MGIMLVYD+TN KSFENI  W+RNI+E+A+ DVE+M+LGNKCD+D +R V K +
Sbjct: 77  SYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGK 136

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GEQ+A E+ I+F ETSAK ++N+E AF
Sbjct: 137 GEQIAREHGIRFFETSAKANINIEKAF 163


>AB209767-1|BAD93004.1|  152|Homo sapiens mel transforming oncogene
           variant protein.
          Length = 152

 Score =  137 bits (332), Expect = 3e-32
 Identities = 64/72 (88%), Positives = 69/72 (95%)
 Frame = +2

Query: 38  DCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTA 217
           D LFKLLLIGDSGVGKT +LFRFSEDAFN +FISTIGIDFKIRTI+LDGK++KLQIWDTA
Sbjct: 1   DYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTA 60

Query: 218 GQERFRTITTAY 253
           GQERFRTITTAY
Sbjct: 61  GQERFRTITTAY 72



 Score = 63.3 bits (147), Expect = 9e-10
 Identities = 26/30 (86%), Positives = 30/30 (100%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEE 345
           RG+MGIMLVYD+TNEKSF+NI+NWIRNIEE
Sbjct: 74  RGAMGIMLVYDITNEKSFDNIRNWIRNIEE 103


>BC094846-1|AAH94846.1|  244|Homo sapiens RAB13 protein protein.
          Length = 244

 Score =  135 bits (327), Expect = 1e-31
 Identities = 61/80 (76%), Positives = 72/80 (90%)
 Frame = +2

Query: 14  VVKMAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKV 193
           V  MAK YD LFKLLLIGDSGVGKT ++ RF+ED FN ++ISTIGIDFKIRT+D++GKK+
Sbjct: 39  VSAMAKAYDHLFKLLLIGDSGVGKTCLIIRFAEDNFNNTYISTIGIDFKIRTVDIEGKKI 98

Query: 194 KLQIWDTAGQERFRTITTAY 253
           KLQ+WDTAGQERF+TITTAY
Sbjct: 99  KLQVWDTAGQERFKTITTAY 118



 Score =  123 bits (297), Expect = 6e-28
 Identities = 53/85 (62%), Positives = 77/85 (90%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+MGI+LVYD+T+EKSFENI+NW+++I+ENASA VE+++LGNKCD++++R+V KE+ ++
Sbjct: 120 RGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRKVQKEQADK 179

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
           LA E+ I+F ETSAK S+NV+ AFS
Sbjct: 180 LAREHGIRFFETSAKSSMNVDEAFS 204


>X75593-1|CAA53266.1|  203|Homo sapiens rab 13 protein.
          Length = 203

 Score =  135 bits (326), Expect = 2e-31
 Identities = 60/77 (77%), Positives = 71/77 (92%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           MAK YD LFKLLLIGDSGVGKT ++ RF+ED FN ++ISTIGIDFKIRT+D++GKK+KLQ
Sbjct: 1   MAKAYDHLFKLLLIGDSGVGKTCLIIRFAEDNFNNTYISTIGIDFKIRTVDIEGKKIKLQ 60

Query: 203 IWDTAGQERFRTITTAY 253
           +WDTAGQERF+TITTAY
Sbjct: 61  VWDTAGQERFKTITTAY 77



 Score =  123 bits (297), Expect = 6e-28
 Identities = 53/85 (62%), Positives = 77/85 (90%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+MGI+LVYD+T+EKSFENI+NW+++I+ENASA VE+++LGNKCD++++R+V KE+ ++
Sbjct: 79  RGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRKVQKEQADK 138

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
           LA E+ I+F ETSAK S+NV+ AFS
Sbjct: 139 LAREHGIRFFETSAKSSMNVDEAFS 163


>BT019701-1|AAV38507.1|  203|Homo sapiens RAB13, member RAS oncogene
           family protein.
          Length = 203

 Score =  135 bits (326), Expect = 2e-31
 Identities = 60/77 (77%), Positives = 71/77 (92%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           MAK YD LFKLLLIGDSGVGKT ++ RF+ED FN ++ISTIGIDFKIRT+D++GKK+KLQ
Sbjct: 1   MAKAYDHLFKLLLIGDSGVGKTCLIIRFAEDNFNNTYISTIGIDFKIRTVDIEGKKIKLQ 60

Query: 203 IWDTAGQERFRTITTAY 253
           +WDTAGQERF+TITTAY
Sbjct: 61  VWDTAGQERFKTITTAY 77



 Score =  123 bits (297), Expect = 6e-28
 Identities = 53/85 (62%), Positives = 77/85 (90%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+MGI+LVYD+T+EKSFENI+NW+++I+ENASA VE+++LGNKCD++++R+V KE+ ++
Sbjct: 79  RGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRKVQKEQADK 138

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
           LA E+ I+F ETSAK S+NV+ AFS
Sbjct: 139 LAREHGIRFFETSAKSSMNVDEAFS 163


>BT019700-1|AAV38506.1|  203|Homo sapiens RAB13, member RAS oncogene
           family protein.
          Length = 203

 Score =  135 bits (326), Expect = 2e-31
 Identities = 60/77 (77%), Positives = 71/77 (92%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           MAK YD LFKLLLIGDSGVGKT ++ RF+ED FN ++ISTIGIDFKIRT+D++GKK+KLQ
Sbjct: 1   MAKAYDHLFKLLLIGDSGVGKTCLIIRFAEDNFNNTYISTIGIDFKIRTVDIEGKKIKLQ 60

Query: 203 IWDTAGQERFRTITTAY 253
           +WDTAGQERF+TITTAY
Sbjct: 61  VWDTAGQERFKTITTAY 77



 Score =  123 bits (297), Expect = 6e-28
 Identities = 53/85 (62%), Positives = 77/85 (90%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+MGI+LVYD+T+EKSFENI+NW+++I+ENASA VE+++LGNKCD++++R+V KE+ ++
Sbjct: 79  RGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRKVQKEQADK 138

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
           LA E+ I+F ETSAK S+NV+ AFS
Sbjct: 139 LAREHGIRFFETSAKSSMNVDEAFS 163


>BC073168-1|AAH73168.2|  203|Homo sapiens RAB13, member RAS oncogene
           family protein.
          Length = 203

 Score =  135 bits (326), Expect = 2e-31
 Identities = 60/77 (77%), Positives = 71/77 (92%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           MAK YD LFKLLLIGDSGVGKT ++ RF+ED FN ++ISTIGIDFKIRT+D++GKK+KLQ
Sbjct: 1   MAKAYDHLFKLLLIGDSGVGKTCLIIRFAEDNFNNTYISTIGIDFKIRTVDIEGKKIKLQ 60

Query: 203 IWDTAGQERFRTITTAY 253
           +WDTAGQERF+TITTAY
Sbjct: 61  VWDTAGQERFKTITTAY 77



 Score =  123 bits (297), Expect = 6e-28
 Identities = 53/85 (62%), Positives = 77/85 (90%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+MGI+LVYD+T+EKSFENI+NW+++I+ENASA VE+++LGNKCD++++R+V KE+ ++
Sbjct: 79  RGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRKVQKEQADK 138

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
           LA E+ I+F ETSAK S+NV+ AFS
Sbjct: 139 LAREHGIRFFETSAKSSMNVDEAFS 163


>BC000799-1|AAH00799.1|  203|Homo sapiens RAB13, member RAS oncogene
           family protein.
          Length = 203

 Score =  135 bits (326), Expect = 2e-31
 Identities = 60/77 (77%), Positives = 71/77 (92%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           MAK YD LFKLLLIGDSGVGKT ++ RF+ED FN ++ISTIGIDFKIRT+D++GKK+KLQ
Sbjct: 1   MAKAYDHLFKLLLIGDSGVGKTCLIIRFAEDNFNNTYISTIGIDFKIRTVDIEGKKIKLQ 60

Query: 203 IWDTAGQERFRTITTAY 253
           +WDTAGQERF+TITTAY
Sbjct: 61  VWDTAGQERFKTITTAY 77



 Score =  123 bits (297), Expect = 6e-28
 Identities = 53/85 (62%), Positives = 77/85 (90%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+MGI+LVYD+T+EKSFENI+NW+++I+ENASA VE+++LGNKCD++++R+V KE+ ++
Sbjct: 79  RGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRKVQKEQADK 138

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
           LA E+ I+F ETSAK S+NV+ AFS
Sbjct: 139 LAREHGIRFFETSAKSSMNVDEAFS 163


>AY423722-1|AAS00485.1|  203|Homo sapiens growth-inhibiting gene 4
           protein protein.
          Length = 203

 Score =  135 bits (326), Expect = 2e-31
 Identities = 60/77 (77%), Positives = 71/77 (92%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           MAK YD LFKLLLIGDSGVGKT ++ RF+ED FN ++ISTIGIDFKIRT+D++GKK+KLQ
Sbjct: 1   MAKAYDHLFKLLLIGDSGVGKTCLIIRFAEDNFNNTYISTIGIDFKIRTVDIEGKKIKLQ 60

Query: 203 IWDTAGQERFRTITTAY 253
           +WDTAGQERF+TITTAY
Sbjct: 61  VWDTAGQERFKTITTAY 77



 Score =  123 bits (297), Expect = 6e-28
 Identities = 53/85 (62%), Positives = 77/85 (90%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+MGI+LVYD+T+EKSFENI+NW+++I+ENASA VE+++LGNKCD++++R+V KE+ ++
Sbjct: 79  RGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRKVQKEQADK 138

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
           LA E+ I+F ETSAK S+NV+ AFS
Sbjct: 139 LAREHGIRFFETSAKSSMNVDEAFS 163


>AL358472-17|CAI14031.1|  203|Homo sapiens RAB13, member RAS
           oncogene family protein.
          Length = 203

 Score =  135 bits (326), Expect = 2e-31
 Identities = 60/77 (77%), Positives = 71/77 (92%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           MAK YD LFKLLLIGDSGVGKT ++ RF+ED FN ++ISTIGIDFKIRT+D++GKK+KLQ
Sbjct: 1   MAKAYDHLFKLLLIGDSGVGKTCLIIRFAEDNFNNTYISTIGIDFKIRTVDIEGKKIKLQ 60

Query: 203 IWDTAGQERFRTITTAY 253
           +WDTAGQERF+TITTAY
Sbjct: 61  VWDTAGQERFKTITTAY 77



 Score =  123 bits (297), Expect = 6e-28
 Identities = 53/85 (62%), Positives = 77/85 (90%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+MGI+LVYD+T+EKSFENI+NW+++I+ENASA VE+++LGNKCD++++R+V KE+ ++
Sbjct: 79  RGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRKVQKEQADK 138

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
           LA E+ I+F ETSAK S+NV+ AFS
Sbjct: 139 LAREHGIRFFETSAKSSMNVDEAFS 163


>AF498948-1|AAM21096.1|  203|Homo sapiens small GTP binding protein
           RAB13 protein.
          Length = 203

 Score =  135 bits (326), Expect = 2e-31
 Identities = 60/77 (77%), Positives = 71/77 (92%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           MAK YD LFKLLLIGDSGVGKT ++ RF+ED FN ++ISTIGIDFKIRT+D++GKK+KLQ
Sbjct: 1   MAKAYDHLFKLLLIGDSGVGKTCLIIRFAEDNFNNTYISTIGIDFKIRTVDIEGKKIKLQ 60

Query: 203 IWDTAGQERFRTITTAY 253
           +WDTAGQERF+TITTAY
Sbjct: 61  VWDTAGQERFKTITTAY 77



 Score =  123 bits (297), Expect = 6e-28
 Identities = 53/85 (62%), Positives = 77/85 (90%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+MGI+LVYD+T+EKSFENI+NW+++I+ENASA VE+++LGNKCD++++R+V KE+ ++
Sbjct: 79  RGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRKVQKEQADK 138

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
           LA E+ I+F ETSAK S+NV+ AFS
Sbjct: 139 LAREHGIRFFETSAKSSMNVDEAFS 163


>X79781-1|CAA56177.1|  201|Homo sapiens ray protein.
          Length = 201

 Score =  124 bits (298), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 71/77 (92%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           MA+ YD LFKLL+IGDSGVGK+S+L RF+++ F+ S+I+TIG+DFKIRT++++G+KVKLQ
Sbjct: 1   MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQ 60

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFRTIT+ Y
Sbjct: 61  IWDTAGQERFRTITSTY 77



 Score = 70.9 bits (166), Expect = 5e-12
 Identities = 34/85 (40%), Positives = 56/85 (65%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+ G+++VYDVT+ +SF N+K W+  I +N   DV ++++GNK D   ++ V  E   +
Sbjct: 79  RGTHGVIVVYDVTSAESFVNVKRWLHEINQNCD-DVCRILVGNKNDDPERKVVETEDAYK 137

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
            A +  I+  ETSAK+++NVE  F+
Sbjct: 138 FAGQMGIQLFETSAKENVNVEEMFN 162


>M28209-1|AAA60240.1|  205|Homo sapiens GTP-binding protein protein.
          Length = 205

 Score =  124 bits (298), Expect = 5e-28
 Identities = 56/77 (72%), Positives = 67/77 (87%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           M   YD LFKLLLIGDSGVGK+ +L RF++D +  S+ISTIG+DFKIRTI+LDGK +KLQ
Sbjct: 4   MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQ 63

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFRTIT++Y
Sbjct: 64  IWDTAGQERFRTITSSY 80



 Score = 89.4 bits (212), Expect = 1e-17
 Identities = 39/88 (44%), Positives = 63/88 (71%)
 Frame = +1

Query: 244 NSILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKE 423
           +S  RG+ GI++VYDVT+++SF N+K W++ I+  AS +V K+++GNKCDL +++ V   
Sbjct: 78  SSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYT 137

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAF 507
             ++ A    I F+ETSAK++ NVE +F
Sbjct: 138 TAKEFADSLGIPFLETSAKNATNVEQSF 165


>CR541683-1|CAG46484.1|  201|Homo sapiens RAB35 protein.
          Length = 201

 Score =  124 bits (298), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 71/77 (92%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           MA+ YD LFKLL+IGDSGVGK+S+L RF+++ F+ S+I+TIG+DFKIRT++++G+KVKLQ
Sbjct: 1   MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQ 60

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFRTIT+ Y
Sbjct: 61  IWDTAGQERFRTITSTY 77



 Score = 70.9 bits (166), Expect = 5e-12
 Identities = 34/85 (40%), Positives = 56/85 (65%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+ G+++VYDVT+ +SF N+K W+  I +N   DV ++++GNK D   ++ V  E   +
Sbjct: 79  RGTHGVIVVYDVTSAESFVNVKRWLHEINQNCD-DVCRILVGNKNDDPERKVVETEDAYK 137

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
            A +  I+  ETSAK+++NVE  F+
Sbjct: 138 FAGQMGIQLFETSAKENVNVEEMFN 162


>CR536488-1|CAG38727.1|  205|Homo sapiens RAB1A protein.
          Length = 205

 Score =  124 bits (298), Expect = 5e-28
 Identities = 56/77 (72%), Positives = 67/77 (87%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           M   YD LFKLLLIGDSGVGK+ +L RF++D +  S+ISTIG+DFKIRTI+LDGK +KLQ
Sbjct: 4   MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQ 63

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFRTIT++Y
Sbjct: 64  IWDTAGQERFRTITSSY 80



 Score = 89.4 bits (212), Expect = 1e-17
 Identities = 39/88 (44%), Positives = 63/88 (71%)
 Frame = +1

Query: 244 NSILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKE 423
           +S  RG+ GI++VYDVT+++SF N+K W++ I+  AS +V K+++GNKCDL +++ V   
Sbjct: 78  SSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYT 137

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAF 507
             ++ A    I F+ETSAK++ NVE +F
Sbjct: 138 TAKEFADSLGIPFLETSAKNATNVEQSF 165


>CR536486-1|CAG38725.1|  201|Homo sapiens RAB35 protein.
          Length = 201

 Score =  124 bits (298), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 71/77 (92%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           MA+ YD LFKLL+IGDSGVGK+S+L RF+++ F+ S+I+TIG+DFKIRT++++G+KVKLQ
Sbjct: 1   MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQ 60

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFRTIT+ Y
Sbjct: 61  IWDTAGQERFRTITSTY 77



 Score = 70.9 bits (166), Expect = 5e-12
 Identities = 34/85 (40%), Positives = 56/85 (65%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+ G+++VYDVT+ +SF N+K W+  I +N   DV ++++GNK D   ++ V  E   +
Sbjct: 79  RGTHGVIVVYDVTSAESFVNVKRWLHEINQNCD-DVCRILVGNKNDDPERKVVETEDAYK 137

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
            A +  I+  ETSAK+++NVE  F+
Sbjct: 138 FAGQMGIQLFETSAKENVNVEEMFN 162


>BT020024-1|AAV38827.1|  201|Homo sapiens RAB35, member RAS oncogene
           family protein.
          Length = 201

 Score =  124 bits (298), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 71/77 (92%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           MA+ YD LFKLL+IGDSGVGK+S+L RF+++ F+ S+I+TIG+DFKIRT++++G+KVKLQ
Sbjct: 1   MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQ 60

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFRTIT+ Y
Sbjct: 61  IWDTAGQERFRTITSTY 77



 Score = 70.9 bits (166), Expect = 5e-12
 Identities = 34/85 (40%), Positives = 56/85 (65%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+ G+++VYDVT+ +SF N+K W+  I +N   DV ++++GNK D   ++ V  E   +
Sbjct: 79  RGTHGVIVVYDVTSAESFVNVKRWLHEINQNCD-DVCRILVGNKNDDPERKVVETEDAYK 137

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
            A +  I+  ETSAK+++NVE  F+
Sbjct: 138 FAGQMGIQLFETSAKENVNVEEMFN 162


>BT019529-1|AAV38336.1|  205|Homo sapiens RAB1A, member RAS oncogene
           family protein.
          Length = 205

 Score =  124 bits (298), Expect = 5e-28
 Identities = 56/77 (72%), Positives = 67/77 (87%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           M   YD LFKLLLIGDSGVGK+ +L RF++D +  S+ISTIG+DFKIRTI+LDGK +KLQ
Sbjct: 4   MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQ 63

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFRTIT++Y
Sbjct: 64  IWDTAGQERFRTITSSY 80



 Score = 89.4 bits (212), Expect = 1e-17
 Identities = 39/88 (44%), Positives = 63/88 (71%)
 Frame = +1

Query: 244 NSILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKE 423
           +S  RG+ GI++VYDVT+++SF N+K W++ I+  AS +V K+++GNKCDL +++ V   
Sbjct: 78  SSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYT 137

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAF 507
             ++ A    I F+ETSAK++ NVE +F
Sbjct: 138 TAKEFADSLGIPFLETSAKNATNVEQSF 165


>BT019528-1|AAV38335.1|  205|Homo sapiens RAB1A, member RAS oncogene
           family protein.
          Length = 205

 Score =  124 bits (298), Expect = 5e-28
 Identities = 56/77 (72%), Positives = 67/77 (87%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           M   YD LFKLLLIGDSGVGK+ +L RF++D +  S+ISTIG+DFKIRTI+LDGK +KLQ
Sbjct: 4   MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQ 63

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFRTIT++Y
Sbjct: 64  IWDTAGQERFRTITSSY 80



 Score = 89.4 bits (212), Expect = 1e-17
 Identities = 39/88 (44%), Positives = 63/88 (71%)
 Frame = +1

Query: 244 NSILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKE 423
           +S  RG+ GI++VYDVT+++SF N+K W++ I+  AS +V K+++GNKCDL +++ V   
Sbjct: 78  SSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYT 137

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAF 507
             ++ A    I F+ETSAK++ NVE +F
Sbjct: 138 TAKEFADSLGIPFLETSAKNATNVEQSF 165


>BC071169-1|AAH71169.1|  201|Homo sapiens RAB1B, member RAS oncogene
           family protein.
          Length = 201

 Score =  124 bits (298), Expect = 5e-28
 Identities = 56/77 (72%), Positives = 67/77 (87%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           M   YD LFKLLLIGDSGVGK+ +L RF++D +  S+ISTIG+DFKIRTI+LDGK +KLQ
Sbjct: 1   MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQ 60

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFRTIT++Y
Sbjct: 61  IWDTAGQERFRTITSSY 77



 Score = 85.8 bits (203), Expect = 1e-16
 Identities = 38/88 (43%), Positives = 62/88 (70%)
 Frame = +1

Query: 244 NSILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKE 423
           +S  RG+ GI++VYDVT+++S+ N+K W++ I+  AS +V K+++GNK DL +++ V   
Sbjct: 75  SSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNT 134

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAF 507
             ++ A    I F+ETSAK++ NVE AF
Sbjct: 135 TAKEFADSLGIPFLETSAKNATNVEQAF 162


>BC015931-1|AAH15931.1|  201|Homo sapiens RAB35, member RAS oncogene
           family protein.
          Length = 201

 Score =  124 bits (298), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 71/77 (92%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           MA+ YD LFKLL+IGDSGVGK+S+L RF+++ F+ S+I+TIG+DFKIRT++++G+KVKLQ
Sbjct: 1   MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQ 60

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFRTIT+ Y
Sbjct: 61  IWDTAGQERFRTITSTY 77



 Score = 70.9 bits (166), Expect = 5e-12
 Identities = 34/85 (40%), Positives = 56/85 (65%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+ G+++VYDVT+ +SF N+K W+  I +N   DV ++++GNK D   ++ V  E   +
Sbjct: 79  RGTHGVIVVYDVTSAESFVNVKRWLHEINQNCD-DVCRILVGNKNDDPERKVVETEDAYK 137

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
            A +  I+  ETSAK+++NVE  F+
Sbjct: 138 FAGQMGIQLFETSAKENVNVEEMFN 162


>BC009227-1|AAH09227.2|  195|Homo sapiens RAB13 protein protein.
          Length = 195

 Score =  124 bits (298), Expect = 5e-28
 Identities = 54/69 (78%), Positives = 65/69 (94%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           FKLLLIGDSGVGKT ++ RF+ED FN ++ISTIGIDFKIRT+D++GKK+KLQ+WDTAGQE
Sbjct: 1   FKLLLIGDSGVGKTCLIIRFAEDNFNNTYISTIGIDFKIRTVDIEGKKIKLQVWDTAGQE 60

Query: 227 RFRTITTAY 253
           RF+TITTAY
Sbjct: 61  RFKTITTAY 69



 Score =  123 bits (297), Expect = 6e-28
 Identities = 53/85 (62%), Positives = 77/85 (90%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+MGI+LVYD+T+EKSFENI+NW+++I+ENASA VE+++LGNKCD++++R+V KE+ ++
Sbjct: 71  RGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRKVQKEQADK 130

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
           LA E+ I+F ETSAK S+NV+ AFS
Sbjct: 131 LAREHGIRFFETSAKSSMNVDEAFS 155


>BC000905-1|AAH00905.1|  205|Homo sapiens RAB1A, member RAS oncogene
           family protein.
          Length = 205

 Score =  124 bits (298), Expect = 5e-28
 Identities = 56/77 (72%), Positives = 67/77 (87%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           M   YD LFKLLLIGDSGVGK+ +L RF++D +  S+ISTIG+DFKIRTI+LDGK +KLQ
Sbjct: 4   MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQ 63

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFRTIT++Y
Sbjct: 64  IWDTAGQERFRTITSSY 80



 Score = 89.4 bits (212), Expect = 1e-17
 Identities = 39/88 (44%), Positives = 63/88 (71%)
 Frame = +1

Query: 244 NSILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKE 423
           +S  RG+ GI++VYDVT+++SF N+K W++ I+  AS +V K+++GNKCDL +++ V   
Sbjct: 78  SSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYT 137

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAF 507
             ++ A    I F+ETSAK++ NVE +F
Sbjct: 138 TAKEFADSLGIPFLETSAKNATNVEQSF 165


>AJ245875-1|CAC21570.1|  163|Homo sapiens putative small GTP-binding
           protein (rab1b) protein.
          Length = 163

 Score =  124 bits (298), Expect = 5e-28
 Identities = 56/77 (72%), Positives = 67/77 (87%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           M   YD LFKLLLIGDSGVGK+ +L RF++D +  S+ISTIG+DFKIRTI+LDGK +KLQ
Sbjct: 1   MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQ 60

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFRTIT++Y
Sbjct: 61  IWDTAGQERFRTITSSY 77



 Score = 34.3 bits (75), Expect = 0.48
 Identities = 13/26 (50%), Positives = 22/26 (84%)
 Frame = +1

Query: 244 NSILRGSMGIMLVYDVTNEKSFENIK 321
           +S  RG+ GI++VYDVT+++S+ N+K
Sbjct: 75  SSYYRGAHGIIVVYDVTDQESYANVK 100


>AF498960-1|AAM21108.1|  201|Homo sapiens small GTP binding protein
           RAB35 protein.
          Length = 201

 Score =  124 bits (298), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 71/77 (92%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           MA+ YD LFKLL+IGDSGVGK+S+L RF+++ F+ S+I+TIG+DFKIRT++++G+KVKLQ
Sbjct: 1   MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQ 60

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFRTIT+ Y
Sbjct: 61  IWDTAGQERFRTITSTY 77



 Score = 70.9 bits (166), Expect = 5e-12
 Identities = 34/85 (40%), Positives = 56/85 (65%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+ G+++VYDVT+ +SF N+K W+  I +N   DV ++++GNK D   ++ V  E   +
Sbjct: 79  RGTHGVIVVYDVTSAESFVNVKRWLHEINQNCD-DVCRILVGNKNDDPERKVVETEDAYK 137

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
            A +  I+  ETSAK+++NVE  F+
Sbjct: 138 FAGQMGIQLFETSAKENVNVEEMFN 162


>AF498929-1|AAM21077.1|  205|Homo sapiens small GTP binding protein
           RAB1A protein.
          Length = 205

 Score =  124 bits (298), Expect = 5e-28
 Identities = 56/77 (72%), Positives = 67/77 (87%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           M   YD LFKLLLIGDSGVGK+ +L RF++D +  S+ISTIG+DFKIRTI+LDGK +KLQ
Sbjct: 4   MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQ 63

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFRTIT++Y
Sbjct: 64  IWDTAGQERFRTITSSY 80



 Score = 89.4 bits (212), Expect = 1e-17
 Identities = 39/88 (44%), Positives = 63/88 (71%)
 Frame = +1

Query: 244 NSILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKE 423
           +S  RG+ GI++VYDVT+++SF N+K W++ I+  AS +V K+++GNKCDL +++ V   
Sbjct: 78  SSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYT 137

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAF 507
             ++ A    I F+ETSAK++ NVE +F
Sbjct: 138 TAKEFADSLGIPFLETSAKNATNVEQSF 165


>AF092437-1|AAP97212.1|  201|Homo sapiens rab1B protein.
          Length = 201

 Score =  124 bits (298), Expect = 5e-28
 Identities = 56/77 (72%), Positives = 67/77 (87%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           M   YD LFKLLLIGDSGVGK+ +L RF++D +  S+ISTIG+DFKIRTI+LDGK +KLQ
Sbjct: 1   MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQ 60

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFRTIT++Y
Sbjct: 61  IWDTAGQERFRTITSSY 77



 Score = 85.8 bits (203), Expect = 1e-16
 Identities = 38/88 (43%), Positives = 62/88 (70%)
 Frame = +1

Query: 244 NSILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKE 423
           +S  RG+ GI++VYDVT+++S+ N+K W++ I+  AS +V K+++GNK DL +++ V   
Sbjct: 75  SSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNT 134

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAF 507
             ++ A    I F+ETSAK++ NVE AF
Sbjct: 135 TAKEFADSLGIPFLETSAKNATNVEQAF 162


>AC011742-1|AAX93140.1|  157|Homo sapiens unknown protein.
          Length = 157

 Score =  124 bits (298), Expect = 5e-28
 Identities = 55/87 (63%), Positives = 72/87 (82%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+MGIMLVYD+TN KSFENI  W+RNI+E+A+ DVE+M+LGNKCD+D +R V K +
Sbjct: 34  SYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGK 93

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GEQ+A E+ I+F ETSAK ++N+E AF
Sbjct: 94  GEQIAREHGIRFFETSAKANINIEKAF 120



 Score = 67.7 bits (158), Expect = 4e-11
 Identities = 28/35 (80%), Positives = 33/35 (94%)
 Frame = +2

Query: 149 IDFKIRTIDLDGKKVKLQIWDTAGQERFRTITTAY 253
           IDFKI+T++L GKK+KLQIWDTAGQERF TITT+Y
Sbjct: 1   IDFKIKTVELQGKKIKLQIWDTAGQERFHTITTSY 35


>AC004812-2|AAC83182.1|  201|Homo sapiens GTP-binding protein H-ray
           protein.
          Length = 201

 Score =  124 bits (298), Expect = 5e-28
 Identities = 54/77 (70%), Positives = 71/77 (92%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           MA+ YD LFKLL+IGDSGVGK+S+L RF+++ F+ S+I+TIG+DFKIRT++++G+KVKLQ
Sbjct: 1   MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQ 60

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFRTIT+ Y
Sbjct: 61  IWDTAGQERFRTITSTY 77



 Score = 70.9 bits (166), Expect = 5e-12
 Identities = 34/85 (40%), Positives = 56/85 (65%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+ G+++VYDVT+ +SF N+K W+  I +N   DV ++++GNK D   ++ V  E   +
Sbjct: 79  RGTHGVIVVYDVTSAESFVNVKRWLHEINQNCD-DVCRILVGNKNDDPERKVVETEDAYK 137

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
            A +  I+  ETSAK+++NVE  F+
Sbjct: 138 FAGQMGIQLFETSAKENVNVEEMFN 162


>CR533462-1|CAG38493.1|  201|Homo sapiens RAB1B protein.
          Length = 201

 Score =  122 bits (295), Expect = 1e-27
 Identities = 55/77 (71%), Positives = 67/77 (87%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           M   YD LFKLLLIGDSGVGK+ +L RF++D +  ++ISTIG+DFKIRTI+LDGK +KLQ
Sbjct: 1   MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTENYISTIGVDFKIRTIELDGKTIKLQ 60

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFRTIT++Y
Sbjct: 61  IWDTAGQERFRTITSSY 77



 Score = 85.8 bits (203), Expect = 1e-16
 Identities = 38/88 (43%), Positives = 62/88 (70%)
 Frame = +1

Query: 244 NSILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKE 423
           +S  RG+ GI++VYDVT+++S+ N+K W++ I+  AS +V K+++GNK DL +++ V   
Sbjct: 75  SSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNT 134

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAF 507
             ++ A    I F+ETSAK++ NVE AF
Sbjct: 135 TAKEFADSLGIPFLETSAKNATNVEQAF 162


>BC040679-1|AAH40679.2|  208|Homo sapiens RAB15, member RAS
           onocogene family protein.
          Length = 208

 Score =  116 bits (279), Expect = 9e-26
 Identities = 52/77 (67%), Positives = 67/77 (87%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           MAK YD LF+LLLIGDSGVGKT +L RF+++ F+ S ISTIG+DFK++TI++DG KV++Q
Sbjct: 1   MAKQYDVLFRLLLIGDSGVGKTCLLCRFTDNEFHSSHISTIGVDFKMKTIEVDGIKVRIQ 60

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQER++TIT  Y
Sbjct: 61  IWDTAGQERYQTITKQY 77



 Score = 38.3 bits (85), Expect = 0.030
 Identities = 13/34 (38%), Positives = 25/34 (73%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASA 357
           R + GI LVYD+++E+S+++I  W+ +++E   A
Sbjct: 79  RRAQGIFLVYDISSERSYQHIMKWVSDVDEVGDA 112


>AF254795-1|AAF67748.1|  220|Homo sapiens GTP-binding protein RAB3A
           protein.
          Length = 220

 Score =  113 bits (273), Expect = 5e-25
 Identities = 48/75 (64%), Positives = 66/75 (88%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           + +D +FK+L+IG+S VGKTS LFR+++D+F  +F+ST+GIDFK++TI  + KK+KLQIW
Sbjct: 17  QNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKKIKLQIW 76

Query: 209 DTAGQERFRTITTAY 253
           DTAGQER+RTITTAY
Sbjct: 77  DTAGQERYRTITTAY 91



 Score = 87.8 bits (208), Expect = 4e-17
 Identities = 37/84 (44%), Positives = 59/84 (70%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+MG +L+YD+TNE+SF  +++W   I+  +  + + +++GNKCD++ +R VS ERG Q
Sbjct: 93  RGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQ 152

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
           LA     +F E SAKD++NV+  F
Sbjct: 153 LADHLGFEFFEASAKDNINVKQTF 176


>BC016471-1|AAH16471.1|  219|Homo sapiens RAB3D, member RAS oncogene
           family protein.
          Length = 219

 Score =  113 bits (271), Expect = 9e-25
 Identities = 48/75 (64%), Positives = 65/75 (86%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           + +D +FKLLLIG+S VGKTS LFR+++D+F  +F+ST+GIDFK++T+    K++KLQIW
Sbjct: 17  QNFDYMFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTVYRHDKRIKLQIW 76

Query: 209 DTAGQERFRTITTAY 253
           DTAGQER+RTITTAY
Sbjct: 77  DTAGQERYRTITTAY 91



 Score = 77.8 bits (183), Expect = 4e-14
 Identities = 32/84 (38%), Positives = 57/84 (67%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+MG +L+YD+ N++SF  +++W   I+  +  + + +++GNKCDL+ +R V  E G +
Sbjct: 93  RGAMGFLLMYDIANQESFAAVQDWATQIKTYSWDNAQVILVGNKCDLEDERVVPAEDGRR 152

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
           LA +   +F E SAK+++NV+  F
Sbjct: 153 LADDLGFEFFEASAKENINVKQVF 176


>BC013033-1|AAH13033.1|  227|Homo sapiens RAB3C, member RAS oncogene
           family protein.
          Length = 227

 Score =  113 bits (271), Expect = 9e-25
 Identities = 47/75 (62%), Positives = 66/75 (88%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           + +D +FKLL+IG+S VGKTS LFR+++D+F  +F+ST+GIDFK++T+  + K++KLQIW
Sbjct: 25  QNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFKNEKRIKLQIW 84

Query: 209 DTAGQERFRTITTAY 253
           DTAGQER+RTITTAY
Sbjct: 85  DTAGQERYRTITTAY 99



 Score = 86.6 bits (205), Expect = 9e-17
 Identities = 35/84 (41%), Positives = 60/84 (71%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+MG +L+YD+TNE+SF  +++W   I+  +  + + +++GNKCD++ +R +S ERG+ 
Sbjct: 101 RGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVILVGNKCDMEDERVISTERGQH 160

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
           L  +   +F ETSAKD++NV+  F
Sbjct: 161 LGEQLGFEFFETSAKDNINVKQTF 184


>AY026936-1|AAK08968.1|  227|Homo sapiens Rab3c protein.
          Length = 227

 Score =  113 bits (271), Expect = 9e-25
 Identities = 47/75 (62%), Positives = 66/75 (88%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           + +D +FKLL+IG+S VGKTS LFR+++D+F  +F+ST+GIDFK++T+  + K++KLQIW
Sbjct: 25  QNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFKNEKRIKLQIW 84

Query: 209 DTAGQERFRTITTAY 253
           DTAGQER+RTITTAY
Sbjct: 85  DTAGQERYRTITTAY 99



 Score = 86.6 bits (205), Expect = 9e-17
 Identities = 35/84 (41%), Positives = 60/84 (71%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+MG +L+YD+TNE+SF  +++W   I+  +  + + +++GNKCD++ +R +S ERG+ 
Sbjct: 101 RGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVILVGNKCDMEDERVISTERGQH 160

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
           L  +   +F ETSAKD++NV+  F
Sbjct: 161 LGEQLGFEFFETSAKDNINVKQTF 184


>AF498933-1|AAM21081.1|  219|Homo sapiens small GTP binding protein
           RAB3D protein.
          Length = 219

 Score =  113 bits (271), Expect = 9e-25
 Identities = 48/75 (64%), Positives = 65/75 (86%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           + +D +FKLLLIG+S VGKTS LFR+++D+F  +F+ST+GIDFK++T+    K++KLQIW
Sbjct: 17  QNFDYMFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTVYRHDKRIKLQIW 76

Query: 209 DTAGQERFRTITTAY 253
           DTAGQER+RTITTAY
Sbjct: 77  DTAGQERYRTITTAY 91



 Score = 77.8 bits (183), Expect = 4e-14
 Identities = 32/84 (38%), Positives = 57/84 (67%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+MG +L+YD+ N++SF  +++W   I+  +  + + +++GNKCDL+ +R V  E G +
Sbjct: 93  RGAMGFLLMYDIANQESFAAVQDWATQIKTYSWDNAQVILVGNKCDLEDERVVPAEDGRR 152

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
           LA +   +F E SAK+++NV+  F
Sbjct: 153 LADDLGFEFFEASAKENINVKQVF 176


>AF081353-1|AAC72918.1|  219|Homo sapiens GTP-binding protein
           protein.
          Length = 219

 Score =  113 bits (271), Expect = 9e-25
 Identities = 48/75 (64%), Positives = 65/75 (86%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           + +D +FKLLLIG+S VGKTS LFR+++D+F  +F+ST+GIDFK++T+    K++KLQIW
Sbjct: 17  QNFDYMFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTVYRHDKRIKLQIW 76

Query: 209 DTAGQERFRTITTAY 253
           DTAGQER+RTITTAY
Sbjct: 77  DTAGQERYRTITTAY 91



 Score = 77.8 bits (183), Expect = 4e-14
 Identities = 32/84 (38%), Positives = 57/84 (67%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+MG +L+YD+ N++SF  +++W   I+  +  + + +++GNKCDL+ +R V  E G +
Sbjct: 93  RGAMGFLLMYDIANQESFAAVQDWATQIKTYSWDNAQVILVGNKCDLEDERVVPAEDGRR 152

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
           LA +   +F E SAK+++NV+  F
Sbjct: 153 LADDLGFEFFEASAKENINVKQVF 176


>M28210-1|AAA60242.1|  220|Homo sapiens GTP-binding protein protein.
          Length = 220

 Score =  112 bits (270), Expect = 1e-24
 Identities = 47/75 (62%), Positives = 66/75 (88%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           + +D +FK+L+IG+S VGKTS LFR+++D+F  +F+ST+GIDFK++TI  + K++KLQIW
Sbjct: 17  QNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIW 76

Query: 209 DTAGQERFRTITTAY 253
           DTAGQER+RTITTAY
Sbjct: 77  DTAGQERYRTITTAY 91



 Score = 87.8 bits (208), Expect = 4e-17
 Identities = 37/84 (44%), Positives = 59/84 (70%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+MG +L+YD+TNE+SF  +++W   I+  +  + + +++GNKCD++ +R VS ERG Q
Sbjct: 93  RGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQ 152

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
           LA     +F E SAKD++NV+  F
Sbjct: 153 LADHLGFEFFEASAKDNINVKQTF 176


>BC011782-1|AAH11782.1|  220|Homo sapiens RAB3A, member RAS oncogene
           family protein.
          Length = 220

 Score =  112 bits (270), Expect = 1e-24
 Identities = 47/75 (62%), Positives = 66/75 (88%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           + +D +FK+L+IG+S VGKTS LFR+++D+F  +F+ST+GIDFK++TI  + K++KLQIW
Sbjct: 17  QNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIW 76

Query: 209 DTAGQERFRTITTAY 253
           DTAGQER+RTITTAY
Sbjct: 77  DTAGQERYRTITTAY 91



 Score = 87.8 bits (208), Expect = 4e-17
 Identities = 37/84 (44%), Positives = 59/84 (70%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+MG +L+YD+TNE+SF  +++W   I+  +  + + +++GNKCD++ +R VS ERG Q
Sbjct: 93  RGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQ 152

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
           LA     +F E SAKD++NV+  F
Sbjct: 153 LADHLGFEFFEASAKDNINVKQTF 176


>AF498931-1|AAM21079.1|  220|Homo sapiens small GTP binding protein
           RAB3A protein.
          Length = 220

 Score =  112 bits (270), Expect = 1e-24
 Identities = 47/75 (62%), Positives = 66/75 (88%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           + +D +FK+L+IG+S VGKTS LFR+++D+F  +F+ST+GIDFK++TI  + K++KLQIW
Sbjct: 17  QNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIW 76

Query: 209 DTAGQERFRTITTAY 253
           DTAGQER+RTITTAY
Sbjct: 77  DTAGQERYRTITTAY 91



 Score = 87.8 bits (208), Expect = 4e-17
 Identities = 37/84 (44%), Positives = 59/84 (70%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+MG +L+YD+TNE+SF  +++W   I+  +  + + +++GNKCD++ +R VS ERG Q
Sbjct: 93  RGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQ 152

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
           LA     +F E SAKD++NV+  F
Sbjct: 153 LADHLGFEFFEASAKDNINVKQTF 176


>AF157809-1|AAD46811.1|  220|Homo sapiens GTP-binding protein
           protein.
          Length = 220

 Score =  112 bits (270), Expect = 1e-24
 Identities = 47/75 (62%), Positives = 66/75 (88%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           + +D +FK+L+IG+S VGKTS LFR+++D+F  +F+ST+GIDFK++TI  + K++KLQIW
Sbjct: 17  QNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIW 76

Query: 209 DTAGQERFRTITTAY 253
           DTAGQER+RTITTAY
Sbjct: 77  DTAGQERYRTITTAY 91



 Score = 87.8 bits (208), Expect = 4e-17
 Identities = 37/84 (44%), Positives = 59/84 (70%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+MG +L+YD+TNE+SF  +++W   I+  +  + + +++GNKCD++ +R VS ERG Q
Sbjct: 93  RGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQ 152

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
           LA     +F E SAKD++NV+  F
Sbjct: 153 LADHLGFEFFEASAKDNINVKQTF 176


>AC068499-1|AAF67385.1|  220|Homo sapiens RAB3A, member RAS oncogene
           family protein.
          Length = 220

 Score =  112 bits (270), Expect = 1e-24
 Identities = 47/75 (62%), Positives = 66/75 (88%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           + +D +FK+L+IG+S VGKTS LFR+++D+F  +F+ST+GIDFK++TI  + K++KLQIW
Sbjct: 17  QNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIW 76

Query: 209 DTAGQERFRTITTAY 253
           DTAGQER+RTITTAY
Sbjct: 77  DTAGQERYRTITTAY 91



 Score = 87.8 bits (208), Expect = 4e-17
 Identities = 37/84 (44%), Positives = 59/84 (70%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+MG +L+YD+TNE+SF  +++W   I+  +  + + +++GNKCD++ +R VS ERG Q
Sbjct: 93  RGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQ 152

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
           LA     +F E SAKD++NV+  F
Sbjct: 153 LADHLGFEFFEASAKDNINVKQTF 176


>BC005035-1|AAH05035.1|  219|Homo sapiens RAB3B, member RAS oncogene
           family protein.
          Length = 219

 Score =  111 bits (268), Expect = 2e-24
 Identities = 48/75 (64%), Positives = 64/75 (85%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           + +D +FKLL+IG+S VGKTS LFR+++D F  +F+ST+GIDFK++T+    K+VKLQIW
Sbjct: 17  QNFDYMFKLLIIGNSSVGKTSFLFRYADDTFTPAFVSTVGIDFKVKTVYRHEKRVKLQIW 76

Query: 209 DTAGQERFRTITTAY 253
           DTAGQER+RTITTAY
Sbjct: 77  DTAGQERYRTITTAY 91



 Score = 79.8 bits (188), Expect = 1e-14
 Identities = 33/84 (39%), Positives = 58/84 (69%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+MG +L+YD+TNE+SF  +++W   I+  +  + + +++GNKCD++ +R V  E+G+ 
Sbjct: 93  RGAMGFILMYDITNEESFNAVQDWATQIKTYSWDNAQVILVGNKCDMEEERVVPTEKGQL 152

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
           LA +    F E SAK++++V  AF
Sbjct: 153 LAEQLGFDFFEASAKENISVRQAF 176


>AL589663-2|CAH74098.1|  219|Homo sapiens RAB3B, member RAS oncogene
           family protein.
          Length = 219

 Score =  111 bits (268), Expect = 2e-24
 Identities = 48/75 (64%), Positives = 64/75 (85%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           + +D +FKLL+IG+S VGKTS LFR+++D F  +F+ST+GIDFK++T+    K+VKLQIW
Sbjct: 17  QNFDYMFKLLIIGNSSVGKTSFLFRYADDTFTPAFVSTVGIDFKVKTVYRHEKRVKLQIW 76

Query: 209 DTAGQERFRTITTAY 253
           DTAGQER+RTITTAY
Sbjct: 77  DTAGQERYRTITTAY 91



 Score = 79.8 bits (188), Expect = 1e-14
 Identities = 33/84 (39%), Positives = 58/84 (69%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+MG +L+YD+TNE+SF  +++W   I+  +  + + +++GNKCD++ +R V  E+G+ 
Sbjct: 93  RGAMGFILMYDITNEESFNAVQDWATQIKTYSWDNAQVILVGNKCDMEEERVVPTEKGQL 152

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
           LA +    F E SAK++++V  AF
Sbjct: 153 LAEQLGFDFFEASAKENISVRQAF 176


>AL445685-1|CAI17027.1|  219|Homo sapiens RAB3B, member RAS oncogene
           family protein.
          Length = 219

 Score =  111 bits (268), Expect = 2e-24
 Identities = 48/75 (64%), Positives = 64/75 (85%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           + +D +FKLL+IG+S VGKTS LFR+++D F  +F+ST+GIDFK++T+    K+VKLQIW
Sbjct: 17  QNFDYMFKLLIIGNSSVGKTSFLFRYADDTFTPAFVSTVGIDFKVKTVYRHEKRVKLQIW 76

Query: 209 DTAGQERFRTITTAY 253
           DTAGQER+RTITTAY
Sbjct: 77  DTAGQERYRTITTAY 91



 Score = 79.8 bits (188), Expect = 1e-14
 Identities = 33/84 (39%), Positives = 58/84 (69%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+MG +L+YD+TNE+SF  +++W   I+  +  + + +++GNKCD++ +R V  E+G+ 
Sbjct: 93  RGAMGFILMYDITNEESFNAVQDWATQIKTYSWDNAQVILVGNKCDMEEERVVPTEKGQL 152

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
           LA +    F E SAK++++V  AF
Sbjct: 153 LAEQLGFDFFEASAKENISVRQAF 176


>AF498932-1|AAM21080.1|  219|Homo sapiens small GTP binding protein
           RAB3B protein.
          Length = 219

 Score =  111 bits (268), Expect = 2e-24
 Identities = 48/75 (64%), Positives = 64/75 (85%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           + +D +FKLL+IG+S VGKTS LFR+++D F  +F+ST+GIDFK++T+    K+VKLQIW
Sbjct: 17  QNFDYMFKLLIIGNSSVGKTSFLFRYADDTFTPAFVSTVGIDFKVKTVYRHEKRVKLQIW 76

Query: 209 DTAGQERFRTITTAY 253
           DTAGQER+RTITTAY
Sbjct: 77  DTAGQERYRTITTAY 91



 Score = 79.8 bits (188), Expect = 1e-14
 Identities = 33/84 (39%), Positives = 58/84 (69%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+MG +L+YD+TNE+SF  +++W   I+  +  + + +++GNKCD++ +R V  E+G+ 
Sbjct: 93  RGAMGFILMYDITNEESFNAVQDWATQIKTYSWDNAQVILVGNKCDMEEERVVPTEKGQL 152

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
           LA +    F E SAK++++V  AF
Sbjct: 153 LAEQLGFDFFEASAKENISVRQAF 176


>M28214-1|AAA60243.1|  219|Homo sapiens GTP-binding protein protein.
          Length = 219

 Score =  109 bits (262), Expect = 1e-23
 Identities = 47/75 (62%), Positives = 63/75 (84%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           + +D +FKLL+IG+S VGKTS L R+++D F  +F+ST+GIDFK++T+    K+VKLQIW
Sbjct: 17  QNFDYMFKLLIIGNSSVGKTSFLLRYADDTFTPAFVSTVGIDFKVKTVYRHEKRVKLQIW 76

Query: 209 DTAGQERFRTITTAY 253
           DTAGQER+RTITTAY
Sbjct: 77  DTAGQERYRTITTAY 91



 Score = 79.8 bits (188), Expect = 1e-14
 Identities = 33/84 (39%), Positives = 58/84 (69%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+MG +L+YD+TNE+SF  +++W   I+  +  + + +++GNKCD++ +R V  E+G+ 
Sbjct: 93  RGAMGFILMYDITNEESFNAVQDWATQIKTYSWDNAQVILVGNKCDMEEERVVPTEKGQL 152

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
           LA +    F E SAK++++V  AF
Sbjct: 153 LAEQLGFDFFEASAKENISVRQAF 176


>BC066913-1|AAH66913.1|  256|Homo sapiens RAB26, member RAS oncogene
           family protein.
          Length = 256

 Score =  104 bits (250), Expect = 3e-22
 Identities = 47/74 (63%), Positives = 61/74 (82%), Gaps = 1/74 (1%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNI-SFISTIGIDFKIRTIDLDGKKVKLQIWD 211
           YD  FK++L+GDSGVGKT +L RF + AF   +FIST+GIDF+ + +D+DG KVKLQ+WD
Sbjct: 60  YDVAFKVMLVGDSGVGKTCLLVRFKDGAFLAGTFISTVGIDFRNKVLDVDGVKVKLQMWD 119

Query: 212 TAGQERFRTITTAY 253
           TAGQERFR++T AY
Sbjct: 120 TAGQERFRSVTHAY 133



 Score = 90.2 bits (214), Expect = 7e-18
 Identities = 43/85 (50%), Positives = 59/85 (69%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           R +  ++L+YDVTN+ SF+NI+ W+  I E A  DV  M+LGNK D   +R V +E GE+
Sbjct: 135 RDAHALLLLYDVTNKASFDNIQAWLTEIHEYAQHDVALMLLGNKVDSAHERVVKREDGEK 194

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
           LA EY + F+ETSAK  LNV+ AF+
Sbjct: 195 LAKEYGLPFMETSAKTGLNVDLAFT 219


>AY646153-1|AAU88191.1|  256|Homo sapiens Ras-related oncogene
           protein protein.
          Length = 256

 Score =  104 bits (250), Expect = 3e-22
 Identities = 47/74 (63%), Positives = 61/74 (82%), Gaps = 1/74 (1%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNI-SFISTIGIDFKIRTIDLDGKKVKLQIWD 211
           YD  FK++L+GDSGVGKT +L RF + AF   +FIST+GIDF+ + +D+DG KVKLQ+WD
Sbjct: 60  YDVAFKVMLVGDSGVGKTCLLVRFKDGAFLAGTFISTVGIDFRNKVLDVDGVKVKLQMWD 119

Query: 212 TAGQERFRTITTAY 253
           TAGQERFR++T AY
Sbjct: 120 TAGQERFRSVTHAY 133



 Score = 90.2 bits (214), Expect = 7e-18
 Identities = 43/85 (50%), Positives = 59/85 (69%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           R +  ++L+YDVTN+ SF+NI+ W+  I E A  DV  M+LGNK D   +R V +E GE+
Sbjct: 135 RDAHALLLLYDVTNKASFDNIQAWLTEIHEYAQHDVALMLLGNKVDSAHERVVKREDGEK 194

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
           LA EY + F+ETSAK  LNV+ AF+
Sbjct: 195 LAKEYGLPFMETSAKTGLNVDLAFT 219


>X56740-1|CAA40064.1|  216|Homo sapiens H rab11 small GTP  binding
           protein protein.
          Length = 216

 Score =  103 bits (247), Expect = 7e-22
 Identities = 45/73 (61%), Positives = 60/73 (82%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK++LIGDSGVGK+++L RF+ + FN+   STIG++F  R+I +DGK +K QIWDT
Sbjct: 8   YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDT 67

Query: 215 AGQERFRTITTAY 253
           AGQER+R IT+AY
Sbjct: 68  AGQERYRAITSAY 80



 Score = 75.8 bits (178), Expect = 2e-13
 Identities = 32/84 (38%), Positives = 54/84 (64%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG++G +LVYD+    ++EN++ W++ + ++A +++  M++GNK DL   R V  +    
Sbjct: 82  RGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARA 141

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A +  + F+ETSA DS NVE AF
Sbjct: 142 FAEKNGLSFIETSALDSTNVEAAF 165


>X53143-1|CAA37300.1|  216|Homo sapiens protein ( Human YL8 mRNA for
           ras-like protein. ).
          Length = 216

 Score =  103 bits (247), Expect = 7e-22
 Identities = 45/73 (61%), Positives = 60/73 (82%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK++LIGDSGVGK+++L RF+ + FN+   STIG++F  R+I +DGK +K QIWDT
Sbjct: 8   YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDT 67

Query: 215 AGQERFRTITTAY 253
           AGQER+R IT+AY
Sbjct: 68  AGQERYRAITSAY 80



 Score = 75.8 bits (178), Expect = 2e-13
 Identities = 32/84 (38%), Positives = 54/84 (64%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG++G +LVYD+    ++EN++ W++ + ++A +++  M++GNK DL   R V  +    
Sbjct: 82  RGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARA 141

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A +  + F+ETSA DS NVE AF
Sbjct: 142 FAEKNGLSFIETSALDSTNVEAAF 165


>EF560724-1|ABQ59034.1|  218|Homo sapiens RAB11B protein protein.
          Length = 218

 Score =  103 bits (247), Expect = 7e-22
 Identities = 45/73 (61%), Positives = 60/73 (82%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK++LIGDSGVGK+++L RF+ + FN+   STIG++F  R+I +DGK +K QIWDT
Sbjct: 8   YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDT 67

Query: 215 AGQERFRTITTAY 253
           AGQER+R IT+AY
Sbjct: 68  AGQERYRAITSAY 80



 Score = 76.6 bits (180), Expect = 9e-14
 Identities = 32/84 (38%), Positives = 54/84 (64%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG++G +LVYD+    ++EN++ W++ + ++A +++  M++GNK DL   R V  +    
Sbjct: 82  RGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARA 141

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A +  + F+ETSA DS NVE AF
Sbjct: 142 FAEKNNLSFIETSALDSTNVEEAF 165


>CR541691-1|CAG46492.1|  218|Homo sapiens RAB11B protein.
          Length = 218

 Score =  103 bits (247), Expect = 7e-22
 Identities = 45/73 (61%), Positives = 60/73 (82%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK++LIGDSGVGK+++L RF+ + FN+   STIG++F  R+I +DGK +K QIWDT
Sbjct: 8   YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDT 67

Query: 215 AGQERFRTITTAY 253
           AGQER+R IT+AY
Sbjct: 68  AGQERYRAITSAY 80



 Score = 76.6 bits (180), Expect = 9e-14
 Identities = 32/84 (38%), Positives = 54/84 (64%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG++G +LVYD+    ++EN++ W++ + ++A +++  M++GNK DL   R V  +    
Sbjct: 82  RGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARA 141

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A +  + F+ETSA DS NVE AF
Sbjct: 142 FAEKNNLSFIETSALDSTNVEEAF 165


>CR536494-1|CAG38733.1|  218|Homo sapiens RAB11B protein.
          Length = 218

 Score =  103 bits (247), Expect = 7e-22
 Identities = 45/73 (61%), Positives = 60/73 (82%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK++LIGDSGVGK+++L RF+ + FN+   STIG++F  R+I +DGK +K QIWDT
Sbjct: 8   YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDT 67

Query: 215 AGQERFRTITTAY 253
           AGQER+R IT+AY
Sbjct: 68  AGQERYRAITSAY 80



 Score = 75.4 bits (177), Expect = 2e-13
 Identities = 31/84 (36%), Positives = 54/84 (64%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG++G +LVYD+    ++EN++ W++ + ++A +++  M++GNK DL   R V  +    
Sbjct: 82  RGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARA 141

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A +  + F+ET+A DS NVE AF
Sbjct: 142 FAEKNNLSFIETAALDSTNVEEAF 165


>CR536493-1|CAG38732.1|  216|Homo sapiens RAB11A protein.
          Length = 216

 Score =  103 bits (247), Expect = 7e-22
 Identities = 45/73 (61%), Positives = 60/73 (82%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK++LIGDSGVGK+++L RF+ + FN+   STIG++F  R+I +DGK +K QIWDT
Sbjct: 8   YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDT 67

Query: 215 AGQERFRTITTAY 253
           AGQER+R IT+AY
Sbjct: 68  AGQERYRAITSAY 80



 Score = 75.8 bits (178), Expect = 2e-13
 Identities = 32/84 (38%), Positives = 54/84 (64%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG++G +LVYD+    ++EN++ W++ + ++A +++  M++GNK DL   R V  +    
Sbjct: 82  RGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARA 141

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A +  + F+ETSA DS NVE AF
Sbjct: 142 FAEKNGLSFIETSALDSTNVEAAF 165


>CR407669-1|CAG28597.1|  216|Homo sapiens RAB11A protein.
          Length = 216

 Score =  103 bits (247), Expect = 7e-22
 Identities = 45/73 (61%), Positives = 60/73 (82%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK++LIGDSGVGK+++L RF+ + FN+   STIG++F  R+I +DGK +K QIWDT
Sbjct: 8   YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDT 67

Query: 215 AGQERFRTITTAY 253
           AGQER+R IT+AY
Sbjct: 68  AGQERYRAITSAY 80



 Score = 75.8 bits (178), Expect = 2e-13
 Identities = 32/84 (38%), Positives = 54/84 (64%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG++G +LVYD+    ++EN++ W++ + ++A +++  M++GNK DL   R V  +    
Sbjct: 82  RGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARA 141

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A +  + F+ETSA DS NVE AF
Sbjct: 142 FAEKNGLSFIETSALDSTNVEAAF 165


>BT020154-1|AAV38956.1|  216|Homo sapiens RAB11A, member RAS
           oncogene family protein.
          Length = 216

 Score =  103 bits (247), Expect = 7e-22
 Identities = 45/73 (61%), Positives = 60/73 (82%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK++LIGDSGVGK+++L RF+ + FN+   STIG++F  R+I +DGK +K QIWDT
Sbjct: 8   YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDT 67

Query: 215 AGQERFRTITTAY 253
           AGQER+R IT+AY
Sbjct: 68  AGQERYRAITSAY 80



 Score = 75.8 bits (178), Expect = 2e-13
 Identities = 32/84 (38%), Positives = 54/84 (64%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG++G +LVYD+    ++EN++ W++ + ++A +++  M++GNK DL   R V  +    
Sbjct: 82  RGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARA 141

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A +  + F+ETSA DS NVE AF
Sbjct: 142 FAEKNGLSFIETSALDSTNVEAAF 165


>BT020151-1|AAV38953.1|  216|Homo sapiens RAB11A, member RAS
           oncogene family protein.
          Length = 216

 Score =  103 bits (247), Expect = 7e-22
 Identities = 45/73 (61%), Positives = 60/73 (82%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK++LIGDSGVGK+++L RF+ + FN+   STIG++F  R+I +DGK +K QIWDT
Sbjct: 8   YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDT 67

Query: 215 AGQERFRTITTAY 253
           AGQER+R IT+AY
Sbjct: 68  AGQERYRAITSAY 80



 Score = 75.8 bits (178), Expect = 2e-13
 Identities = 32/84 (38%), Positives = 54/84 (64%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG++G +LVYD+    ++EN++ W++ + ++A +++  M++GNK DL   R V  +    
Sbjct: 82  RGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARA 141

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A +  + F+ETSA DS NVE AF
Sbjct: 142 FAEKNGLSFIETSALDSTNVEAAF 165


>BT019536-1|AAV38343.1|  218|Homo sapiens RAB11B, member RAS
           oncogene family protein.
          Length = 218

 Score =  103 bits (247), Expect = 7e-22
 Identities = 45/73 (61%), Positives = 60/73 (82%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK++LIGDSGVGK+++L RF+ + FN+   STIG++F  R+I +DGK +K QIWDT
Sbjct: 8   YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDT 67

Query: 215 AGQERFRTITTAY 253
           AGQER+R IT+AY
Sbjct: 68  AGQERYRAITSAY 80



 Score = 76.6 bits (180), Expect = 9e-14
 Identities = 32/84 (38%), Positives = 54/84 (64%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG++G +LVYD+    ++EN++ W++ + ++A +++  M++GNK DL   R V  +    
Sbjct: 82  RGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARA 141

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A +  + F+ETSA DS NVE AF
Sbjct: 142 FAEKNNLSFIETSALDSTNVEEAF 165


>BT019535-1|AAV38342.1|  218|Homo sapiens RAB11B, member RAS
           oncogene family protein.
          Length = 218

 Score =  103 bits (247), Expect = 7e-22
 Identities = 45/73 (61%), Positives = 60/73 (82%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK++LIGDSGVGK+++L RF+ + FN+   STIG++F  R+I +DGK +K QIWDT
Sbjct: 8   YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDT 67

Query: 215 AGQERFRTITTAY 253
           AGQER+R IT+AY
Sbjct: 68  AGQERYRAITSAY 80



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 33/84 (39%), Positives = 54/84 (64%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG++G +LVYD+    ++EN++ W++ + ++A +D+  M++GNK DL   R V  +    
Sbjct: 82  RGAVGALLVYDIAKHLTYENVERWLKELRDHADSDIVIMLVGNKSDLRHLRAVPTDEARA 141

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A +  + F+ETSA DS NVE AF
Sbjct: 142 FAEKNNLSFIETSALDSTNVEEAF 165


>BC110081-1|AAI10082.1|  218|Homo sapiens RAB11B, member RAS
           oncogene family protein.
          Length = 218

 Score =  103 bits (247), Expect = 7e-22
 Identities = 45/73 (61%), Positives = 60/73 (82%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK++LIGDSGVGK+++L RF+ + FN+   STIG++F  R+I +DGK +K QIWDT
Sbjct: 8   YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDT 67

Query: 215 AGQERFRTITTAY 253
           AGQER+R IT+AY
Sbjct: 68  AGQERYRAITSAY 80



 Score = 76.6 bits (180), Expect = 9e-14
 Identities = 32/84 (38%), Positives = 54/84 (64%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG++G +LVYD+    ++EN++ W++ + ++A +++  M++GNK DL   R V  +    
Sbjct: 82  RGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARA 141

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A +  + F+ETSA DS NVE AF
Sbjct: 142 FAEKNNLSFIETSALDSTNVEEAF 165


>BC013348-1|AAH13348.1|  216|Homo sapiens RAB11A protein protein.
          Length = 216

 Score =  103 bits (247), Expect = 7e-22
 Identities = 45/73 (61%), Positives = 60/73 (82%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK++LIGDSGVGK+++L RF+ + FN+   STIG++F  R+I +DGK +K QIWDT
Sbjct: 8   YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDT 67

Query: 215 AGQERFRTITTAY 253
           AGQER+R IT+AY
Sbjct: 68  AGQERYRAITSAY 80



 Score = 75.8 bits (178), Expect = 2e-13
 Identities = 32/84 (38%), Positives = 54/84 (64%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG++G +LVYD+    ++EN++ W++ + ++A +++  M++GNK DL   R V  +    
Sbjct: 82  RGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARA 141

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A +  + F+ETSA DS NVE AF
Sbjct: 142 FAEKNGLSFIETSALDSTNVEAAF 165


>AF498947-1|AAM21095.1|  218|Homo sapiens small GTP binding protein
           RAB11B protein.
          Length = 218

 Score =  103 bits (247), Expect = 7e-22
 Identities = 45/73 (61%), Positives = 60/73 (82%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK++LIGDSGVGK+++L RF+ + FN+   STIG++F  R+I +DGK +K QIWDT
Sbjct: 8   YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDT 67

Query: 215 AGQERFRTITTAY 253
           AGQER+R IT+AY
Sbjct: 68  AGQERYRAITSAY 80



 Score = 76.6 bits (180), Expect = 9e-14
 Identities = 32/84 (38%), Positives = 54/84 (64%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG++G +LVYD+    ++EN++ W++ + ++A +++  M++GNK DL   R V  +    
Sbjct: 82  RGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARA 141

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A +  + F+ETSA DS NVE AF
Sbjct: 142 FAEKNNLSFIETSALDSTNVEEAF 165


>AF498946-1|AAM21094.1|  216|Homo sapiens small GTP binding protein
           RAB11A protein.
          Length = 216

 Score =  103 bits (247), Expect = 7e-22
 Identities = 45/73 (61%), Positives = 60/73 (82%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK++LIGDSGVGK+++L RF+ + FN+   STIG++F  R+I +DGK +K QIWDT
Sbjct: 8   YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDT 67

Query: 215 AGQERFRTITTAY 253
           AGQER+R IT+AY
Sbjct: 68  AGQERYRAITSAY 80



 Score = 75.8 bits (178), Expect = 2e-13
 Identities = 32/84 (38%), Positives = 54/84 (64%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG++G +LVYD+    ++EN++ W++ + ++A +++  M++GNK DL   R V  +    
Sbjct: 82  RGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARA 141

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A +  + F+ETSA DS NVE AF
Sbjct: 142 FAEKNGLSFIETSALDSTNVEAAF 165


>AF000231-1|AAC32887.1|  216|Homo sapiens rab11a protein.
          Length = 216

 Score =  103 bits (247), Expect = 7e-22
 Identities = 45/73 (61%), Positives = 60/73 (82%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK++LIGDSGVGK+++L RF+ + FN+   STIG++F  R+I +DGK +K QIWDT
Sbjct: 8   YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDT 67

Query: 215 AGQERFRTITTAY 253
           AGQER+R IT+AY
Sbjct: 68  AGQERYRAITSAY 80



 Score = 75.8 bits (178), Expect = 2e-13
 Identities = 32/84 (38%), Positives = 54/84 (64%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG++G +LVYD+    ++EN++ W++ + ++A +++  M++GNK DL   R V  +    
Sbjct: 82  RGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARA 141

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A +  + F+ETSA DS NVE AF
Sbjct: 142 FAEKNGLSFIETSALDSTNVEAAF 165


>X79780-1|CAA56176.1|  218|Homo sapiens YPT3 protein.
          Length = 218

 Score =  103 bits (246), Expect = 9e-22
 Identities = 45/73 (61%), Positives = 60/73 (82%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK++LIGDSGVGK+++L RF+ + FN+   STIG++F  R+I +DGK +K QIWDT
Sbjct: 8   YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDT 67

Query: 215 AGQERFRTITTAY 253
           AGQER+R IT+AY
Sbjct: 68  AGQERYRRITSAY 80



 Score = 76.6 bits (180), Expect = 9e-14
 Identities = 32/84 (38%), Positives = 54/84 (64%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG++G +LVYD+    ++EN++ W++ + ++A +++  M++GNK DL   R V  +    
Sbjct: 82  RGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARA 141

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A +  + F+ETSA DS NVE AF
Sbjct: 142 FAEKNNLSFIETSALDSTNVEEAF 165


>CR533455-1|CAG38486.1|  206|Homo sapiens RAB18 protein.
          Length = 206

 Score =  101 bits (241), Expect = 4e-21
 Identities = 42/68 (61%), Positives = 57/68 (83%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K+L+IG+SGVGK+S+L RF++D F+    +TIG+DFK++TI +DG K KL IWDTAGQER
Sbjct: 10  KILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQER 69

Query: 230 FRTITTAY 253
           FRT+T +Y
Sbjct: 70  FRTLTPSY 77



 Score = 65.7 bits (153), Expect = 2e-10
 Identities = 32/88 (36%), Positives = 53/88 (60%), Gaps = 1/88 (1%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASA-DVEKMILGNKCDLDSQRQVSKE 423
           S  RG+ G++LVYDVT   +F  + NW+  +E   +  D+  M++GNK D ++ R+V + 
Sbjct: 76  SYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKEN-REVDRN 134

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAF 507
            G + A ++ + F+E SAK    V+ AF
Sbjct: 135 EGLKFARKHSMLFIEASAKTCDGVQCAF 162


>BT009840-1|AAP88842.1|  206|Homo sapiens RAB18, member RAS oncogene
           family protein.
          Length = 206

 Score =  101 bits (241), Expect = 4e-21
 Identities = 42/68 (61%), Positives = 57/68 (83%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K+L+IG+SGVGK+S+L RF++D F+    +TIG+DFK++TI +DG K KL IWDTAGQER
Sbjct: 10  KILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQER 69

Query: 230 FRTITTAY 253
           FRT+T +Y
Sbjct: 70  FRTLTPSY 77



 Score = 65.7 bits (153), Expect = 2e-10
 Identities = 32/88 (36%), Positives = 53/88 (60%), Gaps = 1/88 (1%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASA-DVEKMILGNKCDLDSQRQVSKE 423
           S  RG+ G++LVYDVT   +F  + NW+  +E   +  D+  M++GNK D ++ R+V + 
Sbjct: 76  SYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKEN-REVDRN 134

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAF 507
            G + A ++ + F+E SAK    V+ AF
Sbjct: 135 EGLKFARKHSMLFIEASAKTCDGVQCAF 162


>BC062319-1|AAH62319.1|  212|Homo sapiens RAB43, member RAS oncogene
           family protein.
          Length = 212

 Score =  101 bits (241), Expect = 4e-21
 Identities = 45/73 (61%), Positives = 59/73 (80%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFKL+L+GD+ VGKT ++ RF   AF+    STIG+DF ++T+++ GK+VKLQIWDT
Sbjct: 15  YDFLFKLVLVGDASVGKTCVVQRFKTGAFSERQGSTIGVDFTMKTLEIQGKRVKLQIWDT 74

Query: 215 AGQERFRTITTAY 253
           AGQERFRTIT +Y
Sbjct: 75  AGQERFRTITQSY 87



 Score = 74.9 bits (176), Expect = 3e-13
 Identities = 36/88 (40%), Positives = 55/88 (62%), Gaps = 1/88 (1%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  R + G +L YD+T   SF ++ +WI ++ + A +++ ++++GNK DL   R+VS   
Sbjct: 86  SYYRSANGAILAYDITKRSSFLSVPHWIEDVRKYAGSNIVQLLIGNKSDLSELREVSLAE 145

Query: 427 GEQLAIEYQIK-FVETSAKDSLNVEYAF 507
            + LA  Y I   +ETSAKDS NVE AF
Sbjct: 146 AQSLAEHYDILCAIETSAKDSSNVEEAF 173


>BC029350-1|AAH29350.1|  206|Homo sapiens RAB18, member RAS oncogene
           family protein.
          Length = 206

 Score =  101 bits (241), Expect = 4e-21
 Identities = 42/68 (61%), Positives = 57/68 (83%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K+L+IG+SGVGK+S+L RF++D F+    +TIG+DFK++TI +DG K KL IWDTAGQER
Sbjct: 10  KILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQER 69

Query: 230 FRTITTAY 253
           FRT+T +Y
Sbjct: 70  FRTLTPSY 77



 Score = 65.7 bits (153), Expect = 2e-10
 Identities = 32/88 (36%), Positives = 53/88 (60%), Gaps = 1/88 (1%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASA-DVEKMILGNKCDLDSQRQVSKE 423
           S  RG+ G++LVYDVT   +F  + NW+  +E   +  D+  M++GNK D ++ R+V + 
Sbjct: 76  SYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKEN-REVDRN 134

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAF 507
            G + A ++ + F+E SAK    V+ AF
Sbjct: 135 EGLKFARKHSMLFIEASAKTCDGVQCAF 162


>BC015014-1|AAH15014.1|  206|Homo sapiens RAB18, member RAS oncogene
           family protein.
          Length = 206

 Score =  101 bits (241), Expect = 4e-21
 Identities = 42/68 (61%), Positives = 57/68 (83%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K+L+IG+SGVGK+S+L RF++D F+    +TIG+DFK++TI +DG K KL IWDTAGQER
Sbjct: 10  KILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQER 69

Query: 230 FRTITTAY 253
           FRT+T +Y
Sbjct: 70  FRTLTPSY 77



 Score = 65.7 bits (153), Expect = 2e-10
 Identities = 32/88 (36%), Positives = 53/88 (60%), Gaps = 1/88 (1%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASA-DVEKMILGNKCDLDSQRQVSKE 423
           S  RG+ G++LVYDVT   +F  + NW+  +E   +  D+  M++GNK D ++ R+V + 
Sbjct: 76  SYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKEN-REVDRN 134

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAF 507
            G + A ++ + F+E SAK    V+ AF
Sbjct: 135 EGLKFARKHSMLFIEASAKTCDGVQCAF 162


>AY166852-1|AAO17291.1|  212|Homo sapiens RAB43 protein.
          Length = 212

 Score =  101 bits (241), Expect = 4e-21
 Identities = 45/73 (61%), Positives = 59/73 (80%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFKL+L+GD+ VGKT ++ RF   AF+    STIG+DF ++T+++ GK+VKLQIWDT
Sbjct: 15  YDFLFKLVLVGDASVGKTCVVQRFKTGAFSERQGSTIGVDFTMKTLEIQGKRVKLQIWDT 74

Query: 215 AGQERFRTITTAY 253
           AGQERFRTIT +Y
Sbjct: 75  AGQERFRTITQSY 87



 Score = 74.9 bits (176), Expect = 3e-13
 Identities = 36/88 (40%), Positives = 55/88 (62%), Gaps = 1/88 (1%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  R + G +L YD+T   SF ++ +WI ++ + A +++ ++++GNK DL   R+VS   
Sbjct: 86  SYYRSANGAILAYDITKRSSFLSVPHWIEDVRKYAGSNIVQLLIGNKSDLSELREVSLAE 145

Query: 427 GEQLAIEYQIK-FVETSAKDSLNVEYAF 507
            + LA  Y I   +ETSAKDS NVE AF
Sbjct: 146 AQSLAEHYDILCAIETSAKDSSNVEEAF 173


>AL138920-1|CAH70590.1|  206|Homo sapiens RAB18, member RAS oncogene
           family protein.
          Length = 206

 Score =  101 bits (241), Expect = 4e-21
 Identities = 42/68 (61%), Positives = 57/68 (83%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K+L+IG+SGVGK+S+L RF++D F+    +TIG+DFK++TI +DG K KL IWDTAGQER
Sbjct: 10  KILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQER 69

Query: 230 FRTITTAY 253
           FRT+T +Y
Sbjct: 70  FRTLTPSY 77



 Score = 65.7 bits (153), Expect = 2e-10
 Identities = 32/88 (36%), Positives = 53/88 (60%), Gaps = 1/88 (1%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASA-DVEKMILGNKCDLDSQRQVSKE 423
           S  RG+ G++LVYDVT   +F  + NW+  +E   +  D+  M++GNK D ++ R+V + 
Sbjct: 76  SYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKEN-REVDRN 134

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAF 507
            G + A ++ + F+E SAK    V+ AF
Sbjct: 135 EGLKFARKHSMLFIEASAKTCDGVQCAF 162


>AJ277145-1|CAB86486.1|  206|Homo sapiens ras-related small GTPase
           RAB18 protein.
          Length = 206

 Score =  101 bits (241), Expect = 4e-21
 Identities = 42/68 (61%), Positives = 57/68 (83%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K+L+IG+SGVGK+S+L RF++D F+    +TIG+DFK++TI +DG K KL IWDTAGQER
Sbjct: 10  KILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQER 69

Query: 230 FRTITTAY 253
           FRT+T +Y
Sbjct: 70  FRTLTPSY 77



 Score = 65.7 bits (153), Expect = 2e-10
 Identities = 32/88 (36%), Positives = 53/88 (60%), Gaps = 1/88 (1%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASA-DVEKMILGNKCDLDSQRQVSKE 423
           S  RG+ G++LVYDVT   +F  + NW+  +E   +  D+  M++GNK D ++ R+V + 
Sbjct: 76  SYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKEN-REVDRN 134

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAF 507
            G + A ++ + F+E SAK    V+ AF
Sbjct: 135 EGLKFARKHSMLFIEASAKTCDGVQCAF 162


>AF498950-1|AAM21098.1|  206|Homo sapiens small GTP binding protein
           RAB18 protein.
          Length = 206

 Score =  101 bits (241), Expect = 4e-21
 Identities = 42/68 (61%), Positives = 57/68 (83%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K+L+IG+SGVGK+S+L RF++D F+    +TIG+DFK++TI +DG K KL IWDTAGQER
Sbjct: 10  KILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQER 69

Query: 230 FRTITTAY 253
           FRT+T +Y
Sbjct: 70  FRTLTPSY 77



 Score = 65.7 bits (153), Expect = 2e-10
 Identities = 32/88 (36%), Positives = 53/88 (60%), Gaps = 1/88 (1%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASA-DVEKMILGNKCDLDSQRQVSKE 423
           S  RG+ G++LVYDVT   +F  + NW+  +E   +  D+  M++GNK D ++ R+V + 
Sbjct: 76  SYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKEN-REVDRN 134

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAF 507
            G + A ++ + F+E SAK    V+ AF
Sbjct: 135 EGLKFARKHSMLFIEASAKTCDGVQCAF 162


>AF137372-1|AAF61433.1|  206|Homo sapiens ras-related protein RAB18
           protein.
          Length = 206

 Score =  101 bits (241), Expect = 4e-21
 Identities = 42/68 (61%), Positives = 57/68 (83%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K+L+IG+SGVGK+S+L RF++D F+    +TIG+DFK++TI +DG K KL IWDTAGQER
Sbjct: 10  KILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQER 69

Query: 230 FRTITTAY 253
           FRT+T +Y
Sbjct: 70  FRTLTPSY 77



 Score = 65.7 bits (153), Expect = 2e-10
 Identities = 32/88 (36%), Positives = 53/88 (60%), Gaps = 1/88 (1%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASA-DVEKMILGNKCDLDSQRQVSKE 423
           S  RG+ G++LVYDVT   +F  + NW+  +E   +  D+  M++GNK D ++ R+V + 
Sbjct: 76  SYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKEN-REVDRN 134

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAF 507
            G + A ++ + F+E SAK    V+ AF
Sbjct: 135 EGLKFARKHSMLFIEASAKTCDGVQCAF 162


>AF136974-1|AAG49435.1|  206|Homo sapiens ras-related protein 18
           protein.
          Length = 206

 Score =  101 bits (241), Expect = 4e-21
 Identities = 42/68 (61%), Positives = 57/68 (83%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K+L+IG+SGVGK+S+L RF++D F+    +TIG+DFK++TI +DG K KL IWDTAGQER
Sbjct: 10  KILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQER 69

Query: 230 FRTITTAY 253
           FRT+T +Y
Sbjct: 70  FRTLTPSY 77



 Score = 65.7 bits (153), Expect = 2e-10
 Identities = 32/88 (36%), Positives = 53/88 (60%), Gaps = 1/88 (1%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASA-DVEKMILGNKCDLDSQRQVSKE 423
           S  RG+ G++LVYDVT   +F  + NW+  +E   +  D+  M++GNK D ++ R+V + 
Sbjct: 76  SYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKEN-REVDRN 134

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAF 507
            G + A ++ + F+E SAK    V+ AF
Sbjct: 135 EGLKFARKHSMLFIEASAKTCDGVQCAF 162


>AF087860-1|AAP97170.1|  206|Homo sapiens rab18 protein.
          Length = 206

 Score =  101 bits (241), Expect = 4e-21
 Identities = 42/68 (61%), Positives = 57/68 (83%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K+L+IG+SGVGK+S+L RF++D F+    +TIG+DFK++TI +DG K KL IWDTAGQER
Sbjct: 10  KILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQER 69

Query: 230 FRTITTAY 253
           FRT+T +Y
Sbjct: 70  FRTLTPSY 77



 Score = 65.7 bits (153), Expect = 2e-10
 Identities = 32/88 (36%), Positives = 53/88 (60%), Gaps = 1/88 (1%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASA-DVEKMILGNKCDLDSQRQVSKE 423
           S  RG+ G++LVYDVT   +F  + NW+  +E   +  D+  M++GNK D ++ R+V + 
Sbjct: 76  SYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKEN-REVDRN 134

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAF 507
            G + A ++ + F+E SAK    V+ AF
Sbjct: 135 EGLKFARKHSMLFIEASAKTCDGVQCAF 162


>AK223153-1|BAD96873.1|  206|Homo sapiens RAB18, member RAS oncogene
           family variant protein.
          Length = 206

 Score =  100 bits (239), Expect = 6e-21
 Identities = 41/68 (60%), Positives = 57/68 (83%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K+L+IG+SGVGK+S+L RF++D F+    +TIG+DFK++TI +DG K KL +WDTAGQER
Sbjct: 10  KILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLALWDTAGQER 69

Query: 230 FRTITTAY 253
           FRT+T +Y
Sbjct: 70  FRTLTPSY 77



 Score = 65.7 bits (153), Expect = 2e-10
 Identities = 32/88 (36%), Positives = 53/88 (60%), Gaps = 1/88 (1%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASA-DVEKMILGNKCDLDSQRQVSKE 423
           S  RG+ G++LVYDVT   +F  + NW+  +E   +  D+  M++GNK D ++ R+V + 
Sbjct: 76  SYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKEN-REVDRN 134

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAF 507
            G + A ++ + F+E SAK    V+ AF
Sbjct: 135 EGLKFARKHSMLFIEASAKTCDGVQCAF 162


>CR542106-1|CAG46903.1|  203|Homo sapiens RAB30 protein.
          Length = 203

 Score = 98.3 bits (234), Expect = 3e-20
 Identities = 43/73 (58%), Positives = 61/73 (83%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK++LIG++GVGKT ++ RF++  F     +TIG+DF I+T++++G+KVKLQIWDT
Sbjct: 6   YDFLFKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEINGEKVKLQIWDT 65

Query: 215 AGQERFRTITTAY 253
           AGQERFR+IT +Y
Sbjct: 66  AGQERFRSITQSY 78



 Score = 75.8 bits (178), Expect = 2e-13
 Identities = 36/87 (41%), Positives = 57/87 (65%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  R +  ++L YD+T E+SF  +  W+R IE+ AS  V  +++GNK DL  +R+VS++R
Sbjct: 77  SYYRSANALILTYDITCEESFRCLPEWLREIEQYASNKVITVLVGNKIDLAERREVSQQR 136

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
            E+ +    + ++ETSAK+S NVE  F
Sbjct: 137 AEEFSEAQDMYYLETSAKESDNVEKLF 163


>BX641138-1|CAE46061.1|  164|Homo sapiens hypothetical protein
           protein.
          Length = 164

 Score = 98.3 bits (234), Expect = 3e-20
 Identities = 43/73 (58%), Positives = 61/73 (83%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK++LIG++GVGKT ++ RF++  F     +TIG+DF I+T++++G+KVKLQIWDT
Sbjct: 6   YDFLFKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEINGEKVKLQIWDT 65

Query: 215 AGQERFRTITTAY 253
           AGQERFR+IT +Y
Sbjct: 66  AGQERFRSITQSY 78



 Score = 37.9 bits (84), Expect = 0.039
 Identities = 20/59 (33%), Positives = 31/59 (52%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKE 423
           S  R +  ++L YD+T E+SF  +  W+R IE+ AS  V  ++      L  +R  S E
Sbjct: 77  SYYRSANALILTYDITCEESFRCLPEWLREIEQYASNKVITVLATRLTWLKGERFPSSE 135


>BC014213-1|AAH14213.1|  203|Homo sapiens RAB30, member RAS oncogene
           family protein.
          Length = 203

 Score = 98.3 bits (234), Expect = 3e-20
 Identities = 43/73 (58%), Positives = 61/73 (83%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK++LIG++GVGKT ++ RF++  F     +TIG+DF I+T++++G+KVKLQIWDT
Sbjct: 6   YDFLFKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEINGEKVKLQIWDT 65

Query: 215 AGQERFRTITTAY 253
           AGQERFR+IT +Y
Sbjct: 66  AGQERFRSITQSY 78



 Score = 75.8 bits (178), Expect = 2e-13
 Identities = 36/87 (41%), Positives = 57/87 (65%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  R +  ++L YD+T E+SF  +  W+R IE+ AS  V  +++GNK DL  +R+VS++R
Sbjct: 77  SYYRSANALILTYDITCEESFRCLPEWLREIEQYASNKVITVLVGNKIDLAERREVSQQR 136

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
            E+ +    + ++ETSAK+S NVE  F
Sbjct: 137 AEEFSEAQDMYYLETSAKESDNVEKLF 163


>AF498956-1|AAM21104.1|  203|Homo sapiens small GTP binding protein
           RAB30 protein.
          Length = 203

 Score = 98.3 bits (234), Expect = 3e-20
 Identities = 43/73 (58%), Positives = 61/73 (83%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK++LIG++GVGKT ++ RF++  F     +TIG+DF I+T++++G+KVKLQIWDT
Sbjct: 6   YDFLFKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEINGEKVKLQIWDT 65

Query: 215 AGQERFRTITTAY 253
           AGQERFR+IT +Y
Sbjct: 66  AGQERFRSITQSY 78



 Score = 75.8 bits (178), Expect = 2e-13
 Identities = 36/87 (41%), Positives = 57/87 (65%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  R +  ++L YD+T E+SF  +  W+R IE+ AS  V  +++GNK DL  +R+VS++R
Sbjct: 77  SYYRSANALILTYDITCEESFRCLPEWLREIEQYASNKVITVLVGNKIDLAERREVSQQR 136

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
            E+ +    + ++ETSAK+S NVE  F
Sbjct: 137 AEEFSEAQDMYYLETSAKESDNVEKLF 163


>U57092-1|AAC50774.1|  203|Homo sapiens Rab30 protein.
          Length = 203

 Score = 95.5 bits (227), Expect = 2e-19
 Identities = 42/73 (57%), Positives = 60/73 (82%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK++LIG++GVGKT ++ RF++  F     +TIG+ F I+T++++G+KVKLQIWDT
Sbjct: 6   YDFLFKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGVGFMIKTVEINGEKVKLQIWDT 65

Query: 215 AGQERFRTITTAY 253
           AGQERFR+IT +Y
Sbjct: 66  AGQERFRSITQSY 78



 Score = 75.8 bits (178), Expect = 2e-13
 Identities = 36/87 (41%), Positives = 57/87 (65%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  R +  ++L YD+T E+SF  +  W+R IE+ AS  V  +++GNK DL  +R+VS++R
Sbjct: 77  SYYRSANALILTYDITCEESFRCLPEWLREIEQYASNKVITVLVGNKIDLAERREVSQQR 136

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
            E+ +    + ++ETSAK+S NVE  F
Sbjct: 137 AEEFSEAQDMYYLETSAKESDNVEKLF 163


>AF498952-1|AAM21100.1|  190|Homo sapiens small GTP binding protein
           RAB26 protein.
          Length = 190

 Score = 95.5 bits (227), Expect = 2e-19
 Identities = 43/67 (64%), Positives = 56/67 (83%), Gaps = 1/67 (1%)
 Frame = +2

Query: 56  LLIGDSGVGKTSILFRFSEDAFNI-SFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQERF 232
           +L+GDSGVGKT +L RF + AF   +FIST+GIDF+ + +D+DG KVKLQ+WDTAGQERF
Sbjct: 1   MLVGDSGVGKTCLLVRFKDGAFLAGTFISTVGIDFRNKVLDVDGVKVKLQMWDTAGQERF 60

Query: 233 RTITTAY 253
           R++T AY
Sbjct: 61  RSVTHAY 67



 Score = 90.2 bits (214), Expect = 7e-18
 Identities = 43/85 (50%), Positives = 59/85 (69%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           R +  ++L+YDVTN+ SF+NI+ W+  I E A  DV  M+LGNK D   +R V +E GE+
Sbjct: 69  RDAHALLLLYDVTNKASFDNIQAWLTEIHEYAQHDVALMLLGNKVDSAHERVVKREDGEK 128

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
           LA EY + F+ETSAK  LNV+ AF+
Sbjct: 129 LAKEYGLPFMETSAKTGLNVDLAFT 153


>AB027137-1|BAA84707.1|  190|Homo sapiens RAB-26 protein.
          Length = 190

 Score = 95.5 bits (227), Expect = 2e-19
 Identities = 43/67 (64%), Positives = 56/67 (83%), Gaps = 1/67 (1%)
 Frame = +2

Query: 56  LLIGDSGVGKTSILFRFSEDAFNI-SFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQERF 232
           +L+GDSGVGKT +L RF + AF   +FIST+GIDF+ + +D+DG KVKLQ+WDTAGQERF
Sbjct: 1   MLVGDSGVGKTCLLVRFKDGAFLAGTFISTVGIDFRNKVLDVDGVKVKLQMWDTAGQERF 60

Query: 233 RTITTAY 253
           R++T AY
Sbjct: 61  RSVTHAY 67



 Score = 90.2 bits (214), Expect = 7e-18
 Identities = 43/85 (50%), Positives = 59/85 (69%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           R +  ++L+YDVTN+ SF+NI+ W+  I E A  DV  M+LGNK D   +R V +E GE+
Sbjct: 69  RDAHALLLLYDVTNKASFDNIQAWLTEIHEYAQHDVALMLLGNKVDSAHERVVKREDGEK 128

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
           LA EY + F+ETSAK  LNV+ AF+
Sbjct: 129 LAKEYGLPFMETSAKTGLNVDLAFT 153


>BC016615-1|AAH16615.1|  223|Homo sapiens RAB37, member RAS oncogene
           family protein.
          Length = 223

 Score = 94.7 bits (225), Expect = 3e-19
 Identities = 42/75 (56%), Positives = 60/75 (80%), Gaps = 1/75 (1%)
 Frame = +2

Query: 32  TYDCLFKLLLIGDSGVGKTSILFRFSEDAF-NISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           +YD   K++L+GD+GVGKT  L +F + AF + +FI+T+GIDF+ + + +DG +VKLQIW
Sbjct: 25  SYDLTGKVMLLGDTGVGKTCFLIQFKDGAFLSGTFIATVGIDFRNKVVTVDGVRVKLQIW 84

Query: 209 DTAGQERFRTITTAY 253
           DTAGQERFR++T AY
Sbjct: 85  DTAGQERFRSVTHAY 99



 Score = 93.9 bits (223), Expect = 6e-19
 Identities = 42/84 (50%), Positives = 58/84 (69%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           R +  ++L+YD+TN+ SF+NI+ W+  I E A  DV  M+LGNK D+ S+R +  E GE 
Sbjct: 101 RDAQALLLLYDITNKSSFDNIRAWLTEIHEYAQRDVVIMLLGNKADMSSERVIRSEDGET 160

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
           LA EY + F+ETSAK  +NVE AF
Sbjct: 161 LAREYGVPFLETSAKTGMNVELAF 184


>AK098068-1|BAC05227.1|  223|Homo sapiens protein ( Homo sapiens
           cDNA FLJ40749 fis, clone TRACH2000540, highly similar to
           Mus musculus GTPase Rab37 (Rab37) mRNA. ).
          Length = 223

 Score = 94.7 bits (225), Expect = 3e-19
 Identities = 42/75 (56%), Positives = 60/75 (80%), Gaps = 1/75 (1%)
 Frame = +2

Query: 32  TYDCLFKLLLIGDSGVGKTSILFRFSEDAF-NISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           +YD   K++L+GD+GVGKT  L +F + AF + +FI+T+GIDF+ + + +DG +VKLQIW
Sbjct: 25  SYDLTGKVMLLGDTGVGKTCFLIQFKDGAFLSGTFIATVGIDFRNKVVTVDGVRVKLQIW 84

Query: 209 DTAGQERFRTITTAY 253
           DTAGQERFR++T AY
Sbjct: 85  DTAGQERFRSVTHAY 99



 Score = 93.9 bits (223), Expect = 6e-19
 Identities = 42/84 (50%), Positives = 58/84 (69%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           R +  ++L+YD+TN+ SF+NI+ W+  I E A  DV  M+LGNK D+ S+R +  E GE 
Sbjct: 101 RDAQALLLLYDITNKSSFDNIRAWLTEIHEYAQRDVVIMLLGNKADMSSERVIRSEDGET 160

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
           LA EY + F+ETSAK  +NVE AF
Sbjct: 161 LAREYGVPFLETSAKTGMNVELAF 184


>BC046927-1|AAH46927.1|  213|Homo sapiens RAB4B, member RAS oncogene
           family protein.
          Length = 213

 Score = 93.9 bits (223), Expect = 6e-19
 Identities = 42/77 (54%), Positives = 57/77 (74%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           MA+TYD LFK L+IG +G GK+ +L +F E+ F      TIG++F  R +++ GK VKLQ
Sbjct: 1   MAETYDFLFKFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGVEFGSRVVNVGGKTVKLQ 60

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFR++T +Y
Sbjct: 61  IWDTAGQERFRSVTRSY 77



 Score = 68.1 bits (159), Expect = 3e-11
 Identities = 32/87 (36%), Positives = 54/87 (62%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G +LVYD+T+ +++ ++  W+ +    AS ++  ++ GNK DLD +R+V+   
Sbjct: 76  SYYRGAAGALLVYDITSRETYNSLAAWLTDARTLASPNIVVILCGNKKDLDPEREVTFLE 135

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
             + A E ++ F+ETSA    NVE AF
Sbjct: 136 ASRFAQENELMFLETSALTGENVEEAF 162


>BC040547-1|AAH40547.1|  216|Homo sapiens RAB37, member RAS oncogene
           family protein.
          Length = 216

 Score = 93.9 bits (223), Expect = 6e-19
 Identities = 42/84 (50%), Positives = 58/84 (69%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           R +  ++L+YD+TN+ SF+NI+ W+  I E A  DV  M+LGNK D+ S+R +  E GE 
Sbjct: 94  RDAQALLLLYDITNKSSFDNIRAWLTEIHEYAQRDVVIMLLGNKADMSSERVIRSEDGET 153

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
           LA EY + F+ETSAK  +NVE AF
Sbjct: 154 LAREYGVPFLETSAKTGMNVELAF 177



 Score = 87.0 bits (206), Expect = 6e-17
 Identities = 41/71 (57%), Positives = 54/71 (76%), Gaps = 1/71 (1%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNI-SFISTIGIDFKIRTIDLDGKKVKLQIWDTAG 220
           L K +L+GDSGVGKTS+L +F +  F   SF +T+GI F  + + +DG +VKLQIWDTAG
Sbjct: 22  LHKTILVGDSGVGKTSLLVQFDQGKFIPGSFSATVGIGFTNKVVTVDGVRVKLQIWDTAG 81

Query: 221 QERFRTITTAY 253
           QERFR++T AY
Sbjct: 82  QERFRSVTHAY 92


>BC033081-1|AAH33081.1|  121|Homo sapiens RAB4B protein protein.
          Length = 121

 Score = 93.9 bits (223), Expect = 6e-19
 Identities = 42/77 (54%), Positives = 57/77 (74%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           MA+TYD LFK L+IG +G GK+ +L +F E+ F      TIG++F  R +++ GK VKLQ
Sbjct: 1   MAETYDFLFKFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGVEFGSRVVNVGGKTVKLQ 60

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFR++T +Y
Sbjct: 61  IWDTAGQERFRSVTRSY 77


>AF498935-1|AAM21083.1|  213|Homo sapiens small GTP binding protein
           RAB4B protein.
          Length = 213

 Score = 93.9 bits (223), Expect = 6e-19
 Identities = 42/77 (54%), Positives = 57/77 (74%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           MA+TYD LFK L+IG +G GK+ +L +F E+ F      TIG++F  R +++ GK VKLQ
Sbjct: 1   MAETYDFLFKFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGVEFGSRVVNVGGKTVKLQ 60

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFR++T +Y
Sbjct: 61  IWDTAGQERFRSVTRSY 77



 Score = 68.1 bits (159), Expect = 3e-11
 Identities = 32/87 (36%), Positives = 54/87 (62%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G +LVYD+T+ +++ ++  W+ +    AS ++  ++ GNK DLD +R+V+   
Sbjct: 76  SYYRGAAGALLVYDITSRETYNSLAAWLTDARTLASPNIVVILCGNKKDLDPEREVTFLE 135

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
             + A E ++ F+ETSA    NVE AF
Sbjct: 136 ASRFAQENELMFLETSALTGENVEEAF 162


>AF165522-1|AAD45923.1|  213|Homo sapiens ras-related GTP-binding
           protein 4b protein.
          Length = 213

 Score = 93.9 bits (223), Expect = 6e-19
 Identities = 42/77 (54%), Positives = 57/77 (74%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           MA+TYD LFK L+IG +G GK+ +L +F E+ F      TIG++F  R +++ GK VKLQ
Sbjct: 1   MAETYDFLFKFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGVEFGSRVVNVGGKTVKLQ 60

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFR++T +Y
Sbjct: 61  IWDTAGQERFRSVTRSY 77



 Score = 68.1 bits (159), Expect = 3e-11
 Identities = 32/87 (36%), Positives = 54/87 (62%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G +LVYD+T+ +++ ++  W+ +    AS ++  ++ GNK DLD +R+V+   
Sbjct: 76  SYYRGAAGALLVYDITSRETYNSLAAWLTDARTLASPNIVVILCGNKKDLDPEREVTFLE 135

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
             + A E ++ F+ETSA    NVE AF
Sbjct: 136 ASRFAQENELMFLETSALTGENVEEAF 162


>CR533479-1|CAG38510.1|  129|Homo sapiens RAB1A protein.
          Length = 129

 Score = 91.5 bits (217), Expect = 3e-18
 Identities = 42/61 (68%), Positives = 51/61 (83%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           M   YD LFKLLLIGDSGVGK+ +L RF++D +  S+ISTIG+DFKIRTI+LDGK +KLQ
Sbjct: 4   MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQ 63

Query: 203 I 205
           I
Sbjct: 64  I 64


>M28211-1|AAA60244.1|  213|Homo sapiens GTP-binding protein protein.
          Length = 213

 Score = 90.6 bits (215), Expect = 5e-18
 Identities = 41/77 (53%), Positives = 57/77 (74%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           M++TYD LFK L+IG++G GK+ +L +F E  F      TIG++F  + I++ GK VKLQ
Sbjct: 1   MSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQ 60

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFR++T +Y
Sbjct: 61  IWDTAGQERFRSVTRSY 77



 Score = 67.3 bits (157), Expect = 6e-11
 Identities = 32/87 (36%), Positives = 54/87 (62%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G +LVYD+T+ +++  + NW+ +    AS ++  ++ GNK DLD+ R+V+   
Sbjct: 76  SYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLE 135

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
             + A E ++ F+ETSA    +VE AF
Sbjct: 136 ASRFAQENELMFLETSALTGEDVEEAF 162


>BC004309-1|AAH04309.1|  218|Homo sapiens RAB4A, member RAS oncogene
           family protein.
          Length = 218

 Score = 90.6 bits (215), Expect = 5e-18
 Identities = 41/77 (53%), Positives = 57/77 (74%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           M++TYD LFK L+IG++G GK+ +L +F E  F      TIG++F  + I++ GK VKLQ
Sbjct: 6   MSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQ 65

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFR++T +Y
Sbjct: 66  IWDTAGQERFRSVTRSY 82



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 33/87 (37%), Positives = 54/87 (62%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G +LVYD+T+ +++  + NW+ +    AS ++  ++ GNK DLD+ R+V+   
Sbjct: 81  SYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLE 140

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
             + A E ++ F+ETSA    NVE AF
Sbjct: 141 ASRFAQENELMFLETSALTGENVEEAF 167


>BC002438-1|AAH02438.1|  218|Homo sapiens RAB4A, member RAS oncogene
           family protein.
          Length = 218

 Score = 90.6 bits (215), Expect = 5e-18
 Identities = 41/77 (53%), Positives = 57/77 (74%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           M++TYD LFK L+IG++G GK+ +L +F E  F      TIG++F  + I++ GK VKLQ
Sbjct: 6   MSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQ 65

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFR++T +Y
Sbjct: 66  IWDTAGQERFRSVTRSY 82



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 33/87 (37%), Positives = 54/87 (62%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G +LVYD+T+ +++  + NW+ +    AS ++  ++ GNK DLD+ R+V+   
Sbjct: 81  SYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLE 140

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
             + A E ++ F+ETSA    NVE AF
Sbjct: 141 ASRFAQENELMFLETSALTGENVEEAF 167


>AY585832-1|AAT91347.1|  218|Homo sapiens HRES-1 antisense Rab
           protein.
          Length = 218

 Score = 90.6 bits (215), Expect = 5e-18
 Identities = 41/77 (53%), Positives = 57/77 (74%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           M++TYD LFK L+IG++G GK+ +L +F E  F      TIG++F  + I++ GK VKLQ
Sbjct: 6   MSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQ 65

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFR++T +Y
Sbjct: 66  IWDTAGQERFRSVTRSY 82



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 33/87 (37%), Positives = 54/87 (62%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G +LVYD+T+ +++  + NW+ +    AS ++  ++ GNK DLD+ R+V+   
Sbjct: 81  SYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLE 140

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
             + A E ++ F+ETSA    NVE AF
Sbjct: 141 ASRFAQENELMFLETSALTGENVEEAF 167


>AL162595-3|CAI19037.1|  218|Homo sapiens RAB4A, member RAS oncogene
           family protein.
          Length = 218

 Score = 90.6 bits (215), Expect = 5e-18
 Identities = 41/77 (53%), Positives = 57/77 (74%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           M++TYD LFK L+IG++G GK+ +L +F E  F      TIG++F  + I++ GK VKLQ
Sbjct: 6   MSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQ 65

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFR++T +Y
Sbjct: 66  IWDTAGQERFRSVTRSY 82



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 33/87 (37%), Positives = 54/87 (62%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G +LVYD+T+ +++  + NW+ +    AS ++  ++ GNK DLD+ R+V+   
Sbjct: 81  SYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLE 140

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
             + A E ++ F+ETSA    NVE AF
Sbjct: 141 ASRFAQENELMFLETSALTGENVEEAF 167


>AL117350-4|CAI22870.1|  218|Homo sapiens RAB4A, member RAS oncogene
           family protein.
          Length = 218

 Score = 90.6 bits (215), Expect = 5e-18
 Identities = 41/77 (53%), Positives = 57/77 (74%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           M++TYD LFK L+IG++G GK+ +L +F E  F      TIG++F  + I++ GK VKLQ
Sbjct: 6   MSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQ 65

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFR++T +Y
Sbjct: 66  IWDTAGQERFRSVTRSY 82



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 33/87 (37%), Positives = 54/87 (62%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G +LVYD+T+ +++  + NW+ +    AS ++  ++ GNK DLD+ R+V+   
Sbjct: 81  SYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLE 140

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
             + A E ++ F+ETSA    NVE AF
Sbjct: 141 ASRFAQENELMFLETSALTGENVEEAF 167


>AF498934-1|AAM21082.1|  218|Homo sapiens small GTP binding protein
           RAB4A protein.
          Length = 218

 Score = 90.6 bits (215), Expect = 5e-18
 Identities = 41/77 (53%), Positives = 57/77 (74%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           M++TYD LFK L+IG++G GK+ +L +F E  F      TIG++F  + I++ GK VKLQ
Sbjct: 6   MSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQ 65

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFR++T +Y
Sbjct: 66  IWDTAGQERFRSVTRSY 82



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 33/87 (37%), Positives = 54/87 (62%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G +LVYD+T+ +++  + NW+ +    AS ++  ++ GNK DLD+ R+V+   
Sbjct: 81  SYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLE 140

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
             + A E ++ F+ETSA    NVE AF
Sbjct: 141 ASRFAQENELMFLETSALTGENVEEAF 167


>BC020839-1|AAH20839.1|  216|Homo sapiens RAB2B, member RAS oncogene
           family protein.
          Length = 216

 Score = 90.2 bits (214), Expect = 7e-18
 Identities = 39/74 (52%), Positives = 56/74 (75%)
 Frame = +2

Query: 32  TYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWD 211
           TY  LFK ++IGD+GVGK+ +L +F++  F      TIG++F  R +++DGK++KLQIWD
Sbjct: 2   TYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVNIDGKQIKLQIWD 61

Query: 212 TAGQERFRTITTAY 253
           TAGQE FR+IT +Y
Sbjct: 62  TAGQESFRSITRSY 75



 Score = 86.2 bits (204), Expect = 1e-16
 Identities = 37/87 (42%), Positives = 62/87 (71%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G +LVYD+T  ++F ++ +W+ +  +++S+++  M++GNK DL+S+R V +E 
Sbjct: 74  SYYRGAAGALLVYDITRRETFNHLTSWLEDARQHSSSNMVIMLIGNKSDLESRRDVKREE 133

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GE  A E+ + F+ETSAK + NVE AF
Sbjct: 134 GEAFAREHGLIFMETSAKTACNVEEAF 160


>AK223009-1|BAD96729.1|  218|Homo sapiens RAB4A, member RAS oncogene
           family variant protein.
          Length = 218

 Score = 90.2 bits (214), Expect = 7e-18
 Identities = 41/77 (53%), Positives = 57/77 (74%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           M++TYD LFK L+IG++G GK+ +L +F E  F      TIG++F  + I++ GK VKLQ
Sbjct: 6   MSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKGDSNHTIGVEFGSKIINVGGKYVKLQ 65

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFR++T +Y
Sbjct: 66  IWDTAGQERFRSVTRSY 82



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 33/87 (37%), Positives = 54/87 (62%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G +LVYD+T+ +++  + NW+ +    AS ++  ++ GNK DLD+ R+V+   
Sbjct: 81  SYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLE 140

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
             + A E ++ F+ETSA    NVE AF
Sbjct: 141 ASRFAQENELMFLETSALTGENVEEAF 167


>AF468652-1|AAN86142.1|  216|Homo sapiens RAB2B protein.
          Length = 216

 Score = 90.2 bits (214), Expect = 7e-18
 Identities = 39/74 (52%), Positives = 56/74 (75%)
 Frame = +2

Query: 32  TYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWD 211
           TY  LFK ++IGD+GVGK+ +L +F++  F      TIG++F  R +++DGK++KLQIWD
Sbjct: 2   TYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVNIDGKQIKLQIWD 61

Query: 212 TAGQERFRTITTAY 253
           TAGQE FR+IT +Y
Sbjct: 62  TAGQESFRSITRSY 75



 Score = 86.2 bits (204), Expect = 1e-16
 Identities = 37/87 (42%), Positives = 62/87 (71%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G +LVYD+T  ++F ++ +W+ +  +++S+++  M++GNK DL+S+R V +E 
Sbjct: 74  SYYRGAAGALLVYDITRRETFNHLTSWLEDARQHSSSNMVIMLIGNKSDLESRRDVKREE 133

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GE  A E+ + F+ETSAK + NVE AF
Sbjct: 134 GEAFAREHGLIFMETSAKTACNVEEAF 160


>U57093-1|AAC51194.2|  218|Homo sapiens small GTP-binding protein
           Rab27b protein.
          Length = 218

 Score = 88.6 bits (210), Expect = 2e-17
 Identities = 44/83 (53%), Positives = 60/83 (72%), Gaps = 10/83 (12%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTI--------DLDGK- 187
           YD L KLL +GDSGVGKT+ L+R++++ FN  FI+T+GIDF+ + +           GK 
Sbjct: 6   YDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKA 65

Query: 188 -KVKLQIWDTAGQERFRTITTAY 253
            KV LQ+WDTAGQERFR++TTA+
Sbjct: 66  FKVHLQLWDTAGQERFRSLTTAF 88



 Score = 75.4 bits (177), Expect = 2e-13
 Identities = 34/87 (39%), Positives = 58/87 (66%), Gaps = 1/87 (1%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMIL-GNKCDLDSQRQVSKE 423
           +  R +MG +L++D+T+++SF N++NW+  ++ NA  +   ++L GNK DL  QR+V++ 
Sbjct: 87  AFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNER 146

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYA 504
           +  +LA +Y I + ETSA    NVE A
Sbjct: 147 QARELADKYGIPYFETSAATGQNVEKA 173


>CR457394-1|CAG33675.1|  215|Homo sapiens RAB14 protein.
          Length = 215

 Score = 88.6 bits (210), Expect = 2e-17
 Identities = 38/73 (52%), Positives = 53/73 (72%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           Y  +FK ++IGD GVGK+ +L +F+E  F      TIG++F  R I++ G+K+KLQIWDT
Sbjct: 8   YSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDT 67

Query: 215 AGQERFRTITTAY 253
           AGQERFR +T +Y
Sbjct: 68  AGQERFRAVTRSY 80



 Score = 70.1 bits (164), Expect = 8e-12
 Identities = 31/87 (35%), Positives = 53/87 (60%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G ++VYD+T   ++ ++ +W+ +     + +   +++GNK DL++QR V+ E 
Sbjct: 79  SYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEE 138

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
            +Q A E  + F+E SAK   NVE AF
Sbjct: 139 AKQFAEENGLLFLEASAKTGENVEDAF 165


>BC027474-1|AAH27474.1|  218|Homo sapiens RAB27B, member RAS
           oncogene family protein.
          Length = 218

 Score = 88.6 bits (210), Expect = 2e-17
 Identities = 44/83 (53%), Positives = 60/83 (72%), Gaps = 10/83 (12%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTI--------DLDGK- 187
           YD L KLL +GDSGVGKT+ L+R++++ FN  FI+T+GIDF+ + +           GK 
Sbjct: 6   YDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKA 65

Query: 188 -KVKLQIWDTAGQERFRTITTAY 253
            KV LQ+WDTAGQERFR++TTA+
Sbjct: 66  FKVHLQLWDTAGQERFRSLTTAF 88



 Score = 75.4 bits (177), Expect = 2e-13
 Identities = 34/87 (39%), Positives = 58/87 (66%), Gaps = 1/87 (1%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMIL-GNKCDLDSQRQVSKE 423
           +  R +MG +L++D+T+++SF N++NW+  ++ NA  +   ++L GNK DL  QR+V++ 
Sbjct: 87  AFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNER 146

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYA 504
           +  +LA +Y I + ETSA    NVE A
Sbjct: 147 QARELADKYGIPYFETSAATGQNVEKA 173


>BC006081-1|AAH06081.1|  215|Homo sapiens RAB14, member RAS oncogene
           family protein.
          Length = 215

 Score = 88.6 bits (210), Expect = 2e-17
 Identities = 38/73 (52%), Positives = 53/73 (72%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           Y  +FK ++IGD GVGK+ +L +F+E  F      TIG++F  R I++ G+K+KLQIWDT
Sbjct: 8   YSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDT 67

Query: 215 AGQERFRTITTAY 253
           AGQERFR +T +Y
Sbjct: 68  AGQERFRAVTRSY 80



 Score = 70.1 bits (164), Expect = 8e-12
 Identities = 31/87 (35%), Positives = 53/87 (60%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G ++VYD+T   ++ ++ +W+ +     + +   +++GNK DL++QR V+ E 
Sbjct: 79  SYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEE 138

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
            +Q A E  + F+E SAK   NVE AF
Sbjct: 139 AKQFAEENGLLFLEASAKTGENVEDAF 165


>AY553875-1|AAS64573.1|  215|Homo sapiens F protein-binding protein
           1 protein.
          Length = 215

 Score = 88.6 bits (210), Expect = 2e-17
 Identities = 38/73 (52%), Positives = 53/73 (72%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           Y  +FK ++IGD GVGK+ +L +F+E  F      TIG++F  R I++ G+K+KLQIWDT
Sbjct: 8   YSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDT 67

Query: 215 AGQERFRTITTAY 253
           AGQERFR +T +Y
Sbjct: 68  AGQERFRAVTRSY 80



 Score = 70.1 bits (164), Expect = 8e-12
 Identities = 31/87 (35%), Positives = 53/87 (60%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G ++VYD+T   ++ ++ +W+ +     + +   +++GNK DL++QR V+ E 
Sbjct: 79  SYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEE 138

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
            +Q A E  + F+E SAK   NVE AF
Sbjct: 139 AKQFAEENGLLFLEASAKTGENVEDAF 165


>AL137068-10|CAD20124.1|  215|Homo sapiens RAB14, member RAS
           oncogene family protein.
          Length = 215

 Score = 88.6 bits (210), Expect = 2e-17
 Identities = 38/73 (52%), Positives = 53/73 (72%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           Y  +FK ++IGD GVGK+ +L +F+E  F      TIG++F  R I++ G+K+KLQIWDT
Sbjct: 8   YSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDT 67

Query: 215 AGQERFRTITTAY 253
           AGQERFR +T +Y
Sbjct: 68  AGQERFRAVTRSY 80



 Score = 70.1 bits (164), Expect = 8e-12
 Identities = 31/87 (35%), Positives = 53/87 (60%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G ++VYD+T   ++ ++ +W+ +     + +   +++GNK DL++QR V+ E 
Sbjct: 79  SYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEE 138

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
            +Q A E  + F+E SAK   NVE AF
Sbjct: 139 AKQFAEENGLLFLEASAKTGENVEDAF 165


>AL137068-9|CAI12361.1|  181|Homo sapiens RAB14, member RAS oncogene
           family protein.
          Length = 181

 Score = 88.6 bits (210), Expect = 2e-17
 Identities = 38/73 (52%), Positives = 53/73 (72%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           Y  +FK ++IGD GVGK+ +L +F+E  F      TIG++F  R I++ G+K+KLQIWDT
Sbjct: 8   YSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDT 67

Query: 215 AGQERFRTITTAY 253
           AGQERFR +T +Y
Sbjct: 68  AGQERFRAVTRSY 80



 Score = 70.1 bits (164), Expect = 8e-12
 Identities = 31/87 (35%), Positives = 53/87 (60%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G ++VYD+T   ++ ++ +W+ +     + +   +++GNK DL++QR V+ E 
Sbjct: 79  SYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEE 138

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
            +Q A E  + F+E SAK   NVE AF
Sbjct: 139 AKQFAEENGLLFLEASAKTGENVEDAF 165


>AK023524-1|BAB14598.1|  215|Homo sapiens protein ( Homo sapiens
           cDNA FLJ13462 fis, clone PLACE1003394, highly similar to
           Homo sapiens RAB14 protein (RAB14) mRNA. ).
          Length = 215

 Score = 88.6 bits (210), Expect = 2e-17
 Identities = 38/73 (52%), Positives = 53/73 (72%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           Y  +FK ++IGD GVGK+ +L +F+E  F      TIG++F  R I++ G+K+KLQIWDT
Sbjct: 8   YSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDT 67

Query: 215 AGQERFRTITTAY 253
           AGQERFR +T +Y
Sbjct: 68  AGQERFRAVTRSY 80



 Score = 70.1 bits (164), Expect = 8e-12
 Identities = 31/87 (35%), Positives = 53/87 (60%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G ++VYD+T   ++ ++ +W+ +     + +   +++GNK DL++QR V+ E 
Sbjct: 79  SYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEE 138

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
            +Q A E  + F+E SAK   NVE AF
Sbjct: 139 AKQFAEENGLLFLEASAKTGENVEDAF 165


>AF498954-1|AAM21102.1|  218|Homo sapiens small GTP binding protein
           RAB27B protein.
          Length = 218

 Score = 88.6 bits (210), Expect = 2e-17
 Identities = 44/83 (53%), Positives = 60/83 (72%), Gaps = 10/83 (12%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTI--------DLDGK- 187
           YD L KLL +GDSGVGKT+ L+R++++ FN  FI+T+GIDF+ + +           GK 
Sbjct: 6   YDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKA 65

Query: 188 -KVKLQIWDTAGQERFRTITTAY 253
            KV LQ+WDTAGQERFR++TTA+
Sbjct: 66  FKVHLQLWDTAGQERFRSLTTAF 88



 Score = 75.4 bits (177), Expect = 2e-13
 Identities = 34/87 (39%), Positives = 58/87 (66%), Gaps = 1/87 (1%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMIL-GNKCDLDSQRQVSKE 423
           +  R +MG +L++D+T+++SF N++NW+  ++ NA  +   ++L GNK DL  QR+V++ 
Sbjct: 87  AFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNER 146

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYA 504
           +  +LA +Y I + ETSA    NVE A
Sbjct: 147 QARELADKYGIPYFETSAATGQNVEKA 173


>AF498949-1|AAM21097.1|  215|Homo sapiens small GTP binding protein
           RAB14 protein.
          Length = 215

 Score = 88.6 bits (210), Expect = 2e-17
 Identities = 38/73 (52%), Positives = 53/73 (72%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           Y  +FK ++IGD GVGK+ +L +F+E  F      TIG++F  R I++ G+K+KLQIWDT
Sbjct: 8   YSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDT 67

Query: 215 AGQERFRTITTAY 253
           AGQERFR +T +Y
Sbjct: 68  AGQERFRAVTRSY 80



 Score = 70.1 bits (164), Expect = 8e-12
 Identities = 31/87 (35%), Positives = 53/87 (60%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G ++VYD+T   ++ ++ +W+ +     + +   +++GNK DL++QR V+ E 
Sbjct: 79  SYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEE 138

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
            +Q A E  + F+E SAK   NVE AF
Sbjct: 139 AKQFAEENGLLFLEASAKTGENVEDAF 165


>AF329499-1|AAK11243.1|  218|Homo sapiens RAS-related protein RAB27B
           protein.
          Length = 218

 Score = 88.6 bits (210), Expect = 2e-17
 Identities = 44/83 (53%), Positives = 60/83 (72%), Gaps = 10/83 (12%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTI--------DLDGK- 187
           YD L KLL +GDSGVGKT+ L+R++++ FN  FI+T+GIDF+ + +           GK 
Sbjct: 6   YDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKA 65

Query: 188 -KVKLQIWDTAGQERFRTITTAY 253
            KV LQ+WDTAGQERFR++TTA+
Sbjct: 66  FKVHLQLWDTAGQERFRSLTTAF 88



 Score = 75.4 bits (177), Expect = 2e-13
 Identities = 34/87 (39%), Positives = 58/87 (66%), Gaps = 1/87 (1%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMIL-GNKCDLDSQRQVSKE 423
           +  R +MG +L++D+T+++SF N++NW+  ++ NA  +   ++L GNK DL  QR+V++ 
Sbjct: 87  AFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNER 146

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYA 504
           +  +LA +Y I + ETSA    NVE A
Sbjct: 147 QARELADKYGIPYFETSAATGQNVEKA 173


>AF203689-1|AAF19400.1|  215|Homo sapiens GTPase Rab14 protein.
          Length = 215

 Score = 88.6 bits (210), Expect = 2e-17
 Identities = 38/73 (52%), Positives = 53/73 (72%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           Y  +FK ++IGD GVGK+ +L +F+E  F      TIG++F  R I++ G+K+KLQIWDT
Sbjct: 8   YSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDT 67

Query: 215 AGQERFRTITTAY 253
           AGQERFR +T +Y
Sbjct: 68  AGQERFRAVTRSY 80



 Score = 70.1 bits (164), Expect = 8e-12
 Identities = 31/87 (35%), Positives = 53/87 (60%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G ++VYD+T   ++ ++ +W+ +     + +   +++GNK DL++QR V+ E 
Sbjct: 79  SYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEE 138

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
            +Q A E  + F+E SAK   NVE AF
Sbjct: 139 AKQFAEENGLLFLEASAKTGENVEDAF 165


>AF152463-1|AAF00150.1|  215|Homo sapiens RAB14 protein protein.
          Length = 215

 Score = 88.6 bits (210), Expect = 2e-17
 Identities = 38/73 (52%), Positives = 53/73 (72%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           Y  +FK ++IGD GVGK+ +L +F+E  F      TIG++F  R I++ G+K+KLQIWDT
Sbjct: 8   YSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDT 67

Query: 215 AGQERFRTITTAY 253
           AGQERFR +T +Y
Sbjct: 68  AGQERFRAVTRSY 80



 Score = 70.1 bits (164), Expect = 8e-12
 Identities = 31/87 (35%), Positives = 53/87 (60%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G ++VYD+T   ++ ++ +W+ +     + +   +++GNK DL++QR V+ E 
Sbjct: 79  SYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEE 138

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
            +Q A E  + F+E SAK   NVE AF
Sbjct: 139 AKQFAEENGLLFLEASAKTGENVEDAF 165


>AF112206-1|AAF17194.1|  215|Homo sapiens ras-related protein rab-14
           protein.
          Length = 215

 Score = 88.6 bits (210), Expect = 2e-17
 Identities = 38/73 (52%), Positives = 53/73 (72%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           Y  +FK ++IGD GVGK+ +L +F+E  F      TIG++F  R I++ G+K+KLQIWDT
Sbjct: 8   YSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDT 67

Query: 215 AGQERFRTITTAY 253
           AGQERFR +T +Y
Sbjct: 68  AGQERFRAVTRSY 80



 Score = 70.1 bits (164), Expect = 8e-12
 Identities = 31/87 (35%), Positives = 53/87 (60%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G ++VYD+T   ++ ++ +W+ +     + +   +++GNK DL++QR V+ E 
Sbjct: 79  SYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEE 138

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
            +Q A E  + F+E SAK   NVE AF
Sbjct: 139 AKQFAEENGLLFLEASAKTGENVEDAF 165


>X12953-1|CAA31411.1|  212|Homo sapiens protein ( Human rab2 mRNA,
           YPT1-related and member of ras family. ).
          Length = 212

 Score = 87.8 bits (208), Expect = 4e-17
 Identities = 39/73 (53%), Positives = 54/73 (73%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           Y  LFK ++IGD+GVGK+ +L +F++  F      TIG++F  R I +DGK++KLQIWDT
Sbjct: 3   YAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDT 62

Query: 215 AGQERFRTITTAY 253
           AGQE FR+IT +Y
Sbjct: 63  AGQESFRSITRSY 75



 Score = 85.4 bits (202), Expect = 2e-16
 Identities = 37/87 (42%), Positives = 61/87 (70%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G +LVYD+T   +F ++  W+ +  +++++++  M++GNK DL+S+R+V KE 
Sbjct: 74  SYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESRREVKKEE 133

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GE  A E+ + F+ETSAK + NVE AF
Sbjct: 134 GEAFAREHGLIFMETSAKTASNVEEAF 160


>M28213-1|AAA60241.1|  212|Homo sapiens GTP-binding protein protein.
          Length = 212

 Score = 87.8 bits (208), Expect = 4e-17
 Identities = 39/73 (53%), Positives = 54/73 (73%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           Y  LFK ++IGD+GVGK+ +L +F++  F      TIG++F  R I +DGK++KLQIWDT
Sbjct: 3   YAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDT 62

Query: 215 AGQERFRTITTAY 253
           AGQE FR+IT +Y
Sbjct: 63  AGQESFRSITRSY 75



 Score = 86.2 bits (204), Expect = 1e-16
 Identities = 37/87 (42%), Positives = 61/87 (70%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G +LVYD+T   +F ++  W+ +  +++++++  M++GNK DL+S+R+V KE 
Sbjct: 74  SYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESRREVKKEE 133

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GE  A E+ + F+ETSAK + NVE AF
Sbjct: 134 GEAFAREHGLMFMETSAKTASNVEEAF 160


>BT019695-1|AAV38501.1|  212|Homo sapiens RAB2, member RAS oncogene
           family protein.
          Length = 212

 Score = 87.8 bits (208), Expect = 4e-17
 Identities = 39/73 (53%), Positives = 54/73 (73%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           Y  LFK ++IGD+GVGK+ +L +F++  F      TIG++F  R I +DGK++KLQIWDT
Sbjct: 3   YAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDT 62

Query: 215 AGQERFRTITTAY 253
           AGQE FR+IT +Y
Sbjct: 63  AGQESFRSITRSY 75



 Score = 85.4 bits (202), Expect = 2e-16
 Identities = 37/87 (42%), Positives = 61/87 (70%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G +LVYD+T   +F ++  W+ +  +++++++  M++GNK DL+S+R+V KE 
Sbjct: 74  SYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESRREVKKEE 133

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GE  A E+ + F+ETSAK + NVE AF
Sbjct: 134 GEAFAREHGLIFMETSAKTASNVEEAF 160


>BC009714-1|AAH09714.1|  213|Homo sapiens RAB39B, member RAS
           oncogene family protein.
          Length = 213

 Score = 87.8 bits (208), Expect = 4e-17
 Identities = 36/86 (41%), Positives = 63/86 (73%), Gaps = 1/86 (1%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASA-DVEKMILGNKCDLDSQRQVSKERGE 432
           R S+G +L++D+TN +SF+N+  W+   + +     +  +++G+KCDLD+QRQV++   E
Sbjct: 80  RNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAE 139

Query: 433 QLAIEYQIKFVETSAKDSLNVEYAFS 510
           +LA  Y +K++ETSA+D++NVE AF+
Sbjct: 140 KLAAAYGMKYIETSARDAINVEKAFT 165



 Score = 82.6 bits (195), Expect = 1e-15
 Identities = 38/70 (54%), Positives = 54/70 (77%), Gaps = 1/70 (1%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLD-GKKVKLQIWDTAGQ 223
           F+L++IGDS VGK+ ++ RF+E  F      T+G+DF  R ++++ GK++KLQIWDTAGQ
Sbjct: 9   FRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQ 68

Query: 224 ERFRTITTAY 253
           ERFR+IT AY
Sbjct: 69  ERFRSITRAY 78


>BC008929-1|AAH08929.1|  212|Homo sapiens RAB2A, member RAS oncogene
           family protein.
          Length = 212

 Score = 87.8 bits (208), Expect = 4e-17
 Identities = 39/73 (53%), Positives = 54/73 (73%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           Y  LFK ++IGD+GVGK+ +L +F++  F      TIG++F  R I +DGK++KLQIWDT
Sbjct: 3   YAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDT 62

Query: 215 AGQERFRTITTAY 253
           AGQE FR+IT +Y
Sbjct: 63  AGQESFRSITRSY 75



 Score = 85.4 bits (202), Expect = 2e-16
 Identities = 37/87 (42%), Positives = 61/87 (70%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G +LVYD+T   +F ++  W+ +  +++++++  M++GNK DL+S+R+V KE 
Sbjct: 74  SYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESRREVKKEE 133

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GE  A E+ + F+ETSAK + NVE AF
Sbjct: 134 GEAFAREHGLIFMETSAKTASNVEEAF 160


>AY052478-1|AAL12244.1|  213|Homo sapiens RAB39 protein.
          Length = 213

 Score = 87.8 bits (208), Expect = 4e-17
 Identities = 36/86 (41%), Positives = 63/86 (73%), Gaps = 1/86 (1%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASA-DVEKMILGNKCDLDSQRQVSKERGE 432
           R S+G +L++D+TN +SF+N+  W+   + +     +  +++G+KCDLD+QRQV++   E
Sbjct: 80  RNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAE 139

Query: 433 QLAIEYQIKFVETSAKDSLNVEYAFS 510
           +LA  Y +K++ETSA+D++NVE AF+
Sbjct: 140 KLAAAYGMKYIETSARDAINVEKAFT 165



 Score = 81.4 bits (192), Expect = 3e-15
 Identities = 38/70 (54%), Positives = 53/70 (75%), Gaps = 1/70 (1%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLD-GKKVKLQIWDTAGQ 223
           F+L++IGDS VGK+ ++ RF+E  F      T+G+DF  R ++++ GK +KLQIWDTAGQ
Sbjct: 9   FRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKTIKLQIWDTAGQ 68

Query: 224 ERFRTITTAY 253
           ERFR+IT AY
Sbjct: 69  ERFRSITRAY 78


>AL356738-7|CAI41468.1|  213|Homo sapiens RAB39B, member RAS
           oncogene family protein.
          Length = 213

 Score = 87.8 bits (208), Expect = 4e-17
 Identities = 36/86 (41%), Positives = 63/86 (73%), Gaps = 1/86 (1%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASA-DVEKMILGNKCDLDSQRQVSKERGE 432
           R S+G +L++D+TN +SF+N+  W+   + +     +  +++G+KCDLD+QRQV++   E
Sbjct: 80  RNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAE 139

Query: 433 QLAIEYQIKFVETSAKDSLNVEYAFS 510
           +LA  Y +K++ETSA+D++NVE AF+
Sbjct: 140 KLAAAYGMKYIETSARDAINVEKAFT 165



 Score = 82.6 bits (195), Expect = 1e-15
 Identities = 38/70 (54%), Positives = 54/70 (77%), Gaps = 1/70 (1%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLD-GKKVKLQIWDTAGQ 223
           F+L++IGDS VGK+ ++ RF+E  F      T+G+DF  R ++++ GK++KLQIWDTAGQ
Sbjct: 9   FRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQ 68

Query: 224 ERFRTITTAY 253
           ERFR+IT AY
Sbjct: 69  ERFRSITRAY 78


>AF498930-1|AAM21078.1|  212|Homo sapiens small GTP binding protein
           RAB2A protein.
          Length = 212

 Score = 87.8 bits (208), Expect = 4e-17
 Identities = 39/73 (53%), Positives = 54/73 (73%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           Y  LFK ++IGD+GVGK+ +L +F++  F      TIG++F  R I +DGK++KLQIWDT
Sbjct: 3   YAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDT 62

Query: 215 AGQERFRTITTAY 253
           AGQE FR+IT +Y
Sbjct: 63  AGQESFRSITRSY 75



 Score = 85.4 bits (202), Expect = 2e-16
 Identities = 37/87 (42%), Positives = 61/87 (70%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G +LVYD+T   +F ++  W+ +  +++++++  M++GNK DL+S+R+V KE 
Sbjct: 74  SYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESRREVKKEE 133

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GE  A E+ + F+ETSAK + NVE AF
Sbjct: 134 GEAFAREHGLIFMETSAKTASNVEEAF 160


>BC066366-1|AAH66366.1|  151|Homo sapiens RAB2B protein protein.
          Length = 151

 Score = 87.4 bits (207), Expect = 5e-17
 Identities = 38/90 (42%), Positives = 64/90 (71%)
 Frame = +1

Query: 238 NNNSILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVS 417
           N  S +RG+ G +LVYD+T  ++F ++ +W+ +  +++S+++  M++GNK DL+S+R V 
Sbjct: 6   NCKSGIRGAAGALLVYDITRRETFNHLTSWLEDARQHSSSNMVIMLIGNKSDLESRRDVK 65

Query: 418 KERGEQLAIEYQIKFVETSAKDSLNVEYAF 507
           +E GE  A E+ + F+ETSAK + NVE AF
Sbjct: 66  REEGEAFAREHGLIFMETSAKTACNVEEAF 95


>AK027730-1|BAB55326.1|  148|Homo sapiens protein ( Homo sapiens
           cDNA FLJ14824 fis, clone OVARC1000771, moderately
           similar to RAS-RELATED PROTEIN RAB-2. ).
          Length = 148

 Score = 87.4 bits (207), Expect = 5e-17
 Identities = 38/90 (42%), Positives = 64/90 (71%)
 Frame = +1

Query: 238 NNNSILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVS 417
           N  S +RG+ G +LVYD+T  ++F ++ +W+ +  +++S+++  M++GNK DL+S+R V 
Sbjct: 6   NCKSGIRGAAGALLVYDITRRETFNHLTSWLEDARQHSSSNMVIMLIGNKSDLESRRDVK 65

Query: 418 KERGEQLAIEYQIKFVETSAKDSLNVEYAF 507
           +E GE  A E+ + F+ETSAK + NVE AF
Sbjct: 66  REEGEAFAREHGLIFMETSAKTACNVEEAF 95


>U57094-1|AAC51195.1|  221|Homo sapiens Rab27a protein.
          Length = 221

 Score = 86.6 bits (205), Expect = 9e-17
 Identities = 40/83 (48%), Positives = 59/83 (71%), Gaps = 10/83 (12%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDL----------DG 184
           YD L K L +GDSGVGKTS+L+++++  FN  FI+T+GIDF+ + +             G
Sbjct: 6   YDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFRPKRVVYRASGPDGPVGRG 65

Query: 185 KKVKLQIWDTAGQERFRTITTAY 253
           +++ LQ+WDTAGQERFR++TTA+
Sbjct: 66  QRIHLQLWDTAGQERFRSLTTAF 88



 Score = 75.4 bits (177), Expect = 2e-13
 Identities = 35/90 (38%), Positives = 57/90 (63%), Gaps = 1/90 (1%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMIL-GNKCDLDSQRQVSKE 423
           +  R +MG +L++D+TNE+SF N++NWI  ++ +A  +   ++L GNK DL+ QR V +E
Sbjct: 87  AFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEE 146

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAFSL 513
               LA +Y I + ETSA +  N+  A  +
Sbjct: 147 EAIALAEKYGIPYFETSAANGTNISQAIEM 176


>U38654-1|AAC50271.2|  221|Homo sapiens Rab27a protein.
          Length = 221

 Score = 86.6 bits (205), Expect = 9e-17
 Identities = 40/83 (48%), Positives = 59/83 (71%), Gaps = 10/83 (12%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDL----------DG 184
           YD L K L +GDSGVGKTS+L+++++  FN  FI+T+GIDF+ + +             G
Sbjct: 6   YDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRG 65

Query: 185 KKVKLQIWDTAGQERFRTITTAY 253
           +++ LQ+WDTAGQERFR++TTA+
Sbjct: 66  QRIHLQLWDTAGQERFRSLTTAF 88



 Score = 75.4 bits (177), Expect = 2e-13
 Identities = 35/90 (38%), Positives = 57/90 (63%), Gaps = 1/90 (1%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMIL-GNKCDLDSQRQVSKE 423
           +  R +MG +L++D+TNE+SF N++NWI  ++ +A  +   ++L GNK DL+ QR V +E
Sbjct: 87  AFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEE 146

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAFSL 513
               LA +Y I + ETSA +  N+  A  +
Sbjct: 147 EAIALAEKYGIPYFETSAANGTNISQAIEM 176


>CR541693-1|CAG46494.1|  221|Homo sapiens RAB27A protein.
          Length = 221

 Score = 86.6 bits (205), Expect = 9e-17
 Identities = 40/83 (48%), Positives = 59/83 (71%), Gaps = 10/83 (12%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDL----------DG 184
           YD L K L +GDSGVGKTS+L+++++  FN  FI+T+GIDF+ + +             G
Sbjct: 6   YDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRG 65

Query: 185 KKVKLQIWDTAGQERFRTITTAY 253
           +++ LQ+WDTAGQERFR++TTA+
Sbjct: 66  QRIHLQLWDTAGQERFRSLTTAF 88



 Score = 75.4 bits (177), Expect = 2e-13
 Identities = 35/90 (38%), Positives = 57/90 (63%), Gaps = 1/90 (1%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMIL-GNKCDLDSQRQVSKE 423
           +  R +MG +L++D+TNE+SF N++NWI  ++ +A  +   ++L GNK DL+ QR V +E
Sbjct: 87  AFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEE 146

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAFSL 513
               LA +Y I + ETSA +  N+  A  +
Sbjct: 147 EAIALAEKYGIPYFETSAANGTNISQAIEM 176


>CR536496-1|CAG38735.1|  221|Homo sapiens RAB27A protein.
          Length = 221

 Score = 86.6 bits (205), Expect = 9e-17
 Identities = 40/83 (48%), Positives = 59/83 (71%), Gaps = 10/83 (12%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDL----------DG 184
           YD L K L +GDSGVGKTS+L+++++  FN  FI+T+GIDF+ + +             G
Sbjct: 6   YDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRG 65

Query: 185 KKVKLQIWDTAGQERFRTITTAY 253
           +++ LQ+WDTAGQERFR++TTA+
Sbjct: 66  QRIHLQLWDTAGQERFRSLTTAF 88



 Score = 75.4 bits (177), Expect = 2e-13
 Identities = 35/90 (38%), Positives = 57/90 (63%), Gaps = 1/90 (1%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMIL-GNKCDLDSQRQVSKE 423
           +  R +MG +L++D+TNE+SF N++NWI  ++ +A  +   ++L GNK DL+ QR V +E
Sbjct: 87  AFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEE 146

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAFSL 513
               LA +Y I + ETSA +  N+  A  +
Sbjct: 147 EAIALAEKYGIPYFETSAANGTNISQAIEM 176


>BC132800-1|AAI32801.1|  221|Homo sapiens RAB27A, member RAS
           oncogene family protein.
          Length = 221

 Score = 86.6 bits (205), Expect = 9e-17
 Identities = 40/83 (48%), Positives = 59/83 (71%), Gaps = 10/83 (12%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDL----------DG 184
           YD L K L +GDSGVGKTS+L+++++  FN  FI+T+GIDF+ + +             G
Sbjct: 6   YDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRG 65

Query: 185 KKVKLQIWDTAGQERFRTITTAY 253
           +++ LQ+WDTAGQERFR++TTA+
Sbjct: 66  QRIHLQLWDTAGQERFRSLTTAF 88



 Score = 75.4 bits (177), Expect = 2e-13
 Identities = 35/90 (38%), Positives = 57/90 (63%), Gaps = 1/90 (1%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMIL-GNKCDLDSQRQVSKE 423
           +  R +MG +L++D+TNE+SF N++NWI  ++ +A  +   ++L GNK DL+ QR V +E
Sbjct: 87  AFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEE 146

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAFSL 513
               LA +Y I + ETSA +  N+  A  +
Sbjct: 147 EAIALAEKYGIPYFETSAANGTNISQAIEM 176


>BC107680-1|AAI07681.1|  221|Homo sapiens RAB27A, member RAS
           oncogene family protein.
          Length = 221

 Score = 86.6 bits (205), Expect = 9e-17
 Identities = 40/83 (48%), Positives = 59/83 (71%), Gaps = 10/83 (12%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDL----------DG 184
           YD L K L +GDSGVGKTS+L+++++  FN  FI+T+GIDF+ + +             G
Sbjct: 6   YDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRG 65

Query: 185 KKVKLQIWDTAGQERFRTITTAY 253
           +++ LQ+WDTAGQERFR++TTA+
Sbjct: 66  QRIHLQLWDTAGQERFRSLTTAF 88



 Score = 75.4 bits (177), Expect = 2e-13
 Identities = 35/90 (38%), Positives = 57/90 (63%), Gaps = 1/90 (1%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMIL-GNKCDLDSQRQVSKE 423
           +  R +MG +L++D+TNE+SF N++NWI  ++ +A  +   ++L GNK DL+ QR V +E
Sbjct: 87  AFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEE 146

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAFSL 513
               LA +Y I + ETSA +  N+  A  +
Sbjct: 147 EAIALAEKYGIPYFETSAANGTNISQAIEM 176


>AF498953-1|AAM21101.1|  221|Homo sapiens small GTP binding protein
           RAB27A protein.
          Length = 221

 Score = 86.6 bits (205), Expect = 9e-17
 Identities = 40/83 (48%), Positives = 59/83 (71%), Gaps = 10/83 (12%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDL----------DG 184
           YD L K L +GDSGVGKTS+L+++++  FN  FI+T+GIDF+ + +             G
Sbjct: 6   YDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRG 65

Query: 185 KKVKLQIWDTAGQERFRTITTAY 253
           +++ LQ+WDTAGQERFR++TTA+
Sbjct: 66  QRIHLQLWDTAGQERFRSLTTAF 88



 Score = 75.4 bits (177), Expect = 2e-13
 Identities = 35/90 (38%), Positives = 57/90 (63%), Gaps = 1/90 (1%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMIL-GNKCDLDSQRQVSKE 423
           +  R +MG +L++D+TNE+SF N++NWI  ++ +A  +   ++L GNK DL+ QR V +E
Sbjct: 87  AFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEE 146

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAFSL 513
               LA +Y I + ETSA +  N+  A  +
Sbjct: 147 EAIALAEKYGIPYFETSAANGTNISQAIEM 176


>AF443871-1|AAL39097.1|  221|Homo sapiens Ras-like GTP-binding
           protein protein.
          Length = 221

 Score = 86.6 bits (205), Expect = 9e-17
 Identities = 40/83 (48%), Positives = 59/83 (71%), Gaps = 10/83 (12%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDL----------DG 184
           YD L K L +GDSGVGKTS+L+++++  FN  FI+T+GIDF+ + +             G
Sbjct: 6   YDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRG 65

Query: 185 KKVKLQIWDTAGQERFRTITTAY 253
           +++ LQ+WDTAGQERFR++TTA+
Sbjct: 66  QRIHLQLWDTAGQERFRSLTTAF 88



 Score = 75.4 bits (177), Expect = 2e-13
 Identities = 35/90 (38%), Positives = 57/90 (63%), Gaps = 1/90 (1%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMIL-GNKCDLDSQRQVSKE 423
           +  R +MG +L++D+TNE+SF N++NWI  ++ +A  +   ++L GNK DL+ QR V +E
Sbjct: 87  AFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEE 146

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAFSL 513
               LA +Y I + ETSA +  N+  A  +
Sbjct: 147 EAIALAEKYGIPYFETSAANGTNISQAIEM 176


>AF154840-1|AAD47629.1|  221|Homo sapiens Ras-like GTP-binding
           protein protein.
          Length = 221

 Score = 86.6 bits (205), Expect = 9e-17
 Identities = 40/83 (48%), Positives = 59/83 (71%), Gaps = 10/83 (12%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDL----------DG 184
           YD L K L +GDSGVGKTS+L+++++  FN  FI+T+GIDF+ + +             G
Sbjct: 6   YDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRG 65

Query: 185 KKVKLQIWDTAGQERFRTITTAY 253
           +++ LQ+WDTAGQERFR++TTA+
Sbjct: 66  QRIHLQLWDTAGQERFRSLTTAF 88



 Score = 75.4 bits (177), Expect = 2e-13
 Identities = 35/90 (38%), Positives = 57/90 (63%), Gaps = 1/90 (1%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMIL-GNKCDLDSQRQVSKE 423
           +  R +MG +L++D+TNE+SF N++NWI  ++ +A  +   ++L GNK DL+ QR V +E
Sbjct: 87  AFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEE 146

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAFSL 513
               LA +Y I + ETSA +  N+  A  +
Sbjct: 147 EAIALAEKYGIPYFETSAANGTNISQAIEM 176


>AF125393-1|AAD43049.1|  213|Homo sapiens Rab27 isoform protein.
          Length = 213

 Score = 86.6 bits (205), Expect = 9e-17
 Identities = 40/83 (48%), Positives = 59/83 (71%), Gaps = 10/83 (12%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDL----------DG 184
           YD L K L +GDSGVGKTS+L+++++  FN  FI+T+GIDF+ + +             G
Sbjct: 6   YDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFRPKRVVYRASGPDGPVGRG 65

Query: 185 KKVKLQIWDTAGQERFRTITTAY 253
           +++ LQ+WDTAGQERFR++TTA+
Sbjct: 66  QRIHLQLWDTAGQERFRSLTTAF 88



 Score = 63.3 bits (147), Expect = 9e-10
 Identities = 34/90 (37%), Positives = 55/90 (61%), Gaps = 1/90 (1%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMIL-GNKCDLDSQRQVSKE 423
           +  R +MG +L++D+TNE+SF N++NWI  ++ +A  +   ++L GNK DL+ QR V KE
Sbjct: 87  AFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQR-VVKE 145

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAFSL 513
           +       Y I + ETSA +  N+  A  +
Sbjct: 146 K-------YGIPYFETSAANGTNISQAIEM 168


>BC033322-1|AAH33322.1|  213|Homo sapiens RAB25, member RAS oncogene
           family protein.
          Length = 213

 Score = 85.8 bits (203), Expect = 1e-16
 Identities = 39/73 (53%), Positives = 55/73 (75%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           Y+ +FK++LIG+SGVGKT++L RF+ + F+    +TIG++F  RT+ L    VK QIWDT
Sbjct: 9   YNFVFKVVLIGESGVGKTNLLSRFTRNEFSHDSRTTIGVEFSTRTVMLGTAAVKAQIWDT 68

Query: 215 AGQERFRTITTAY 253
           AG ER+R IT+AY
Sbjct: 69  AGLERYRAITSAY 81



 Score = 73.3 bits (172), Expect = 8e-13
 Identities = 32/84 (38%), Positives = 53/84 (63%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG++G +LV+D+T  +++  ++ W++ + ++A A +  M++GNK DL   R+V  E    
Sbjct: 83  RGAVGALLVFDLTKHQTYAVVERWLKELYDHAEATIVVMLVGNKSDLSQAREVPTEEARM 142

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A    + F+ETSA DS NVE AF
Sbjct: 143 FAENNGLLFLETSALDSTNVELAF 166


>BC009831-1|AAH09831.1|  213|Homo sapiens RAB25, member RAS oncogene
           family protein.
          Length = 213

 Score = 85.8 bits (203), Expect = 1e-16
 Identities = 39/73 (53%), Positives = 55/73 (75%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           Y+ +FK++LIG+SGVGKT++L RF+ + F+    +TIG++F  RT+ L    VK QIWDT
Sbjct: 9   YNFVFKVVLIGESGVGKTNLLSRFTRNEFSHDSRTTIGVEFSTRTVMLGTAAVKAQIWDT 68

Query: 215 AGQERFRTITTAY 253
           AG ER+R IT+AY
Sbjct: 69  AGLERYRAITSAY 81



 Score = 73.3 bits (172), Expect = 8e-13
 Identities = 32/84 (38%), Positives = 53/84 (63%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG++G +LV+D+T  +++  ++ W++ + ++A A +  M++GNK DL   R+V  E    
Sbjct: 83  RGAVGALLVFDLTKHQTYAVVERWLKELYDHAEATIVVMLVGNKSDLSQAREVPTEEARM 142

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A    + F+ETSA DS NVE AF
Sbjct: 143 FAENNGLLFLETSALDSTNVELAF 166


>AL355388-18|CAH72638.1|  213|Homo sapiens RAB25, member RAS
           oncogene family protein.
          Length = 213

 Score = 85.8 bits (203), Expect = 1e-16
 Identities = 39/73 (53%), Positives = 55/73 (75%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           Y+ +FK++LIG+SGVGKT++L RF+ + F+    +TIG++F  RT+ L    VK QIWDT
Sbjct: 9   YNFVFKVVLIGESGVGKTNLLSRFTRNEFSHDSRTTIGVEFSTRTVMLGTAAVKAQIWDT 68

Query: 215 AGQERFRTITTAY 253
           AG ER+R IT+AY
Sbjct: 69  AGLERYRAITSAY 81



 Score = 73.3 bits (172), Expect = 8e-13
 Identities = 32/84 (38%), Positives = 53/84 (63%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG++G +LV+D+T  +++  ++ W++ + ++A A +  M++GNK DL   R+V  E    
Sbjct: 83  RGAVGALLVFDLTKHQTYAVVERWLKELYDHAEATIVVMLVGNKSDLSQAREVPTEEARM 142

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A    + F+ETSA DS NVE AF
Sbjct: 143 FAENNGLLFLETSALDSTNVELAF 166


>AF274025-1|AAM69362.1|  217|Homo sapiens GTP-binding protein Rab25
           protein.
          Length = 217

 Score = 85.8 bits (203), Expect = 1e-16
 Identities = 39/73 (53%), Positives = 55/73 (75%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           Y+ +FK++LIG+SGVGKT++L RF+ + F+    +TIG++F  RT+ L    VK QIWDT
Sbjct: 13  YNFVFKVVLIGESGVGKTNLLSRFTRNEFSHDSRTTIGVEFSTRTVMLGTAAVKAQIWDT 72

Query: 215 AGQERFRTITTAY 253
           AG ER+R IT+AY
Sbjct: 73  AGLERYRAITSAY 85



 Score = 73.3 bits (172), Expect = 8e-13
 Identities = 32/84 (38%), Positives = 53/84 (63%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG++G +LV+D+T  +++  ++ W++ + ++A A +  M++GNK DL   R+V  E    
Sbjct: 87  RGAVGALLVFDLTKHQTYAVVERWLKELYDHAEATIVVMLVGNKSDLSQAREVPTEEARM 146

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A    + F+ETSA DS NVE AF
Sbjct: 147 FAENNGLLFLETSALDSTNVELAF 170


>AF083124-1|AAF98238.1|  256|Homo sapiens unknown protein.
          Length = 256

 Score = 85.8 bits (203), Expect = 1e-16
 Identities = 39/73 (53%), Positives = 55/73 (75%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           Y+ +FK++LIG+SGVGKT++L RF+ + F+    +TIG++F  RT+ L    VK QIWDT
Sbjct: 9   YNFVFKVVLIGESGVGKTNLLSRFTRNEFSHDSRTTIGVEFSTRTVMLGTAAVKAQIWDT 68

Query: 215 AGQERFRTITTAY 253
           AG ER+R IT+AY
Sbjct: 69  AGLERYRAITSAY 81



 Score = 73.3 bits (172), Expect = 8e-13
 Identities = 32/84 (38%), Positives = 53/84 (63%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG++G +LV+D+T  +++  ++ W++ + ++A A +  M++GNK DL   R+V  E    
Sbjct: 83  RGAVGALLVFDLTKHQTYAVVERWLKELYDHAEATIVVMLVGNKSDLSQAREVPTEEARM 142

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A    + F+ETSA DS NVE AF
Sbjct: 143 FAENNGLLFLETSALDSTNVELAF 166


>BC028064-1|AAH28064.1|  217|Homo sapiens RAB39, member RAS oncogene
           family protein.
          Length = 217

 Score = 85.4 bits (202), Expect = 2e-16
 Identities = 38/90 (42%), Positives = 64/90 (71%), Gaps = 1/90 (1%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASA-DVEKMILGNKCDLDSQRQVSKE 423
           S  R S+G  LV+D+TN +SFE++K+W+   +       +  +++G+KCDL SQRQV++E
Sbjct: 81  SYYRNSVGGFLVFDITNRRSFEHVKDWLEEAKMYVQPFRIVFLLVGHKCDLASQRQVTRE 140

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAFSL 513
             E+L+ +  +K++ETSAKD+ NVE +F++
Sbjct: 141 EAEKLSADCGMKYIETSAKDATNVEESFTI 170



 Score = 76.2 bits (179), Expect = 1e-13
 Identities = 36/74 (48%), Positives = 56/74 (75%), Gaps = 5/74 (6%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAF----NISFISTIGIDFKIRTIDLD-GKKVKLQIWD 211
           F+L++IGDS VGK+ +L RF++  F    + +   T+G+DF  R ++++ GK++KLQ+WD
Sbjct: 9   FRLIVIGDSTVGKSCLLHRFTQGRFPGLRSPACDPTVGVDFFSRLLEIEPGKRIKLQLWD 68

Query: 212 TAGQERFRTITTAY 253
           TAGQERFR+IT +Y
Sbjct: 69  TAGQERFRSITRSY 82


>CR457076-1|CAG33357.1|  221|Homo sapiens RAB27A protein.
          Length = 221

 Score = 85.0 bits (201), Expect = 3e-16
 Identities = 39/83 (46%), Positives = 58/83 (69%), Gaps = 10/83 (12%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDL----------DG 184
           YD L K L +GDSGVGKTS+L+++++  FN  FI+T+GIDF+ + +             G
Sbjct: 6   YDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRG 65

Query: 185 KKVKLQIWDTAGQERFRTITTAY 253
           +++ LQ+WDTAGQERFR++TT +
Sbjct: 66  QRIHLQLWDTAGQERFRSLTTTF 88



 Score = 75.4 bits (177), Expect = 2e-13
 Identities = 35/90 (38%), Positives = 57/90 (63%), Gaps = 1/90 (1%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMIL-GNKCDLDSQRQVSKE 423
           +  R +MG +L++D+TNE+SF N++NWI  ++ +A  +   ++L GNK DL+ QR V +E
Sbjct: 87  TFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEE 146

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAFSL 513
               LA +Y I + ETSA +  N+  A  +
Sbjct: 147 EAIALAEKYGIPYFETSAANGTNISQAIEM 176


>AF217985-1|AAG17228.1|  248|Homo sapiens unknown protein.
          Length = 248

 Score = 85.0 bits (201), Expect = 3e-16
 Identities = 38/72 (52%), Positives = 52/72 (72%)
 Frame = +2

Query: 38  DCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTA 217
           D LFK L+IG +G GK+ +L +F E+ F      TIG++F  R +++ GK VKLQIWDTA
Sbjct: 41  DFLFKFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGVEFGSRVVNVGGKTVKLQIWDTA 100

Query: 218 GQERFRTITTAY 253
           GQERFR++T +Y
Sbjct: 101 GQERFRSVTRSY 112



 Score = 68.1 bits (159), Expect = 3e-11
 Identities = 32/87 (36%), Positives = 54/87 (62%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G +LVYD+T+ +++ ++  W+ +    AS ++  ++ GNK DLD +R+V+   
Sbjct: 111 SYYRGAAGALLVYDITSRETYNSLAAWLTDARTLASPNIVVILCGNKKDLDPEREVTFLE 170

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
             + A E ++ F+ETSA    NVE AF
Sbjct: 171 ASRFAQENELMFLETSALTGENVEEAF 197


>AF087861-1|AAP97171.1|  213|Homo sapiens rab4b protein.
          Length = 213

 Score = 85.0 bits (201), Expect = 3e-16
 Identities = 39/77 (50%), Positives = 54/77 (70%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           MA+    LFK L+IG +G GK+ +L +F E+ F      TIG++F  R +++ GK VKLQ
Sbjct: 1   MAEDRHFLFKFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGVEFGSRVVNVGGKTVKLQ 60

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFR++T +Y
Sbjct: 61  IWDTAGQERFRSVTRSY 77



 Score = 68.1 bits (159), Expect = 3e-11
 Identities = 32/87 (36%), Positives = 54/87 (62%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G +LVYD+T+ +++ ++  W+ +    AS ++  ++ GNK DLD +R+V+   
Sbjct: 76  SYYRGAAGALLVYDITSRETYNSLAAWLTDARTLASPNIVVILCGNKKDLDPEREVTFLE 135

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
             + A E ++ F+ETSA    NVE AF
Sbjct: 136 ASRFAQENELMFLETSALTGENVEEAF 162


>D14889-1|BAA03606.1|  237|Homo sapiens small GTP-binding protein
           S10 protein.
          Length = 237

 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 34/64 (53%), Positives = 51/64 (79%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           +FK+++IGDS VGKT + FRF    F     +TIG+DF+ +T++++G+K+K+Q+WDTAGQ
Sbjct: 36  IFKIIVIGDSNVGKTCLTFRFCGGTFPDKTEATIGVDFREKTVEIEGEKIKVQVWDTAGQ 95

Query: 224 ERFR 235
           ERFR
Sbjct: 96  ERFR 99



 Score = 59.3 bits (137), Expect = 1e-08
 Identities = 36/88 (40%), Positives = 47/88 (53%), Gaps = 4/88 (4%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASAD-VEKMILGNKCDLDSQRQVSKERGE 432
           R    ++ VYDVT   SF N+K WI+    +A    V K+++GNKCDL  Q QV      
Sbjct: 108 RNVHAVVFVYDVTKMTSFTNLKMWIQECNGHAVPPLVPKVLVGNKCDLREQIQVPSNLAL 167

Query: 433 QLAIEYQIKFVETSAKD---SLNVEYAF 507
           + A  + +   ETSAKD   S NVE  F
Sbjct: 168 KFADAHNMLLFETSAKDPKESQNVESIF 195


>BT007038-1|AAP35687.1|  237|Homo sapiens RAB33A, member RAS
           oncogene family protein.
          Length = 237

 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 34/64 (53%), Positives = 51/64 (79%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           +FK+++IGDS VGKT + FRF    F     +TIG+DF+ +T++++G+K+K+Q+WDTAGQ
Sbjct: 36  IFKIIVIGDSNVGKTCLTFRFCGGTFPDKTEATIGVDFREKTVEIEGEKIKVQVWDTAGQ 95

Query: 224 ERFR 235
           ERFR
Sbjct: 96  ERFR 99



 Score = 59.3 bits (137), Expect = 1e-08
 Identities = 36/88 (40%), Positives = 47/88 (53%), Gaps = 4/88 (4%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASAD-VEKMILGNKCDLDSQRQVSKERGE 432
           R    ++ VYDVT   SF N+K WI+    +A    V K+++GNKCDL  Q QV      
Sbjct: 108 RNVHAVVFVYDVTKMTSFTNLKMWIQECNGHAVPPLVPKVLVGNKCDLREQIQVPSNLAL 167

Query: 433 QLAIEYQIKFVETSAKD---SLNVEYAF 507
           + A  + +   ETSAKD   S NVE  F
Sbjct: 168 KFADAHNMLLFETSAKDPKESQNVESIF 195


>BC009996-1|AAH09996.1|  237|Homo sapiens RAB33A, member RAS
           oncogene family protein.
          Length = 237

 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 34/64 (53%), Positives = 51/64 (79%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           +FK+++IGDS VGKT + FRF    F     +TIG+DF+ +T++++G+K+K+Q+WDTAGQ
Sbjct: 36  IFKIIVIGDSNVGKTCLTFRFCGGTFPDKTEATIGVDFREKTVEIEGEKIKVQVWDTAGQ 95

Query: 224 ERFR 235
           ERFR
Sbjct: 96  ERFR 99



 Score = 59.3 bits (137), Expect = 1e-08
 Identities = 36/88 (40%), Positives = 47/88 (53%), Gaps = 4/88 (4%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASAD-VEKMILGNKCDLDSQRQVSKERGE 432
           R    ++ VYDVT   SF N+K WI+    +A    V K+++GNKCDL  Q QV      
Sbjct: 108 RNVHAVVFVYDVTKMTSFTNLKMWIQECNGHAVPPLVPKVLVGNKCDLREQIQVPSNLAL 167

Query: 433 QLAIEYQIKFVETSAKD---SLNVEYAF 507
           + A  + +   ETSAKD   S NVE  F
Sbjct: 168 KFADAHNMLLFETSAKDPKESQNVESIF 195


>BC001157-1|AAH01157.1|  237|Homo sapiens RAB33A, member RAS
           oncogene family protein.
          Length = 237

 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 34/64 (53%), Positives = 51/64 (79%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           +FK+++IGDS VGKT + FRF    F     +TIG+DF+ +T++++G+K+K+Q+WDTAGQ
Sbjct: 36  IFKIIVIGDSNVGKTCLTFRFCGGTFPDKTEATIGVDFREKTVEIEGEKIKVQVWDTAGQ 95

Query: 224 ERFR 235
           ERFR
Sbjct: 96  ERFR 99



 Score = 59.3 bits (137), Expect = 1e-08
 Identities = 36/88 (40%), Positives = 47/88 (53%), Gaps = 4/88 (4%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASAD-VEKMILGNKCDLDSQRQVSKERGE 432
           R    ++ VYDVT   SF N+K WI+    +A    V K+++GNKCDL  Q QV      
Sbjct: 108 RNVHAVVFVYDVTKMTSFTNLKMWIQECNGHAVPPLVPKVLVGNKCDLREQIQVPSNLAL 167

Query: 433 QLAIEYQIKFVETSAKD---SLNVEYAF 507
           + A  + +   ETSAKD   S NVE  F
Sbjct: 168 KFADAHNMLLFETSAKDPKESQNVESIF 195


>AL139234-4|CAI42781.1|  237|Homo sapiens RAB33A, member RAS
           oncogene family protein.
          Length = 237

 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 34/64 (53%), Positives = 51/64 (79%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           +FK+++IGDS VGKT + FRF    F     +TIG+DF+ +T++++G+K+K+Q+WDTAGQ
Sbjct: 36  IFKIIVIGDSNVGKTCLTFRFCGGTFPDKTEATIGVDFREKTVEIEGEKIKVQVWDTAGQ 95

Query: 224 ERFR 235
           ERFR
Sbjct: 96  ERFR 99



 Score = 59.3 bits (137), Expect = 1e-08
 Identities = 36/88 (40%), Positives = 47/88 (53%), Gaps = 4/88 (4%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASAD-VEKMILGNKCDLDSQRQVSKERGE 432
           R    ++ VYDVT   SF N+K WI+    +A    V K+++GNKCDL  Q QV      
Sbjct: 108 RNVHAVVFVYDVTKMTSFTNLKMWIQECNGHAVPPLVPKVLVGNKCDLREQIQVPSNLAL 167

Query: 433 QLAIEYQIKFVETSAKD---SLNVEYAF 507
           + A  + +   ETSAKD   S NVE  F
Sbjct: 168 KFADAHNMLLFETSAKDPKESQNVESIF 195


>AF498959-1|AAM21107.1|  237|Homo sapiens small GTP binding protein
           RAB33A protein.
          Length = 237

 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 34/64 (53%), Positives = 51/64 (79%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           +FK+++IGDS VGKT + FRF    F     +TIG+DF+ +T++++G+K+K+Q+WDTAGQ
Sbjct: 36  IFKIIVIGDSNVGKTCLTFRFCGGTFPDKTEATIGVDFREKTVEIEGEKIKVQVWDTAGQ 95

Query: 224 ERFR 235
           ERFR
Sbjct: 96  ERFR 99



 Score = 59.3 bits (137), Expect = 1e-08
 Identities = 36/88 (40%), Positives = 47/88 (53%), Gaps = 4/88 (4%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASAD-VEKMILGNKCDLDSQRQVSKERGE 432
           R    ++ VYDVT   SF N+K WI+    +A    V K+++GNKCDL  Q QV      
Sbjct: 108 RNVHAVVFVYDVTKMTSFTNLKMWIQECNGHAVPPLVPKVLVGNKCDLREQIQVPSNLAL 167

Query: 433 QLAIEYQIKFVETSAKD---SLNVEYAF 507
           + A  + +   ETSAKD   S NVE  F
Sbjct: 168 KFADAHNMLLFETSAKDPKESQNVESIF 195


>M28212-1|AAA60246.1|  208|Homo sapiens GTP-binding protein protein.
          Length = 208

 Score = 82.6 bits (195), Expect = 1e-15
 Identities = 35/69 (50%), Positives = 54/69 (78%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           FKL+ +G+  VGKTS++ RF  D+F+ ++ +TIGIDF  +T+ L+ + V+LQ+WDTAGQE
Sbjct: 14  FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQE 73

Query: 227 RFRTITTAY 253
           RFR++  +Y
Sbjct: 74  RFRSLIPSY 82



 Score = 77.8 bits (183), Expect = 4e-14
 Identities = 38/87 (43%), Positives = 53/87 (60%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S +R S   ++VYD+TN  SF+    WI ++     +DV  M++GNK DL  +RQVS E 
Sbjct: 81  SYIRDSTVAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEE 140

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GE+ A E  + F+ETSAK   NV+  F
Sbjct: 141 GERKAKELNVMFIETSAKAGYNVKQLF 167


>BT019698-1|AAV38504.1|  208|Homo sapiens RAB6A, member RAS oncogene
           family protein.
          Length = 208

 Score = 82.6 bits (195), Expect = 1e-15
 Identities = 35/69 (50%), Positives = 54/69 (78%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           FKL+ +G+  VGKTS++ RF  D+F+ ++ +TIGIDF  +T+ L+ + V+LQ+WDTAGQE
Sbjct: 14  FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQE 73

Query: 227 RFRTITTAY 253
           RFR++  +Y
Sbjct: 74  RFRSLIPSY 82



 Score = 77.8 bits (183), Expect = 4e-14
 Identities = 38/87 (43%), Positives = 53/87 (60%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S +R S   ++VYD+TN  SF+    WI ++     +DV  M++GNK DL  +RQVS E 
Sbjct: 81  SYIRDSTVAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEE 140

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GE+ A E  + F+ETSAK   NV+  F
Sbjct: 141 GERKAKELNVMFIETSAKAGYNVKQLF 167


>BT007263-1|AAP35927.1|  208|Homo sapiens RAB6B, member RAS oncogene
           family protein.
          Length = 208

 Score = 82.6 bits (195), Expect = 1e-15
 Identities = 35/69 (50%), Positives = 54/69 (78%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           FKL+ +G+  VGKTS++ RF  D+F+ ++ +TIGIDF  +T+ L+ + V+LQ+WDTAGQE
Sbjct: 14  FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQE 73

Query: 227 RFRTITTAY 253
           RFR++  +Y
Sbjct: 74  RFRSLIPSY 82



 Score = 78.2 bits (184), Expect = 3e-14
 Identities = 37/87 (42%), Positives = 53/87 (60%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S +R S   ++VYD+TN  SF+    WI ++     +DV  M++GNK DL  +RQ++ E 
Sbjct: 81  SYIRDSTVAVVVYDITNLNSFQQTSKWIDDVRTERGSDVIIMLVGNKTDLADKRQITIEE 140

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GEQ A E  + F+ETSAK   NV+  F
Sbjct: 141 GEQRAKELSVMFIETSAKTGYNVKQLF 167


>BC111977-1|AAI11978.1|  229|Homo sapiens RAB33B, member RAS
           oncogene family protein.
          Length = 229

 Score = 82.6 bits (195), Expect = 1e-15
 Identities = 33/64 (51%), Positives = 50/64 (78%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           +FK+++IGDS VGKT + +RF    F     +TIG+DF+ R +++DG+++K+Q+WDTAGQ
Sbjct: 33  IFKIIVIGDSNVGKTCLTYRFCAGRFPDRTEATIGVDFRERAVEIDGERIKIQLWDTAGQ 92

Query: 224 ERFR 235
           ERFR
Sbjct: 93  ERFR 96



 Score = 58.4 bits (135), Expect = 3e-08
 Identities = 27/77 (35%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASA-DVEKMILGNKCDLDSQRQVSKERGE 432
           R    ++ VYD+TN  SF ++ +WI   +++  A D+ ++++GNKCDL S  QV  +  +
Sbjct: 105 RNVHAVVFVYDMTNMASFHSLPSWIEECKQHLLANDIPRILVGNKCDLRSAIQVPTDLAQ 164

Query: 433 QLAIEYQIKFVETSAKD 483
           + A  + +   ETSAK+
Sbjct: 165 KFADTHSMPLFETSAKN 181


>BC096818-1|AAH96818.1|  208|Homo sapiens RAB6A, member RAS oncogene
           family protein.
          Length = 208

 Score = 82.6 bits (195), Expect = 1e-15
 Identities = 35/69 (50%), Positives = 54/69 (78%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           FKL+ +G+  VGKTS++ RF  D+F+ ++ +TIGIDF  +T+ L+ + V+LQ+WDTAGQE
Sbjct: 14  FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQE 73

Query: 227 RFRTITTAY 253
           RFR++  +Y
Sbjct: 74  RFRSLIPSY 82



 Score = 77.8 bits (183), Expect = 4e-14
 Identities = 38/87 (43%), Positives = 53/87 (60%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S +R S   ++VYD+TN  SF+    WI ++     +DV  M++GNK DL  +RQVS E 
Sbjct: 81  SYIRDSTVAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEE 140

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GE+ A E  + F+ETSAK   NV+  F
Sbjct: 141 GERKAKELNVMFIETSAKAGYNVKQLF 167


>BC078662-1|AAH78662.1|  208|Homo sapiens RAB6B protein protein.
          Length = 208

 Score = 82.6 bits (195), Expect = 1e-15
 Identities = 35/69 (50%), Positives = 54/69 (78%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           FKL+ +G+  VGKTS++ RF  D+F+ ++ +TIGIDF  +T+ L+ + V+LQ+WDTAGQE
Sbjct: 14  FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQE 73

Query: 227 RFRTITTAY 253
           RFR++  +Y
Sbjct: 74  RFRSLIPSY 82



 Score = 77.4 bits (182), Expect = 5e-14
 Identities = 37/87 (42%), Positives = 52/87 (59%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S +R S   ++VYD+TN  SF+    WI ++     +DV  M+ GNK DL  +RQ++ E 
Sbjct: 81  SYIRDSTVAVVVYDITNLNSFQQTSKWIDDVRTERGSDVIIMLAGNKTDLADKRQITIEE 140

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GEQ A E  + F+ETSAK   NV+  F
Sbjct: 141 GEQRAKELSVMFIETSAKTGYNVKQLF 167


>BC036064-1|AAH36064.1|  229|Homo sapiens RAB33B, member RAS
           oncogene family protein.
          Length = 229

 Score = 82.6 bits (195), Expect = 1e-15
 Identities = 33/64 (51%), Positives = 50/64 (78%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           +FK+++IGDS VGKT + +RF    F     +TIG+DF+ R +++DG+++K+Q+WDTAGQ
Sbjct: 33  IFKIIVIGDSNVGKTCLTYRFCAGRFPDHTEATIGVDFRERAVEIDGERIKIQLWDTAGQ 92

Query: 224 ERFR 235
           ERFR
Sbjct: 93  ERFR 96



 Score = 58.4 bits (135), Expect = 3e-08
 Identities = 27/77 (35%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASA-DVEKMILGNKCDLDSQRQVSKERGE 432
           R    ++ VYD+TN  SF ++ +WI   +++  A D+ ++++GNKCDL S  QV  +  +
Sbjct: 105 RNVHAVVFVYDMTNMASFHSLPSWIEECKQHLLANDIPRILVGNKCDLRSAIQVPTDLAQ 164

Query: 433 QLAIEYQIKFVETSAKD 483
           + A  + +   ETSAK+
Sbjct: 165 KFADTHSMPLFETSAKN 181


>BC002510-1|AAH02510.1|  208|Homo sapiens RAB6B, member RAS oncogene
           family protein.
          Length = 208

 Score = 82.6 bits (195), Expect = 1e-15
 Identities = 35/69 (50%), Positives = 54/69 (78%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           FKL+ +G+  VGKTS++ RF  D+F+ ++ +TIGIDF  +T+ L+ + V+LQ+WDTAGQE
Sbjct: 14  FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQE 73

Query: 227 RFRTITTAY 253
           RFR++  +Y
Sbjct: 74  RFRSLIPSY 82



 Score = 78.2 bits (184), Expect = 3e-14
 Identities = 37/87 (42%), Positives = 53/87 (60%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S +R S   ++VYD+TN  SF+    WI ++     +DV  M++GNK DL  +RQ++ E 
Sbjct: 81  SYIRDSTVAVVVYDITNLNSFQQTSKWIDDVRTERGSDVIIMLVGNKTDLADKRQITIEE 140

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GEQ A E  + F+ETSAK   NV+  F
Sbjct: 141 GEQRAKELSVMFIETSAKTGYNVKQLF 167


>AF498940-1|AAM21088.1|  208|Homo sapiens small GTP binding protein
           RAB6B protein.
          Length = 208

 Score = 82.6 bits (195), Expect = 1e-15
 Identities = 35/69 (50%), Positives = 54/69 (78%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           FKL+ +G+  VGKTS++ RF  D+F+ ++ +TIGIDF  +T+ L+ + V+LQ+WDTAGQE
Sbjct: 14  FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQE 73

Query: 227 RFRTITTAY 253
           RFR++  +Y
Sbjct: 74  RFRSLIPSY 82



 Score = 78.2 bits (184), Expect = 3e-14
 Identities = 37/87 (42%), Positives = 53/87 (60%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S +R S   ++VYD+TN  SF+    WI ++     +DV  M++GNK DL  +RQ++ E 
Sbjct: 81  SYIRDSTVAVVVYDITNLNSFQQTSKWIDDVRTERGSDVIIMLVGNKTDLADKRQITIEE 140

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GEQ A E  + F+ETSAK   NV+  F
Sbjct: 141 GEQRAKELSVMFIETSAKTGYNVKQLF 167


>AF498939-1|AAM21087.1|  208|Homo sapiens small GTP binding protein
           RAB6A protein.
          Length = 208

 Score = 82.6 bits (195), Expect = 1e-15
 Identities = 35/69 (50%), Positives = 54/69 (78%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           FKL+ +G+  VGKTS++ RF  D+F+ ++ +TIGIDF  +T+ L+ + V+LQ+WDTAGQE
Sbjct: 14  FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQE 73

Query: 227 RFRTITTAY 253
           RFR++  +Y
Sbjct: 74  RFRSLIPSY 82



 Score = 77.8 bits (183), Expect = 4e-14
 Identities = 38/87 (43%), Positives = 53/87 (60%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S +R S   ++VYD+TN  SF+    WI ++     +DV  M++GNK DL  +RQVS E 
Sbjct: 81  SYIRDSTVAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEE 140

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GE+ A E  + F+ETSAK   NV+  F
Sbjct: 141 GERKAKELNVMFIETSAKAGYNVKQLF 167


>AF350420-1|AAL83916.1|  229|Homo sapiens RAB33B protein.
          Length = 229

 Score = 82.6 bits (195), Expect = 1e-15
 Identities = 33/64 (51%), Positives = 50/64 (78%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           +FK+++IGDS VGKT + +RF    F     +TIG+DF+ R +++DG+++K+Q+WDTAGQ
Sbjct: 33  IFKIIVIGDSNVGKTCLTYRFCAGRFPDRTEATIGVDFRERAVEIDGERIKIQLWDTAGQ 92

Query: 224 ERFR 235
           ERFR
Sbjct: 93  ERFR 96



 Score = 58.4 bits (135), Expect = 3e-08
 Identities = 27/77 (35%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASA-DVEKMILGNKCDLDSQRQVSKERGE 432
           R    ++ VYD+TN  SF ++ +WI   +++  A D+ ++++GNKCDL S  QV  +  +
Sbjct: 105 RNVHAVVFVYDMTNMASFHSLPSWIEECKQHLLANDIPRILVGNKCDLRSAIQVPTDLAQ 164

Query: 433 QLAIEYQIKFVETSAKD 483
           + A  + +   ETSAK+
Sbjct: 165 KFADTHSMPLFETSAKN 181


>AF166492-1|AAF61637.1|  208|Homo sapiens small GTPase RAB6B
           protein.
          Length = 208

 Score = 82.6 bits (195), Expect = 1e-15
 Identities = 35/69 (50%), Positives = 54/69 (78%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           FKL+ +G+  VGKTS++ RF  D+F+ ++ +TIGIDF  +T+ L+ + V+LQ+WDTAGQE
Sbjct: 14  FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQE 73

Query: 227 RFRTITTAY 253
           RFR++  +Y
Sbjct: 74  RFRSLIPSY 82



 Score = 78.2 bits (184), Expect = 3e-14
 Identities = 37/87 (42%), Positives = 53/87 (60%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S +R S   ++VYD+TN  SF+    WI ++     +DV  M++GNK DL  +RQ++ E 
Sbjct: 81  SYIRDSTVAVVVYDITNLNSFQQTSKWIDDVRTERGSDVIIMLVGNKTDLADKRQITIEE 140

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GEQ A E  + F+ETSAK   NV+  F
Sbjct: 141 GEQRAKELSVMFIETSAKTGYNVKQLF 167


>AF130986-1|AAD25535.1|  208|Homo sapiens RAS-related protein RAB6
           protein.
          Length = 208

 Score = 82.6 bits (195), Expect = 1e-15
 Identities = 35/69 (50%), Positives = 54/69 (78%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           FKL+ +G+  VGKTS++ RF  D+F+ ++ +TIGIDF  +T+ L+ + V+LQ+WDTAGQE
Sbjct: 14  FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQE 73

Query: 227 RFRTITTAY 253
           RFR++  +Y
Sbjct: 74  RFRSLIPSY 82



 Score = 77.8 bits (183), Expect = 4e-14
 Identities = 38/87 (43%), Positives = 53/87 (60%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S +R S   ++VYD+TN  SF+    WI ++     +DV  M++GNK DL  +RQVS E 
Sbjct: 81  SYIRDSTVAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEE 140

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GE+ A E  + F+ETSAK   NV+  F
Sbjct: 141 GERKAKELNVMFIETSAKAGYNVKQLF 167


>AC114743-1|AAY40936.1|  229|Homo sapiens unknown protein.
          Length = 229

 Score = 82.6 bits (195), Expect = 1e-15
 Identities = 33/64 (51%), Positives = 50/64 (78%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           +FK+++IGDS VGKT + +RF    F     +TIG+DF+ R +++DG+++K+Q+WDTAGQ
Sbjct: 33  IFKIIVIGDSNVGKTCLTYRFCAGRFPDRTEATIGVDFRERAVEIDGERIKIQLWDTAGQ 92

Query: 224 ERFR 235
           ERFR
Sbjct: 93  ERFR 96



 Score = 58.4 bits (135), Expect = 3e-08
 Identities = 27/77 (35%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASA-DVEKMILGNKCDLDSQRQVSKERGE 432
           R    ++ VYD+TN  SF ++ +WI   +++  A D+ ++++GNKCDL S  QV  +  +
Sbjct: 105 RNVHAVVFVYDMTNMASFHSLPSWIEECKQHLLANDIPRILVGNKCDLRSAIQVPTDLAQ 164

Query: 433 QLAIEYQIKFVETSAKD 483
           + A  + +   ETSAK+
Sbjct: 165 KFADTHSMPLFETSAKN 181


>CR541984-1|CAG46781.1|  208|Homo sapiens RAB6A protein.
          Length = 208

 Score = 82.2 bits (194), Expect = 2e-15
 Identities = 34/69 (49%), Positives = 54/69 (78%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           FKL+ +G+  VGKTS++ RF  D+F+ ++ +TIGIDF  +T+ L+ + ++LQ+WDTAGQE
Sbjct: 14  FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTIRLQLWDTAGQE 73

Query: 227 RFRTITTAY 253
           RFR++  +Y
Sbjct: 74  RFRSLIPSY 82



 Score = 77.0 bits (181), Expect = 7e-14
 Identities = 37/87 (42%), Positives = 53/87 (60%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S +R S   ++VYD+TN  SF+    WI ++     +DV  M++GNK DL  +RQVS E 
Sbjct: 81  SYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEE 140

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GE+ A E  + F+ETSAK   +V+  F
Sbjct: 141 GERKAKELNVMFIETSAKAGYDVKQLF 167


>BC068486-1|AAH68486.1|  208|Homo sapiens RAB6A protein protein.
          Length = 208

 Score = 82.2 bits (194), Expect = 2e-15
 Identities = 34/69 (49%), Positives = 54/69 (78%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           FKL+ +G+  VGKTS++ RF  D+F+ ++ +TIGIDF  +T+ L+ + ++LQ+WDTAGQE
Sbjct: 14  FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTIRLQLWDTAGQE 73

Query: 227 RFRTITTAY 253
           RFR++  +Y
Sbjct: 74  RFRSLIPSY 82



 Score = 79.0 bits (186), Expect = 2e-14
 Identities = 38/87 (43%), Positives = 53/87 (60%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S +R S   ++VYD+TN  SF+    WI ++     +DV  M++GNK DL  +RQVS E 
Sbjct: 81  SYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEE 140

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GE+ A E  + F+ETSAK   NV+  F
Sbjct: 141 GERKAKELNVMFIETSAKAGYNVKQLF 167


>BC003617-1|AAH03617.1|  208|Homo sapiens RAB6A, member RAS oncogene
           family protein.
          Length = 208

 Score = 82.2 bits (194), Expect = 2e-15
 Identities = 34/69 (49%), Positives = 54/69 (78%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           FKL+ +G+  VGKTS++ RF  D+F+ ++ +TIGIDF  +T+ L+ + ++LQ+WDTAGQE
Sbjct: 14  FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTIRLQLWDTAGQE 73

Query: 227 RFRTITTAY 253
           RFR++  +Y
Sbjct: 74  RFRSLIPSY 82



 Score = 79.0 bits (186), Expect = 2e-14
 Identities = 38/87 (43%), Positives = 53/87 (60%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S +R S   ++VYD+TN  SF+    WI ++     +DV  M++GNK DL  +RQVS E 
Sbjct: 81  SYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEE 140

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GE+ A E  + F+ETSAK   NV+  F
Sbjct: 141 GERKAKELNVMFIETSAKAGYNVKQLF 167


>AK223551-1|BAD97271.1|  208|Homo sapiens RAB6A, member RAS oncogene
           family isoform a variant protein.
          Length = 208

 Score = 82.2 bits (194), Expect = 2e-15
 Identities = 34/69 (49%), Positives = 54/69 (78%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           FKL+ +G+  VGKTS++ RF  D+F+ ++ +TIGIDF  +T+ L+ + ++LQ+WDTAGQE
Sbjct: 14  FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTIRLQLWDTAGQE 73

Query: 227 RFRTITTAY 253
           RFR++  +Y
Sbjct: 74  RFRSLIPSY 82



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 37/87 (42%), Positives = 53/87 (60%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S +R S   ++VYD+TN  SF+    WI ++     +D+  M++GNK DL  +RQVS E 
Sbjct: 81  SYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTERGSDIIIMLVGNKTDLADKRQVSIEE 140

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GE+ A E  + F+ETSAK   NV+  F
Sbjct: 141 GERKAKELNVMFIETSAKAGYNVKQLF 167


>AK057157-1|BAB71371.1|  208|Homo sapiens protein ( Homo sapiens
           cDNA FLJ32595 fis, clone SPLEN2000505, highly similar to
           RAS-RELATED PROTEIN RAB-6. ).
          Length = 208

 Score = 82.2 bits (194), Expect = 2e-15
 Identities = 34/69 (49%), Positives = 54/69 (78%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           FKL+ +G+  VGKTS++ RF  D+F+ ++ +TIGIDF  +T+ L+ + ++LQ+WDTAGQE
Sbjct: 14  FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTIRLQLWDTAGQE 73

Query: 227 RFRTITTAY 253
           RFR++  +Y
Sbjct: 74  RFRSLIPSY 82



 Score = 79.0 bits (186), Expect = 2e-14
 Identities = 38/87 (43%), Positives = 53/87 (60%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S +R S   ++VYD+TN  SF+    WI ++     +DV  M++GNK DL  +RQVS E 
Sbjct: 81  SYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEE 140

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GE+ A E  + F+ETSAK   NV+  F
Sbjct: 141 GERKAKELNVMFIETSAKAGYNVKQLF 167


>AF498941-1|AAM21089.1|  208|Homo sapiens small GTP binding protein
           RAB6C protein.
          Length = 208

 Score = 82.2 bits (194), Expect = 2e-15
 Identities = 34/69 (49%), Positives = 54/69 (78%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           FKL+ +G+  VGKTS++ RF  D+F+ ++ +TIGIDF  +T+ L+ + ++LQ+WDTAGQE
Sbjct: 14  FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTIRLQLWDTAGQE 73

Query: 227 RFRTITTAY 253
           RFR++  +Y
Sbjct: 74  RFRSLIPSY 82



 Score = 79.0 bits (186), Expect = 2e-14
 Identities = 38/87 (43%), Positives = 53/87 (60%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S +R S   ++VYD+TN  SF+    WI ++     +DV  M++GNK DL  +RQVS E 
Sbjct: 81  SYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEE 140

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GE+ A E  + F+ETSAK   NV+  F
Sbjct: 141 GERKAKELNVMFIETSAKAGYNVKQLF 167


>AF198616-1|AAF73841.1|  208|Homo sapiens Rab GTPase RAB6A' protein.
          Length = 208

 Score = 82.2 bits (194), Expect = 2e-15
 Identities = 34/69 (49%), Positives = 54/69 (78%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           FKL+ +G+  VGKTS++ RF  D+F+ ++ +TIGIDF  +T+ L+ + ++LQ+WDTAGQE
Sbjct: 14  FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTIRLQLWDTAGQE 73

Query: 227 RFRTITTAY 253
           RFR++  +Y
Sbjct: 74  RFRSLIPSY 82



 Score = 79.0 bits (186), Expect = 2e-14
 Identities = 38/87 (43%), Positives = 53/87 (60%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S +R S   ++VYD+TN  SF+    WI ++     +DV  M++GNK DL  +RQVS E 
Sbjct: 81  SYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEE 140

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GE+ A E  + F+ETSAK   NV+  F
Sbjct: 141 GERKAKELNVMFIETSAKAGYNVKQLF 167


>AF130122-1|AAD27707.1|  208|Homo sapiens small GTP binding protein
           RAB6 isoform protein.
          Length = 208

 Score = 82.2 bits (194), Expect = 2e-15
 Identities = 34/69 (49%), Positives = 54/69 (78%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           FKL+ +G+  VGKTS++ RF  D+F+ ++ +TIGIDF  +T+ L+ + ++LQ+WDTAGQE
Sbjct: 14  FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTIRLQLWDTAGQE 73

Query: 227 RFRTITTAY 253
           RFR++  +Y
Sbjct: 74  RFRSLIPSY 82



 Score = 79.0 bits (186), Expect = 2e-14
 Identities = 38/87 (43%), Positives = 53/87 (60%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S +R S   ++VYD+TN  SF+    WI ++     +DV  M++GNK DL  +RQVS E 
Sbjct: 81  SYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEE 140

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GE+ A E  + F+ETSAK   NV+  F
Sbjct: 141 GERKAKELNVMFIETSAKAGYNVKQLF 167


>AF119836-1|AAF23593.1|  208|Homo sapiens GTP-binding protein RAB6C
           protein.
          Length = 208

 Score = 82.2 bits (194), Expect = 2e-15
 Identities = 34/69 (49%), Positives = 54/69 (78%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           FKL+ +G+  VGKTS++ RF  D+F+ ++ +TIGIDF  +T+ L+ + ++LQ+WDTAGQE
Sbjct: 14  FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTIRLQLWDTAGQE 73

Query: 227 RFRTITTAY 253
           RFR++  +Y
Sbjct: 74  RFRSLIPSY 82



 Score = 79.0 bits (186), Expect = 2e-14
 Identities = 38/87 (43%), Positives = 53/87 (60%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S +R S   ++VYD+TN  SF+    WI ++     +DV  M++GNK DL  +RQVS E 
Sbjct: 81  SYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEE 140

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GE+ A E  + F+ETSAK   NV+  F
Sbjct: 141 GERKAKELNVMFIETSAKAGYNVKQLF 167


>BC023566-1|AAH23566.1|  740|Homo sapiens RAS and EF-hand domain
           containing protein.
          Length = 740

 Score = 81.0 bits (191), Expect = 4e-15
 Identities = 36/85 (42%), Positives = 60/85 (70%), Gaps = 2/85 (2%)
 Frame = +2

Query: 5   TRIVVKMAKTYDC--LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDL 178
           T +V   AK++     +K++L GD+ VGK+S L R  ++ F  +  +T+G+DF+++T+ +
Sbjct: 526 TDLVDDNAKSFSSQKAYKIVLAGDAAVGKSSFLMRLCKNEFRENISATLGVDFQMKTLIV 585

Query: 179 DGKKVKLQIWDTAGQERFRTITTAY 253
           DG++  LQ+WDTAGQERFR+I  +Y
Sbjct: 586 DGERTVLQLWDTAGQERFRSIAKSY 610



 Score = 71.3 bits (167), Expect = 3e-12
 Identities = 39/89 (43%), Positives = 54/89 (60%), Gaps = 6/89 (6%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDL------DSQR 408
           S  R + G++L+YDVT EKSF NI+ W+  IE+ A   V  M++GNK D+      + Q+
Sbjct: 609 SYFRKADGVLLLYDVTCEKSFLNIREWVDMIEDAAHETVPIMLVGNKADIRDTAATEGQK 668

Query: 409 QVSKERGEQLAIEYQIKFVETSAKDSLNV 495
            V    GE+LA+ Y   F ETSAKD  N+
Sbjct: 669 CVPGHFGEKLAMTYGALFCETSAKDGSNI 697


>AL499602-1|CAH70678.1|  740|Homo sapiens RAS and EF-hand domain
           containing protein.
          Length = 740

 Score = 81.0 bits (191), Expect = 4e-15
 Identities = 36/85 (42%), Positives = 60/85 (70%), Gaps = 2/85 (2%)
 Frame = +2

Query: 5   TRIVVKMAKTYDC--LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDL 178
           T +V   AK++     +K++L GD+ VGK+S L R  ++ F  +  +T+G+DF+++T+ +
Sbjct: 526 TDLVDDNAKSFSSQKAYKIVLAGDAAVGKSSFLMRLCKNEFRENISATLGVDFQMKTLIV 585

Query: 179 DGKKVKLQIWDTAGQERFRTITTAY 253
           DG++  LQ+WDTAGQERFR+I  +Y
Sbjct: 586 DGERTVLQLWDTAGQERFRSIAKSY 610



 Score = 71.3 bits (167), Expect = 3e-12
 Identities = 39/89 (43%), Positives = 54/89 (60%), Gaps = 6/89 (6%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDL------DSQR 408
           S  R + G++L+YDVT EKSF NI+ W+  IE+ A   V  M++GNK D+      + Q+
Sbjct: 609 SYFRKADGVLLLYDVTCEKSFLNIREWVDMIEDAAHETVPIMLVGNKADIRDTAATEGQK 668

Query: 409 QVSKERGEQLAIEYQIKFVETSAKDSLNV 495
            V    GE+LA+ Y   F ETSAKD  N+
Sbjct: 669 CVPGHFGEKLAMTYGALFCETSAKDGSNI 697


>U66624-1|AAC51199.1|   53|Homo sapiens small GTP-binding protein
           protein.
          Length = 53

 Score = 80.6 bits (190), Expect = 6e-15
 Identities = 35/41 (85%), Positives = 41/41 (100%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMIL 378
           RG+MGIMLVYD+TNEKSF+NIKNWIRNIEE+AS+DVE+MIL
Sbjct: 13  RGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMIL 53


>AF274957-1|AAK07532.1|   70|Homo sapiens PNAS-32 protein.
          Length = 70

 Score = 80.6 bits (190), Expect = 6e-15
 Identities = 33/56 (58%), Positives = 46/56 (82%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTA 217
           K+L+IG+SGVGK+S+L RF++D F+    +TIG+DFK++TI +DG K KL IWDTA
Sbjct: 10  KILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTA 65


>Z98883-3|CAM26443.1|  281|Homo sapiens RAB40C, member RAS oncogene
           family protein.
          Length = 281

 Score = 80.2 bits (189), Expect = 7e-15
 Identities = 39/76 (51%), Positives = 51/76 (67%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           K+YD L K LL+GDS VGK  IL    + A    +  + GID+K  TI LDG++VKL++W
Sbjct: 9   KSYDYLLKFLLVGDSDVGKGEILESLQDGAAESPYAYSNGIDYKTTTILLDGRRVKLELW 68

Query: 209 DTAGQERFRTITTAYS 256
           DT+GQ RF TI  +YS
Sbjct: 69  DTSGQGRFCTIFRSYS 84



 Score = 64.5 bits (150), Expect = 4e-10
 Identities = 34/88 (38%), Positives = 53/88 (60%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ GI+LVYD+TN  SF+ I  WI+ I+E+A   V ++++GN+  L  +RQV  E+
Sbjct: 82  SYSRGAQGILLVYDITNRWSFDGIDRWIKEIDEHAPG-VPRILVGNRLHLAFKRQVPTEQ 140

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAFS 510
               A +  + F E S   + NV  +F+
Sbjct: 141 ARAYAEKNCMTFFEVSPLCNFNVIESFT 168


>Z84479-1|CAB06484.2|  281|Homo sapiens RAB40C, member RAS oncogene
           family protein.
          Length = 281

 Score = 80.2 bits (189), Expect = 7e-15
 Identities = 39/76 (51%), Positives = 51/76 (67%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           K+YD L K LL+GDS VGK  IL    + A    +  + GID+K  TI LDG++VKL++W
Sbjct: 9   KSYDYLLKFLLVGDSDVGKGEILESLQDGAAESPYAYSNGIDYKTTTILLDGRRVKLELW 68

Query: 209 DTAGQERFRTITTAYS 256
           DT+GQ RF TI  +YS
Sbjct: 69  DTSGQGRFCTIFRSYS 84



 Score = 64.5 bits (150), Expect = 4e-10
 Identities = 34/88 (38%), Positives = 53/88 (60%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ GI+LVYD+TN  SF+ I  WI+ I+E+A   V ++++GN+  L  +RQV  E+
Sbjct: 82  SYSRGAQGILLVYDITNRWSFDGIDRWIKEIDEHAPG-VPRILVGNRLHLAFKRQVPTEQ 140

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAFS 510
               A +  + F E S   + NV  +F+
Sbjct: 141 ARAYAEKNCMTFFEVSPLCNFNVIESFT 168


>U44103-1|AAC51200.1|  201|Homo sapiens small GTP binding protein
           Rab9 protein.
          Length = 201

 Score = 80.2 bits (189), Expect = 7e-15
 Identities = 33/70 (47%), Positives = 52/70 (74%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           LFK++L+GD GVGK+S++ R+  + F+     TIG++F  + +++DG  V +QIWDTAGQ
Sbjct: 7   LFKVILLGDGGVGKSSLMNRYVTNKFDTQLFHTIGVEFLNKDLEVDGHFVTMQIWDTAGQ 66

Query: 224 ERFRTITTAY 253
           ERFR++ T +
Sbjct: 67  ERFRSLRTPF 76



 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 36/91 (39%), Positives = 52/91 (57%), Gaps = 7/91 (7%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEK------MILGNKCDLDSQRQVS 417
           RGS   +L + V + +SF+N+ NW +  E    ADV++      +ILGNK D+ S+RQVS
Sbjct: 78  RGSDCCLLTFSVDDSQSFQNLSNWKK--EFIYYADVKEPESFPFVILGNKIDI-SERQVS 134

Query: 418 KERGEQLAIEY-QIKFVETSAKDSLNVEYAF 507
            E  +    +     + ETSAKD+ NV  AF
Sbjct: 135 TEEAQAWCRDNGDYPYFETSAKDATNVAAAF 165


>D84488-1|BAA22160.1|  203|Homo sapiens small GTP-binding protein
           protein.
          Length = 203

 Score = 80.2 bits (189), Expect = 7e-15
 Identities = 35/73 (47%), Positives = 56/73 (76%), Gaps = 1/73 (1%)
 Frame = +2

Query: 38  DCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTID-LDGKKVKLQIWDT 214
           D LFK+L++GD+ VGKTS++ R+S+D+F+  + ST+G+DF ++ +   D + V+LQ+WD 
Sbjct: 5   DHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDYEIVRLQLWDI 64

Query: 215 AGQERFRTITTAY 253
           AGQERF ++T  Y
Sbjct: 65  AGQERFTSMTRLY 77



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 25/88 (28%), Positives = 49/88 (55%), Gaps = 5/88 (5%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENAS----ADVEKMILGNKCDLDSQRQVSKE 423
           R +   ++++DVTN  +F N + W ++++   +      V  ++L NKCDL S   VS++
Sbjct: 79  RDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPNGEPVPCLLLANKCDL-SPWAVSRD 137

Query: 424 RGEQLAIEYQIK-FVETSAKDSLNVEYA 504
           + ++ + E     + ETS K++ N+  A
Sbjct: 138 QIDRFSKENGFTGWTETSVKENKNINEA 165


>CR542010-1|CAG46807.1|  203|Homo sapiens RAB7L1 protein.
          Length = 203

 Score = 80.2 bits (189), Expect = 7e-15
 Identities = 35/73 (47%), Positives = 56/73 (76%), Gaps = 1/73 (1%)
 Frame = +2

Query: 38  DCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTID-LDGKKVKLQIWDT 214
           D LFK+L++GD+ VGKTS++ R+S+D+F+  + ST+G+DF ++ +   D + V+LQ+WD 
Sbjct: 5   DHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDYEIVRLQLWDI 64

Query: 215 AGQERFRTITTAY 253
           AGQERF ++T  Y
Sbjct: 65  AGQERFTSMTRLY 77



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 25/88 (28%), Positives = 49/88 (55%), Gaps = 5/88 (5%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENAS----ADVEKMILGNKCDLDSQRQVSKE 423
           R +   ++++DVTN  +F N + W ++++   +      V  ++L NKCDL S   VS++
Sbjct: 79  RDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPNGEPVPCLLLANKCDL-SPWAVSRD 137

Query: 424 RGEQLAIEYQIK-FVETSAKDSLNVEYA 504
           + ++ + E     + ETS K++ N+  A
Sbjct: 138 QIDRFSKENGFTGWTETSVKENKNINEA 165


>CR450362-1|CAG29358.1|  201|Homo sapiens RAB9A protein.
          Length = 201

 Score = 80.2 bits (189), Expect = 7e-15
 Identities = 33/70 (47%), Positives = 52/70 (74%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           LFK++L+GD GVGK+S++ R+  + F+     TIG++F  + +++DG  V +QIWDTAGQ
Sbjct: 7   LFKVILLGDGGVGKSSLMNRYVTNKFDTQLFHTIGVEFLNKDLEVDGHFVTMQIWDTAGQ 66

Query: 224 ERFRTITTAY 253
           ERFR++ T +
Sbjct: 67  ERFRSLRTPF 76



 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 36/91 (39%), Positives = 52/91 (57%), Gaps = 7/91 (7%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEK------MILGNKCDLDSQRQVS 417
           RGS   +L + V + +SF+N+ NW +  E    ADV++      +ILGNK D+ S+RQVS
Sbjct: 78  RGSDCCLLTFSVDDSQSFQNLSNWKK--EFIYYADVKEPESFPFVILGNKIDI-SERQVS 134

Query: 418 KERGEQLAIEY-QIKFVETSAKDSLNVEYAF 507
            E  +    +     + ETSAKD+ NV  AF
Sbjct: 135 TEEAQAWCRDNGDYPYFETSAKDATNVAAAF 165


>BT019540-1|AAV38347.1|  203|Homo sapiens RAB7, member RAS oncogene
           family-like 1 protein.
          Length = 203

 Score = 80.2 bits (189), Expect = 7e-15
 Identities = 35/73 (47%), Positives = 56/73 (76%), Gaps = 1/73 (1%)
 Frame = +2

Query: 38  DCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTID-LDGKKVKLQIWDT 214
           D LFK+L++GD+ VGKTS++ R+S+D+F+  + ST+G+DF ++ +   D + V+LQ+WD 
Sbjct: 5   DHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDYEIVRLQLWDI 64

Query: 215 AGQERFRTITTAY 253
           AGQERF ++T  Y
Sbjct: 65  AGQERFTSMTRLY 77



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 25/88 (28%), Positives = 49/88 (55%), Gaps = 5/88 (5%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENAS----ADVEKMILGNKCDLDSQRQVSKE 423
           R +   ++++DVTN  +F N + W ++++   +      V  ++L NKCDL S   VS++
Sbjct: 79  RDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPNGEPVPCLLLANKCDL-SPWAVSRD 137

Query: 424 RGEQLAIEYQIK-FVETSAKDSLNVEYA 504
           + ++ + E     + ETS K++ N+  A
Sbjct: 138 QIDRFSKENGFTGWTETSVKENKNINEA 165


>BC018039-1|AAH18039.1|  278|Homo sapiens RAB40B, member RAS
           oncogene family protein.
          Length = 278

 Score = 80.2 bits (189), Expect = 7e-15
 Identities = 39/76 (51%), Positives = 50/76 (65%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           + YD L K LL+GDS VGK  IL    + A   ++    GID+K  TI LDG++VKLQ+W
Sbjct: 9   RAYDFLLKFLLVGDSDVGKGEILASLQDGAAESTYGHPAGIDYKTTTILLDGRRVKLQLW 68

Query: 209 DTAGQERFRTITTAYS 256
           DT+GQ RF TI  +YS
Sbjct: 69  DTSGQGRFCTIFRSYS 84



 Score = 65.3 bits (152), Expect = 2e-10
 Identities = 32/88 (36%), Positives = 52/88 (59%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G++LVYD+ N  SF+ I  WI+ I+E+A   V K+++GN+  L  +RQV  E+
Sbjct: 82  SYSRGAQGVILVYDIANRWSFDGIDRWIKEIDEHAPG-VPKILVGNRLHLAFKRQVPTEQ 140

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAFS 510
            +  A    + F E S   + N+  +F+
Sbjct: 141 AQAYAERLGVTFFEVSPLCNFNITESFT 168


>BC017265-1|AAH17265.1|  201|Homo sapiens RAB9A, member RAS oncogene
           family protein.
          Length = 201

 Score = 80.2 bits (189), Expect = 7e-15
 Identities = 33/70 (47%), Positives = 52/70 (74%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           LFK++L+GD GVGK+S++ R+  + F+     TIG++F  + +++DG  V +QIWDTAGQ
Sbjct: 7   LFKVILLGDGGVGKSSLMNRYVTNKFDTQLFHTIGVEFLNKDLEVDGHFVTMQIWDTAGQ 66

Query: 224 ERFRTITTAY 253
           ERFR++ T +
Sbjct: 67  ERFRSLRTPF 76



 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 36/91 (39%), Positives = 52/91 (57%), Gaps = 7/91 (7%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEK------MILGNKCDLDSQRQVS 417
           RGS   +L + V + +SF+N+ NW +  E    ADV++      +ILGNK D+ S+RQVS
Sbjct: 78  RGSDCCLLTFSVDDSQSFQNLSNWKK--EFIYYADVKEPESFPFVILGNKIDI-SERQVS 134

Query: 418 KERGEQLAIEY-QIKFVETSAKDSLNVEYAF 507
            E  +    +     + ETSAKD+ NV  AF
Sbjct: 135 TEEAQAWCRDNGDYPYFETSAKDATNVAAAF 165


>BC002585-1|AAH02585.1|  203|Homo sapiens RAB7, member RAS oncogene
           family-like 1 protein.
          Length = 203

 Score = 80.2 bits (189), Expect = 7e-15
 Identities = 35/73 (47%), Positives = 56/73 (76%), Gaps = 1/73 (1%)
 Frame = +2

Query: 38  DCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTID-LDGKKVKLQIWDT 214
           D LFK+L++GD+ VGKTS++ R+S+D+F+  + ST+G+DF ++ +   D + V+LQ+WD 
Sbjct: 5   DHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDYEIVRLQLWDI 64

Query: 215 AGQERFRTITTAY 253
           AGQERF ++T  Y
Sbjct: 65  AGQERFTSMTRLY 77



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 25/88 (28%), Positives = 49/88 (55%), Gaps = 5/88 (5%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENAS----ADVEKMILGNKCDLDSQRQVSKE 423
           R +   ++++DVTN  +F N + W ++++   +      V  ++L NKCDL S   VS++
Sbjct: 79  RDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPNGEPVPCLLLANKCDL-SPWAVSRD 137

Query: 424 RGEQLAIEYQIK-FVETSAKDSLNVEYA 504
           + ++ + E     + ETS K++ N+  A
Sbjct: 138 QIDRFSKENGFTGWTETSVKENKNINEA 165


>AY823398-1|AAV83924.1|  262|Homo sapiens RAR-like GTPase variant
           protein.
          Length = 262

 Score = 80.2 bits (189), Expect = 7e-15
 Identities = 39/76 (51%), Positives = 51/76 (67%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           K+YD L K LL+GDS VGK  IL    + A    +  + GID+K  TI LDG++VKL++W
Sbjct: 9   KSYDYLLKFLLVGDSDVGKGEILESLQDGAAESPYAYSNGIDYKTTTILLDGRRVKLELW 68

Query: 209 DTAGQERFRTITTAYS 256
           DT+GQ RF TI  +YS
Sbjct: 69  DTSGQGRFCTIFRSYS 84



 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 18/33 (54%), Positives = 24/33 (72%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEE 345
           S  RG+ GI+LVYD+TN  SF+ I  WI+ I+E
Sbjct: 82  SYSRGAQGILLVYDITNRWSFDGIDRWIKEIDE 114


>AF498944-1|AAM21092.1|  201|Homo sapiens small GTP binding protein
           RAB9 protein.
          Length = 201

 Score = 80.2 bits (189), Expect = 7e-15
 Identities = 33/70 (47%), Positives = 52/70 (74%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           LFK++L+GD GVGK+S++ R+  + F+     TIG++F  + +++DG  V +QIWDTAGQ
Sbjct: 7   LFKVILLGDGGVGKSSLMNRYVTNKFDTQLFHTIGVEFLNKDLEVDGHFVTMQIWDTAGQ 66

Query: 224 ERFRTITTAY 253
           ERFR++ T +
Sbjct: 67  ERFRSLRTPF 76



 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 36/91 (39%), Positives = 52/91 (57%), Gaps = 7/91 (7%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEK------MILGNKCDLDSQRQVS 417
           RGS   +L + V + +SF+N+ NW +  E    ADV++      +ILGNK D+ S+RQVS
Sbjct: 78  RGSDCCLLTFSVDDSQSFQNLSNWKK--EFIYYADVKEPESFPFVILGNKIDI-SERQVS 134

Query: 418 KERGEQLAIEY-QIKFVETSAKDSLNVEYAF 507
            E  +    +     + ETSAKD+ NV  AF
Sbjct: 135 TEEAQAWCRDNGDYPYFETSAKDATNVAAAF 165


>AE006464-4|AAK61236.1|  281|Homo sapiens RAR (RAS like GTPase) like
           protein.
          Length = 281

 Score = 80.2 bits (189), Expect = 7e-15
 Identities = 39/76 (51%), Positives = 51/76 (67%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           K+YD L K LL+GDS VGK  IL    + A    +  + GID+K  TI LDG++VKL++W
Sbjct: 9   KSYDYLLKFLLVGDSDVGKGEILESLQDGAAESPYAYSNGIDYKTTTILLDGRRVKLELW 68

Query: 209 DTAGQERFRTITTAYS 256
           DT+GQ RF TI  +YS
Sbjct: 69  DTSGQGRFCTIFRSYS 84



 Score = 64.5 bits (150), Expect = 4e-10
 Identities = 34/88 (38%), Positives = 53/88 (60%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ GI+LVYD+TN  SF+ I  WI+ I+E+A   V ++++GN+  L  +RQV  E+
Sbjct: 82  SYSRGAQGILLVYDITNRWSFDGIDRWIKEIDEHAPG-VPRILVGNRLHLAFKRQVPTEQ 140

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAFS 510
               A +  + F E S   + NV  +F+
Sbjct: 141 ARAYAEKNCMTFFEVSPLCNFNVIESFT 168


>X99962-1|CAA68227.1|  217|Homo sapiens rab-related GTP-binding
           protein protein.
          Length = 217

 Score = 79.8 bits (188), Expect = 1e-14
 Identities = 36/85 (42%), Positives = 59/85 (69%), Gaps = 1/85 (1%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASA-DVEKMILGNKCDLDSQRQVSKE 423
           S  R S+G  LV+D+TN +SFE++K+W+   +       +  +++G+KCDL SQRQV++E
Sbjct: 81  SYYRNSVGGFLVFDITNRRSFEHVKDWLEEAKMYVQPFRIVFLLVGHKCDLASQRQVTRE 140

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVE 498
             E+L+ +  + ++ETSAKD+ NVE
Sbjct: 141 EAEKLSADCGMMYIETSAKDATNVE 165



 Score = 76.2 bits (179), Expect = 1e-13
 Identities = 36/74 (48%), Positives = 56/74 (75%), Gaps = 5/74 (6%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAF----NISFISTIGIDFKIRTIDLD-GKKVKLQIWD 211
           F+L++IGDS VGK+ +L RF++  F    + +   T+G+DF  R ++++ GK++KLQ+WD
Sbjct: 9   FRLIVIGDSTVGKSCLLHRFTQGRFPGLRSPACDPTVGVDFFSRLLEIEPGKRIKLQLWD 68

Query: 212 TAGQERFRTITTAY 253
           TAGQERFR+IT +Y
Sbjct: 69  TAGQERFRSITRSY 82


>U05227-1|AAA17031.1|  278|Homo sapiens Rar protein protein.
          Length = 278

 Score = 79.4 bits (187), Expect = 1e-14
 Identities = 39/76 (51%), Positives = 49/76 (64%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           + YD L K LL+GDS VGK  IL    + A    +    GID+K  TI LDG++VKLQ+W
Sbjct: 9   RAYDFLLKFLLVGDSDVGKGEILASLQDGAAESPYGHPAGIDYKTTTILLDGRRVKLQLW 68

Query: 209 DTAGQERFRTITTAYS 256
           DT+GQ RF TI  +YS
Sbjct: 69  DTSGQGRFCTIFRSYS 84



 Score = 65.3 bits (152), Expect = 2e-10
 Identities = 32/88 (36%), Positives = 52/88 (59%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G++LVYD+ N  SF+ I  WI+ I+E+A   V K+++GN+  L  +RQV  E+
Sbjct: 82  SYSRGAQGVILVYDIANRWSFDGIDRWIKEIDEHAPG-VPKILVGNRLHLAFKRQVPTEQ 140

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAFS 510
            +  A    + F E S   + N+  +F+
Sbjct: 141 AQAYAERLGVTFFEVSPLCNFNITESFT 168


>AB209711-1|BAD92948.1|  380|Homo sapiens RAB40B, member RAS
           oncogene family variant protein.
          Length = 380

 Score = 79.4 bits (187), Expect = 1e-14
 Identities = 39/76 (51%), Positives = 49/76 (64%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           + YD L K LL+GDS VGK  IL    + A    +    GID+K  TI LDG++VKLQ+W
Sbjct: 43  RAYDFLLKFLLVGDSDVGKGEILASLQDGAAESPYGHPAGIDYKTTTILLDGRRVKLQLW 102

Query: 209 DTAGQERFRTITTAYS 256
           DT+GQ RF TI  +YS
Sbjct: 103 DTSGQGRFCTIFRSYS 118



 Score = 65.3 bits (152), Expect = 2e-10
 Identities = 32/88 (36%), Positives = 52/88 (59%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G++LVYD+ N  SF+ I  WI+ I+E+A   V K+++GN+  L  +RQV  E+
Sbjct: 116 SYSRGAQGVILVYDIANRWSFDGIDRWIKEIDEHAPG-VPKILVGNRLHLAFKRQVPTEQ 174

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAFS 510
            +  A    + F E S   + N+  +F+
Sbjct: 175 AQAYAERLGVTFFEVSPLCNFNITESFT 202


>BC028696-1|AAH28696.1|  281|Homo sapiens RAB40C, member RAS
           oncogene family protein.
          Length = 281

 Score = 79.0 bits (186), Expect = 2e-14
 Identities = 38/76 (50%), Positives = 51/76 (67%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           K+YD L K LL+GDS VGK  IL    + A    +  + GID+K  TI LDG++V+L++W
Sbjct: 9   KSYDYLLKFLLVGDSDVGKGEILESLQDGAAESPYAYSNGIDYKTTTILLDGRRVRLELW 68

Query: 209 DTAGQERFRTITTAYS 256
           DT+GQ RF TI  +YS
Sbjct: 69  DTSGQGRFCTIFRSYS 84



 Score = 64.5 bits (150), Expect = 4e-10
 Identities = 34/88 (38%), Positives = 53/88 (60%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ GI+LVYD+TN  SF+ I  WI+ I+E+A   V ++++GN+  L  +RQV  E+
Sbjct: 82  SYSRGAQGILLVYDITNRWSFDGIDRWIKEIDEHAPG-VPRILVGNRLHLAFKRQVPTEQ 140

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAFS 510
               A +  + F E S   + NV  +F+
Sbjct: 141 ARAYAEKNCMTFFEVSPLCNFNVIESFT 168


>BC093758-1|AAH93758.1|  201|Homo sapiens RAB9B, member RAS oncogene
           family protein.
          Length = 201

 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 33/70 (47%), Positives = 52/70 (74%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           L K++L+GD GVGK+S++ R+  + F+     TIG++F  R +++DG+ V LQIWDTAGQ
Sbjct: 7   LLKVILLGDGGVGKSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQIWDTAGQ 66

Query: 224 ERFRTITTAY 253
           ERF+++ T +
Sbjct: 67  ERFKSLRTPF 76



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 33/89 (37%), Positives = 48/89 (53%), Gaps = 5/89 (5%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASA-DVEK---MILGNKCDLDSQRQVSKE 423
           RG+   +L + V + +SFEN+ NW +     A   D E    ++LGNK D +  RQV+ E
Sbjct: 78  RGADCCLLTFSVDDRQSFENLGNWQKEFIYYADVKDPEHFPFVVLGNKVDKE-DRQVTTE 136

Query: 424 RGEQLAIEY-QIKFVETSAKDSLNVEYAF 507
             +   +E     ++ETSAKD  NV  AF
Sbjct: 137 EAQTWCMENGDYPYLETSAKDDTNVTVAF 165


>BC093756-1|AAH93756.1|  201|Homo sapiens RAB9B, member RAS oncogene
           family protein.
          Length = 201

 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 33/70 (47%), Positives = 52/70 (74%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           L K++L+GD GVGK+S++ R+  + F+     TIG++F  R +++DG+ V LQIWDTAGQ
Sbjct: 7   LLKVILLGDGGVGKSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQIWDTAGQ 66

Query: 224 ERFRTITTAY 253
           ERF+++ T +
Sbjct: 67  ERFKSLRTPF 76



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 33/89 (37%), Positives = 48/89 (53%), Gaps = 5/89 (5%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASA-DVEK---MILGNKCDLDSQRQVSKE 423
           RG+   +L + V + +SFEN+ NW +     A   D E    ++LGNK D +  RQV+ E
Sbjct: 78  RGADCCLLTFSVDDRQSFENLGNWQKEFIYYADVKDPEHFPFVVLGNKVDKE-DRQVTTE 136

Query: 424 RGEQLAIEY-QIKFVETSAKDSLNVEYAF 507
             +   +E     ++ETSAKD  NV  AF
Sbjct: 137 EAQTWCMENGDYPYLETSAKDDTNVTVAF 165


>AL139228-1|CAB76967.1|  201|Homo sapiens RAB9B, member RAS oncogene
           family protein.
          Length = 201

 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 33/70 (47%), Positives = 52/70 (74%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           L K++L+GD GVGK+S++ R+  + F+     TIG++F  R +++DG+ V LQIWDTAGQ
Sbjct: 7   LLKVILLGDGGVGKSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQIWDTAGQ 66

Query: 224 ERFRTITTAY 253
           ERF+++ T +
Sbjct: 67  ERFKSLRTPF 76



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 33/89 (37%), Positives = 48/89 (53%), Gaps = 5/89 (5%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASA-DVEK---MILGNKCDLDSQRQVSKE 423
           RG+   +L + V + +SFEN+ NW +     A   D E    ++LGNK D +  RQV+ E
Sbjct: 78  RGADCCLLTFSVDDRQSFENLGNWQKEFIYYADVKDPEHFPFVVLGNKVDKE-DRQVTTE 136

Query: 424 RGEQLAIEY-QIKFVETSAKDSLNVEYAF 507
             +   +E     ++ETSAKD  NV  AF
Sbjct: 137 EAQTWCMENGDYPYLETSAKDDTNVTVAF 165


>AF091032-1|AAF00045.1|   43|Homo sapiens GTP-binding protein RAB10
           protein.
          Length = 43

 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 33/43 (76%), Positives = 40/43 (93%)
 Frame = +2

Query: 80  GKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           GKT +LFRFS+DAFN +FISTIGIDFKI+T++L GKK+KLQIW
Sbjct: 1   GKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIW 43


>AB036693-1|BAA89542.1|  201|Homo sapiens RAB9-like protein protein.
          Length = 201

 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 33/70 (47%), Positives = 52/70 (74%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           L K++L+GD GVGK+S++ R+  + F+     TIG++F  R +++DG+ V LQIWDTAGQ
Sbjct: 7   LLKVILLGDGGVGKSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQIWDTAGQ 66

Query: 224 ERFRTITTAY 253
           ERF+++ T +
Sbjct: 67  ERFKSLRTPF 76



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 33/89 (37%), Positives = 48/89 (53%), Gaps = 5/89 (5%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASA-DVEK---MILGNKCDLDSQRQVSKE 423
           RG+   +L + V + +SFEN+ NW +     A   D E    ++LGNK D +  RQV+ E
Sbjct: 78  RGADCCLLTFSVDDRQSFENLGNWQKEFIYYADVKDPEHFPFVVLGNKVDKE-DRQVTTE 136

Query: 424 RGEQLAIEY-QIKFVETSAKDSLNVEYAF 507
             +   +E     ++ETSAKD  NV  AF
Sbjct: 137 EAQTWCMENGDYPYLETSAKDDTNVTVAF 165


>BC117239-1|AAI17240.1|  221|Homo sapiens RAB41, member RAS oncogene
           family protein.
          Length = 221

 Score = 78.2 bits (184), Expect = 3e-14
 Identities = 36/87 (41%), Positives = 54/87 (62%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S +R S   ++VYD+TN  SF+    W+ ++      DV  M+LGNK DLD++RQV+ E+
Sbjct: 98  SYIRDSTIAVVVYDITNINSFKETDKWVEHVRAERGDDVVIMLLGNKIDLDNKRQVTAEQ 157

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GE+ +    + F+ETSAK   NV+  F
Sbjct: 158 GEEKSRNLNVMFIETSAKTGYNVKKLF 184



 Score = 70.5 bits (165), Expect = 6e-12
 Identities = 33/71 (46%), Positives = 50/71 (70%)
 Frame = +2

Query: 41  CLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAG 220
           C  KLL +G+   GKTSI+ RF  ++F  +  +T+GIDF  +T+ L+ + V+LQ+WDTAG
Sbjct: 30  CKSKLLFLGEQS-GKTSIISRFMYNSFGCACQATVGIDFLSKTMYLEDQIVQLQLWDTAG 88

Query: 221 QERFRTITTAY 253
           QERF ++  +Y
Sbjct: 89  QERFHSLIPSY 99


>AL357752-5|CAI41489.1|  212|Homo sapiens novel protein similar to
           RAB6A, member RAS oncogene family protein.
          Length = 212

 Score = 78.2 bits (184), Expect = 3e-14
 Identities = 36/87 (41%), Positives = 54/87 (62%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S +R S   ++VYD+TN  SF+    W+ ++      DV  M+LGNK DLD++RQV+ E+
Sbjct: 89  SYIRDSTIAVVVYDITNINSFKETDKWVEHVRAERGDDVVIMLLGNKIDLDNKRQVTAEQ 148

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GE+ +    + F+ETSAK   NV+  F
Sbjct: 149 GEEKSRNLNVMFIETSAKTGYNVKKLF 175



 Score = 76.6 bits (180), Expect = 9e-14
 Identities = 34/71 (47%), Positives = 51/71 (71%)
 Frame = +2

Query: 41  CLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAG 220
           C  KLL +G+  VGKTSI+ RF  ++F  +  +T+GIDF  +T+ L+ + V+LQ+WDTAG
Sbjct: 20  CKSKLLFLGEQSVGKTSIISRFMYNSFGCACQATVGIDFLSKTMYLEDQIVQLQLWDTAG 79

Query: 221 QERFRTITTAY 253
           QERF ++  +Y
Sbjct: 80  QERFHSLIPSY 90


>AK223514-1|BAD97234.1|  203|Homo sapiens RAB7, member RAS oncogene
           family-like 1 variant protein.
          Length = 203

 Score = 78.2 bits (184), Expect = 3e-14
 Identities = 35/73 (47%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +2

Query: 38  DCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTID-LDGKKVKLQIWDT 214
           D LFK+L++GD+ VGKTS + R+S+D+F+  + ST+G+DF ++ +   D + V+LQ+WD 
Sbjct: 5   DHLFKVLVVGDAAVGKTSPVQRYSQDSFSKHYKSTVGVDFALKVLQWSDYEIVRLQLWDI 64

Query: 215 AGQERFRTITTAY 253
           AGQERF ++T  Y
Sbjct: 65  AGQERFTSMTRLY 77



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 25/88 (28%), Positives = 49/88 (55%), Gaps = 5/88 (5%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENAS----ADVEKMILGNKCDLDSQRQVSKE 423
           R +   ++++DVTN  +F N + W ++++   +      V  ++L NKCDL S   VS++
Sbjct: 79  RDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPNGEPVPCLLLANKCDL-SPWAVSRD 137

Query: 424 RGEQLAIEYQIK-FVETSAKDSLNVEYA 504
           + ++ + E     + ETS K++ N+  A
Sbjct: 138 QIDRFSKENGFTGWTETSVKENKNINEA 165


>CR456553-1|CAG30439.1|  333|Homo sapiens RAB36 protein.
          Length = 333

 Score = 77.0 bits (181), Expect = 7e-14
 Identities = 33/70 (47%), Positives = 51/70 (72%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           L K++++GD  VGKTS++ RF ++ F+  + +TIG+DF+I   ++ G    LQIWDTAGQ
Sbjct: 123 LSKVVVVGDLYVGKTSLIHRFCKNVFDRDYKATIGVDFEIERFEIAGIPYSLQIWDTAGQ 182

Query: 224 ERFRTITTAY 253
           E+F+ I +AY
Sbjct: 183 EKFKCIASAY 192



 Score = 40.3 bits (90), Expect = 0.007
 Identities = 25/88 (28%), Positives = 45/88 (51%), Gaps = 3/88 (3%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRN-IEENASADVEKMILGNKCDLDSQRQVSKERGE 432
           RG+  I+  +D+T+ ++ E+ + W+ + + EN +      ++G K DL S     +   +
Sbjct: 194 RGAQVIITAFDLTDVQTLEHTRQWLEDALRENEAGSCFIFLVGTKKDLLSGAACEQAEAD 253

Query: 433 --QLAIEYQIKFVETSAKDSLNVEYAFS 510
              LA E Q ++   SAK   NV+  FS
Sbjct: 254 AVHLAREMQAEYWSVSAKTGENVKAFFS 281


>BC104991-1|AAI04992.1|  333|Homo sapiens RAB36, member RAS oncogene
           family protein.
          Length = 333

 Score = 77.0 bits (181), Expect = 7e-14
 Identities = 33/70 (47%), Positives = 51/70 (72%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           L K++++GD  VGKTS++ RF ++ F+  + +TIG+DF+I   ++ G    LQIWDTAGQ
Sbjct: 123 LSKVVVVGDLYVGKTSLIHRFCKNVFDRDYKATIGVDFEIERFEIAGIPYSLQIWDTAGQ 182

Query: 224 ERFRTITTAY 253
           E+F+ I +AY
Sbjct: 183 EKFKCIASAY 192



 Score = 40.3 bits (90), Expect = 0.007
 Identities = 25/88 (28%), Positives = 45/88 (51%), Gaps = 3/88 (3%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRN-IEENASADVEKMILGNKCDLDSQRQVSKERGE 432
           RG+  I+  +D+T+ ++ E+ + W+ + + EN +      ++G K DL S     +   +
Sbjct: 194 RGAQVIITAFDLTDVQTLEHTRQWLEDALRENEAGSCFIFLVGTKKDLLSGAACEQAEAD 253

Query: 433 --QLAIEYQIKFVETSAKDSLNVEYAFS 510
              LA E Q ++   SAK   NV+  FS
Sbjct: 254 AVHLAREMQAEYWSVSAKTGENVKAFFS 281


>BC104989-1|AAI04990.1|  333|Homo sapiens RAB36, member RAS oncogene
           family protein.
          Length = 333

 Score = 77.0 bits (181), Expect = 7e-14
 Identities = 33/70 (47%), Positives = 51/70 (72%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           L K++++GD  VGKTS++ RF ++ F+  + +TIG+DF+I   ++ G    LQIWDTAGQ
Sbjct: 123 LSKVVVVGDLYVGKTSLIHRFCKNVFDRDYKATIGVDFEIERFEIAGIPYSLQIWDTAGQ 182

Query: 224 ERFRTITTAY 253
           E+F+ I +AY
Sbjct: 183 EKFKCIASAY 192



 Score = 40.3 bits (90), Expect = 0.007
 Identities = 25/88 (28%), Positives = 45/88 (51%), Gaps = 3/88 (3%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRN-IEENASADVEKMILGNKCDLDSQRQVSKERGE 432
           RG+  I+  +D+T+ ++ E+ + W+ + + EN +      ++G K DL S     +   +
Sbjct: 194 RGAQVIITAFDLTDVQTLEHTRQWLEDALRENEAGSCFIFLVGTKKDLLSGAACEQAEAD 253

Query: 433 --QLAIEYQIKFVETSAKDSLNVEYAFS 510
              LA E Q ++   SAK   NV+  FS
Sbjct: 254 AVHLAREMQAEYWSVSAKTGENVKAFFS 281


>AY574034-1|AAU08232.1|  235|Homo sapiens RAB18 long isoform 1
           protein.
          Length = 235

 Score = 77.0 bits (181), Expect = 7e-14
 Identities = 32/59 (54%), Positives = 46/59 (77%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           K+L+IG+SGVGK+S+L RF++D F+    +TIG+DFK++TI +DG K KL IW T  Q+
Sbjct: 10  KILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWVTLHQQ 68



 Score = 65.7 bits (153), Expect = 2e-10
 Identities = 32/88 (36%), Positives = 53/88 (60%), Gaps = 1/88 (1%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASA-DVEKMILGNKCDLDSQRQVSKE 423
           S  RG+ G++LVYDVT   +F  + NW+  +E   +  D+  M++GNK D ++ R+V + 
Sbjct: 105 SYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKEN-REVDRN 163

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAF 507
            G + A ++ + F+E SAK    V+ AF
Sbjct: 164 EGLKFARKHSMLFIEASAKTCDGVQCAF 191


>AF133588-1|AAF02485.1|  333|Homo sapiens RAB36 protein.
          Length = 333

 Score = 77.0 bits (181), Expect = 7e-14
 Identities = 33/70 (47%), Positives = 51/70 (72%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           L K++++GD  VGKTS++ RF ++ F+  + +TIG+DF+I   ++ G    LQIWDTAGQ
Sbjct: 123 LSKVVVVGDLYVGKTSLIHRFCKNVFDRDYKATIGVDFEIERFEIAGIPYSLQIWDTAGQ 182

Query: 224 ERFRTITTAY 253
           E+F+ I +AY
Sbjct: 183 EKFKCIASAY 192



 Score = 40.3 bits (90), Expect = 0.007
 Identities = 25/88 (28%), Positives = 45/88 (51%), Gaps = 3/88 (3%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRN-IEENASADVEKMILGNKCDLDSQRQVSKERGE 432
           RG+  I+  +D+T+ ++ E+ + W+ + + EN +      ++G K DL S     +   +
Sbjct: 194 RGAQVIITAFDLTDVQTLEHTRQWLEDALRENEAGSCFIFLVGTKKDLLSGAACEQAEAD 253

Query: 433 --QLAIEYQIKFVETSAKDSLNVEYAFS 510
              LA E Q ++   SAK   NV+  FS
Sbjct: 254 AVHLAREMQAEYWSVSAKTGENVKAFFS 281


>AB023061-1|BAA75195.1|  333|Homo sapiens small GTP-binding protein
           Rab36 protein.
          Length = 333

 Score = 77.0 bits (181), Expect = 7e-14
 Identities = 33/70 (47%), Positives = 51/70 (72%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           L K++++GD  VGKTS++ RF ++ F+  + +TIG+DF+I   ++ G    LQIWDTAGQ
Sbjct: 123 LSKVVVVGDLYVGKTSLIHRFCKNVFDRDYKATIGVDFEIERFEIAGIPYSLQIWDTAGQ 182

Query: 224 ERFRTITTAY 253
           E+F+ I +AY
Sbjct: 183 EKFKCIASAY 192



 Score = 40.3 bits (90), Expect = 0.007
 Identities = 25/88 (28%), Positives = 45/88 (51%), Gaps = 3/88 (3%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRN-IEENASADVEKMILGNKCDLDSQRQVSKERGE 432
           RG+  I+  +D+T+ ++ E+ + W+ + + EN +      ++G K DL S     +   +
Sbjct: 194 RGAQVIITAFDLTDVQTLEHTRQWLEDALRENEAGSCFIFLVGTKKDLLSGAACEQAEAD 253

Query: 433 --QLAIEYQIKFVETSAKDSLNVEYAFS 510
              LA E Q ++   SAK   NV+  FS
Sbjct: 254 AVHLAREMQAEYWSVSAKTGENVKAFFS 281


>U71127-1|AAB09599.1|  225|Homo sapiens low Mr GTP-binding protein
           Rab32 protein.
          Length = 225

 Score = 76.6 bits (180), Expect = 9e-14
 Identities = 35/76 (46%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKK-VKLQI 205
           +T + LFK+L+IG+ GVGKTSI+ R+    F+  + +TIG+DF ++ ++ D +  V+LQ+
Sbjct: 20  ETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQL 79

Query: 206 WDTAGQERFRTITTAY 253
           WD AGQERF  +T  Y
Sbjct: 80  WDIAGQERFGNMTRVY 95



 Score = 47.2 bits (107), Expect = 6e-05
 Identities = 23/86 (26%), Positives = 46/86 (53%), Gaps = 5/86 (5%)
 Frame = +1

Query: 262 SMGIMLVYDVTNEKSFENIKNWIRNIEENA----SADVEKMILGNKCDLDSQRQVSKERG 429
           ++G  +V+D++   +FE +  W  +++        + +  ++L NKCD +     S  + 
Sbjct: 99  AVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVLLANKCDQNKDSSQSPSQV 158

Query: 430 EQLAIEYQIK-FVETSAKDSLNVEYA 504
           +Q   E+    + ETSAKD++N+E A
Sbjct: 159 DQFCKEHGFAGWFETSAKDNINIEEA 184


>U59878-1|AAB02833.1|  210|Homo sapiens low-Mr GTP-binding protein
           Rab32 protein.
          Length = 210

 Score = 76.6 bits (180), Expect = 9e-14
 Identities = 35/76 (46%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKK-VKLQI 205
           +T + LFK+L+IG+ GVGKTSI+ R+    F+  + +TIG+DF ++ ++ D +  V+LQ+
Sbjct: 5   ETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQL 64

Query: 206 WDTAGQERFRTITTAY 253
           WD AGQERF  +T  Y
Sbjct: 65  WDIAGQERFGNMTRVY 80



 Score = 47.2 bits (107), Expect = 6e-05
 Identities = 23/86 (26%), Positives = 46/86 (53%), Gaps = 5/86 (5%)
 Frame = +1

Query: 262 SMGIMLVYDVTNEKSFENIKNWIRNIEENA----SADVEKMILGNKCDLDSQRQVSKERG 429
           ++G  +V+D++   +FE +  W  +++        + +  ++L NKCD +     S  + 
Sbjct: 84  AVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVLLANKCDQNKDSSQSPSQV 143

Query: 430 EQLAIEYQIK-FVETSAKDSLNVEYA 504
           +Q   E+    + ETSAKD++N+E A
Sbjct: 144 DQFCKEHGFAGWFETSAKDNINIEEA 169


>BT020016-1|AAV38819.1|  225|Homo sapiens RAB32, member RAS oncogene
           family protein.
          Length = 225

 Score = 76.6 bits (180), Expect = 9e-14
 Identities = 35/76 (46%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKK-VKLQI 205
           +T + LFK+L+IG+ GVGKTSI+ R+    F+  + +TIG+DF ++ ++ D +  V+LQ+
Sbjct: 20  ETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQL 79

Query: 206 WDTAGQERFRTITTAY 253
           WD AGQERF  +T  Y
Sbjct: 80  WDIAGQERFGNMTRVY 95



 Score = 47.2 bits (107), Expect = 6e-05
 Identities = 23/86 (26%), Positives = 46/86 (53%), Gaps = 5/86 (5%)
 Frame = +1

Query: 262 SMGIMLVYDVTNEKSFENIKNWIRNIEENA----SADVEKMILGNKCDLDSQRQVSKERG 429
           ++G  +V+D++   +FE +  W  +++        + +  ++L NKCD +     S  + 
Sbjct: 99  AVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVLLANKCDQNKDSSQSPSQV 158

Query: 430 EQLAIEYQIK-FVETSAKDSLNVEYA 504
           +Q   E+    + ETSAKD++N+E A
Sbjct: 159 DQFCKEHGFAGWFETSAKDNINIEEA 184


>BC015061-1|AAH15061.1|  225|Homo sapiens RAB32, member RAS oncogene
           family protein.
          Length = 225

 Score = 76.6 bits (180), Expect = 9e-14
 Identities = 35/76 (46%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKK-VKLQI 205
           +T + LFK+L+IG+ GVGKTSI+ R+    F+  + +TIG+DF ++ ++ D +  V+LQ+
Sbjct: 20  ETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQL 79

Query: 206 WDTAGQERFRTITTAY 253
           WD AGQERF  +T  Y
Sbjct: 80  WDIAGQERFGNMTRVY 95



 Score = 47.2 bits (107), Expect = 6e-05
 Identities = 23/86 (26%), Positives = 46/86 (53%), Gaps = 5/86 (5%)
 Frame = +1

Query: 262 SMGIMLVYDVTNEKSFENIKNWIRNIEENA----SADVEKMILGNKCDLDSQRQVSKERG 429
           ++G  +V+D++   +FE +  W  +++        + +  ++L NKCD +     S  + 
Sbjct: 99  AVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVLLANKCDQNKDSSQSPSQV 158

Query: 430 EQLAIEYQIK-FVETSAKDSLNVEYA 504
           +Q   E+    + ETSAKD++N+E A
Sbjct: 159 DQFCKEHGFAGWFETSAKDNINIEEA 184


>AL133539-1|CAC34968.1|  225|Homo sapiens RAB32, member RAS oncogene
           family protein.
          Length = 225

 Score = 76.6 bits (180), Expect = 9e-14
 Identities = 35/76 (46%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKK-VKLQI 205
           +T + LFK+L+IG+ GVGKTSI+ R+    F+  + +TIG+DF ++ ++ D +  V+LQ+
Sbjct: 20  ETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQL 79

Query: 206 WDTAGQERFRTITTAY 253
           WD AGQERF  +T  Y
Sbjct: 80  WDIAGQERFGNMTRVY 95



 Score = 47.2 bits (107), Expect = 6e-05
 Identities = 23/86 (26%), Positives = 46/86 (53%), Gaps = 5/86 (5%)
 Frame = +1

Query: 262 SMGIMLVYDVTNEKSFENIKNWIRNIEENA----SADVEKMILGNKCDLDSQRQVSKERG 429
           ++G  +V+D++   +FE +  W  +++        + +  ++L NKCD +     S  + 
Sbjct: 99  AVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVLLANKCDQNKDSSQSPSQV 158

Query: 430 EQLAIEYQIK-FVETSAKDSLNVEYA 504
           +Q   E+    + ETSAKD++N+E A
Sbjct: 159 DQFCKEHGFAGWFETSAKDNINIEEA 184


>AF498958-1|AAM21106.1|  225|Homo sapiens small GTP binding protein
           RAB32 protein.
          Length = 225

 Score = 76.6 bits (180), Expect = 9e-14
 Identities = 35/76 (46%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKK-VKLQI 205
           +T + LFK+L+IG+ GVGKTSI+ R+    F+  + +TIG+DF ++ ++ D +  V+LQ+
Sbjct: 20  ETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQL 79

Query: 206 WDTAGQERFRTITTAY 253
           WD AGQERF  +T  Y
Sbjct: 80  WDIAGQERFGNMTRVY 95



 Score = 47.2 bits (107), Expect = 6e-05
 Identities = 23/86 (26%), Positives = 46/86 (53%), Gaps = 5/86 (5%)
 Frame = +1

Query: 262 SMGIMLVYDVTNEKSFENIKNWIRNIEENA----SADVEKMILGNKCDLDSQRQVSKERG 429
           ++G  +V+D++   +FE +  W  +++        + +  ++L NKCD +     S  + 
Sbjct: 99  AVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVLLANKCDQNKDSSQSPSQV 158

Query: 430 EQLAIEYQIK-FVETSAKDSLNVEYA 504
           +Q   E+    + ETSAKD++N+E A
Sbjct: 159 DQFCKEHGFAGWFETSAKDNINIEEA 184


>AF050175-1|AAD02565.1|  207|Homo sapiens Rab7 protein.
          Length = 207

 Score = 76.2 bits (179), Expect = 1e-13
 Identities = 32/70 (45%), Positives = 52/70 (74%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           L K++++GDSGVGKTS++ ++    F+  + +TIG DF I+ + +D + V +QIWDTAGQ
Sbjct: 8   LLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLIKEVMVDDRLVTMQIWDTAGQ 67

Query: 224 ERFRTITTAY 253
           ERF+++  A+
Sbjct: 68  ERFQSLGVAF 77



 Score = 51.6 bits (118), Expect = 3e-06
 Identities = 34/89 (38%), Positives = 53/89 (59%), Gaps = 5/89 (5%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASA-DVEK---MILGNKCDLDSQRQVSKE 423
           RG+   +LV+DVT   +F+ + +W       AS  D E    ++LGNK DL++ RQV+ +
Sbjct: 79  RGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLEN-RQVATK 137

Query: 424 RGEQLAI-EYQIKFVETSAKDSLNVEYAF 507
           R +     +  I + ETSAK+++NVE AF
Sbjct: 138 RAQAWCYSKNNIPYFETSAKEAINVEQAF 166


>M28215-1|AAA60245.1|  215|Homo sapiens GTP-binding protein protein.
          Length = 215

 Score = 75.8 bits (178), Expect = 2e-13
 Identities = 33/84 (39%), Positives = 53/84 (63%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+   ++VYD+TNE+SF   KNW++ ++  AS ++   + GNK DL ++R V  +  + 
Sbjct: 91  RGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQS 150

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A +  + F+ETSAK S+NV   F
Sbjct: 151 YADDNSLLFMETSAKTSMNVNEIF 174



 Score = 70.9 bits (166), Expect = 5e-12
 Identities = 33/71 (46%), Positives = 47/71 (66%)
 Frame = +2

Query: 41  CLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAG 220
           C FKL+L+G+S VGK+S++ RF +  F+    STIG  F  +T+ LD   VK +IWDTAG
Sbjct: 19  CQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAG 78

Query: 221 QERFRTITTAY 253
           QE + ++   Y
Sbjct: 79  QEGYHSLAPMY 89


>CR536492-1|CAG38731.1|  215|Homo sapiens RAB5A protein.
          Length = 215

 Score = 75.8 bits (178), Expect = 2e-13
 Identities = 33/84 (39%), Positives = 53/84 (63%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+   ++VYD+TNE+SF   KNW++ ++  AS ++   + GNK DL ++R V  +  + 
Sbjct: 91  RGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQS 150

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A +  + F+ETSAK S+NV   F
Sbjct: 151 YADDNSLLFMETSAKTSMNVNEIF 174



 Score = 73.7 bits (173), Expect = 6e-13
 Identities = 34/71 (47%), Positives = 48/71 (67%)
 Frame = +2

Query: 41  CLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAG 220
           C FKL+L+G+S VGK+S++ RF +  F+    STIG  F  +T+ LD   VK +IWDTAG
Sbjct: 19  CQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAG 78

Query: 221 QERFRTITTAY 253
           QER+ ++   Y
Sbjct: 79  QERYHSLAPMY 89


>BC018288-1|AAH18288.1|  215|Homo sapiens RAB5A, member RAS oncogene
           family protein.
          Length = 215

 Score = 75.8 bits (178), Expect = 2e-13
 Identities = 33/84 (39%), Positives = 53/84 (63%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+   ++VYD+TNE+SF   KNW++ ++  AS ++   + GNK DL ++R V  +  + 
Sbjct: 91  RGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQS 150

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A +  + F+ETSAK S+NV   F
Sbjct: 151 YADDNSLLFMETSAKTSMNVNEIF 174



 Score = 73.7 bits (173), Expect = 6e-13
 Identities = 34/71 (47%), Positives = 48/71 (67%)
 Frame = +2

Query: 41  CLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAG 220
           C FKL+L+G+S VGK+S++ RF +  F+    STIG  F  +T+ LD   VK +IWDTAG
Sbjct: 19  CQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAG 78

Query: 221 QERFRTITTAY 253
           QER+ ++   Y
Sbjct: 79  QERYHSLAPMY 89


>BC001267-1|AAH01267.1|  215|Homo sapiens RAB5A, member RAS oncogene
           family protein.
          Length = 215

 Score = 75.8 bits (178), Expect = 2e-13
 Identities = 33/84 (39%), Positives = 53/84 (63%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+   ++VYD+TNE+SF   KNW++ ++  AS ++   + GNK DL ++R V  +  + 
Sbjct: 91  RGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQS 150

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A +  + F+ETSAK S+NV   F
Sbjct: 151 YADDNSLLFMETSAKTSMNVNEIF 174



 Score = 73.7 bits (173), Expect = 6e-13
 Identities = 34/71 (47%), Positives = 48/71 (67%)
 Frame = +2

Query: 41  CLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAG 220
           C FKL+L+G+S VGK+S++ RF +  F+    STIG  F  +T+ LD   VK +IWDTAG
Sbjct: 19  CQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAG 78

Query: 221 QERFRTITTAY 253
           QER+ ++   Y
Sbjct: 79  QERYHSLAPMY 89


>AF498936-1|AAM21084.1|  215|Homo sapiens small GTP binding protein
           RAB5A protein.
          Length = 215

 Score = 75.8 bits (178), Expect = 2e-13
 Identities = 33/84 (39%), Positives = 53/84 (63%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+   ++VYD+TNE+SF   KNW++ ++  AS ++   + GNK DL ++R V  +  + 
Sbjct: 91  RGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQS 150

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A +  + F+ETSAK S+NV   F
Sbjct: 151 YADDNSLLFMETSAKTSMNVNEIF 174



 Score = 73.7 bits (173), Expect = 6e-13
 Identities = 34/71 (47%), Positives = 48/71 (67%)
 Frame = +2

Query: 41  CLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAG 220
           C FKL+L+G+S VGK+S++ RF +  F+    STIG  F  +T+ LD   VK +IWDTAG
Sbjct: 19  CQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAG 78

Query: 221 QERFRTITTAY 253
           QER+ ++   Y
Sbjct: 79  QERYHSLAPMY 89


>AF464088-1|AAO15677.1|  215|Homo sapiens cervical cancer oncogene
           10 protein protein.
          Length = 215

 Score = 75.8 bits (178), Expect = 2e-13
 Identities = 33/84 (39%), Positives = 53/84 (63%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+   ++VYD+TNE+SF   KNW++ ++  AS ++   + GNK DL ++R V  +  + 
Sbjct: 91  RGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQS 150

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A +  + F+ETSAK S+NV   F
Sbjct: 151 YADDNSLLFMETSAKTSMNVNEIF 174



 Score = 73.7 bits (173), Expect = 6e-13
 Identities = 34/71 (47%), Positives = 48/71 (67%)
 Frame = +2

Query: 41  CLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAG 220
           C FKL+L+G+S VGK+S++ RF +  F+    STIG  F  +T+ LD   VK +IWDTAG
Sbjct: 19  CQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAG 78

Query: 221 QERFRTITTAY 253
           QER+ ++   Y
Sbjct: 79  QERYHSLAPMY 89


>Z69733-1|CAI41993.1|  277|Homo sapiens RAB40A, member RAS oncogene
           family protein.
          Length = 277

 Score = 75.4 bits (177), Expect = 2e-13
 Identities = 37/76 (48%), Positives = 49/76 (64%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           + YD L K LL+GD  VGK+ IL    + A    +    GID+K  TI LDG++VKL++W
Sbjct: 9   QAYDFLLKFLLVGDRDVGKSEILESLQDGAAESPYSHLGGIDYKTTTILLDGQRVKLKLW 68

Query: 209 DTAGQERFRTITTAYS 256
           DT+GQ RF TI  +YS
Sbjct: 69  DTSGQGRFCTIFRSYS 84



 Score = 66.9 bits (156), Expect = 7e-11
 Identities = 33/88 (37%), Positives = 53/88 (60%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G++LVYD+ N  SFE +  WI+ IEE+A   V K+++GN+  L  +RQV +E+
Sbjct: 82  SYSRGAQGVILVYDIANRWSFEGMDRWIKKIEEHAPG-VPKILVGNRLHLAFKRQVPREQ 140

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAFS 510
            +  A    + F E S   + N+  +F+
Sbjct: 141 AQAYAERLGVTFFEVSPLCNFNIIESFT 168


>BC117232-1|AAI17233.1|  277|Homo sapiens RAB40A, member RAS
           oncogene family protein.
          Length = 277

 Score = 75.4 bits (177), Expect = 2e-13
 Identities = 37/76 (48%), Positives = 49/76 (64%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           + YD L K LL+GD  VGK+ IL    + A    +    GID+K  TI LDG++VKL++W
Sbjct: 9   QAYDFLLKFLLVGDRDVGKSEILESLQDGAAESPYSHLGGIDYKTTTILLDGQRVKLKLW 68

Query: 209 DTAGQERFRTITTAYS 256
           DT+GQ RF TI  +YS
Sbjct: 69  DTSGQGRFCTIFRSYS 84



 Score = 66.9 bits (156), Expect = 7e-11
 Identities = 33/88 (37%), Positives = 53/88 (60%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G++LVYD+ N  SFE +  WI+ IEE+A   V K+++GN+  L  +RQV +E+
Sbjct: 82  SYSRGAQGVILVYDIANRWSFEGMDRWIKKIEEHAPG-VPKILVGNRLHLAFKRQVPREQ 140

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAFS 510
            +  A    + F E S   + N+  +F+
Sbjct: 141 AQAYAERLGVTFFEVSPLCNFNIIESFT 168


>BC113501-1|AAI13502.1|  277|Homo sapiens RAB40A, member RAS
           oncogene family protein.
          Length = 277

 Score = 75.4 bits (177), Expect = 2e-13
 Identities = 37/76 (48%), Positives = 49/76 (64%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           + YD L K LL+GD  VGK+ IL    + A    +    GID+K  TI LDG++VKL++W
Sbjct: 9   QAYDFLLKFLLVGDRDVGKSEILESLQDGAAESPYSHLGGIDYKTTTILLDGQRVKLKLW 68

Query: 209 DTAGQERFRTITTAYS 256
           DT+GQ RF TI  +YS
Sbjct: 69  DTSGQGRFCTIFRSYS 84



 Score = 66.9 bits (156), Expect = 7e-11
 Identities = 33/88 (37%), Positives = 53/88 (60%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G++LVYD+ N  SFE +  WI+ IEE+A   V K+++GN+  L  +RQV +E+
Sbjct: 82  SYSRGAQGVILVYDIANRWSFEGMDRWIKKIEEHAPG-VPKILVGNRLHLAFKRQVPREQ 140

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAFS 510
            +  A    + F E S   + N+  +F+
Sbjct: 141 AQAYAERLGVTFFEVSPLCNFNIIESFT 168


>BC074855-1|AAH74855.1|  277|Homo sapiens RAB40A, member RAS
           oncogene family protein.
          Length = 277

 Score = 75.4 bits (177), Expect = 2e-13
 Identities = 37/76 (48%), Positives = 49/76 (64%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           + YD L K LL+GD  VGK+ IL    + A    +    GID+K  TI LDG++VKL++W
Sbjct: 9   QAYDFLLKFLLVGDRDVGKSEILESLQDGAAESPYSHLGGIDYKTTTILLDGQRVKLKLW 68

Query: 209 DTAGQERFRTITTAYS 256
           DT+GQ RF TI  +YS
Sbjct: 69  DTSGQGRFCTIFRSYS 84



 Score = 66.9 bits (156), Expect = 7e-11
 Identities = 33/88 (37%), Positives = 53/88 (60%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G++LVYD+ N  SFE +  WI+ IEE+A   V K+++GN+  L  +RQV +E+
Sbjct: 82  SYSRGAQGVILVYDIANRWSFEGMDRWIKKIEEHAPG-VPKILVGNRLHLAFKRQVPREQ 140

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAFS 510
            +  A    + F E S   + N+  +F+
Sbjct: 141 AQAYAERLGVTFFEVSPLCNFNIIESFT 168


>BC074854-1|AAH74854.1|  277|Homo sapiens RAB40A, member RAS
           oncogene family protein.
          Length = 277

 Score = 75.4 bits (177), Expect = 2e-13
 Identities = 37/76 (48%), Positives = 49/76 (64%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           + YD L K LL+GD  VGK+ IL    + A    +    GID+K  TI LDG++VKL++W
Sbjct: 9   QAYDFLLKFLLVGDRDVGKSEILESLQDGAAESPYSHLGGIDYKTTTILLDGQRVKLKLW 68

Query: 209 DTAGQERFRTITTAYS 256
           DT+GQ RF TI  +YS
Sbjct: 69  DTSGQGRFCTIFRSYS 84



 Score = 66.9 bits (156), Expect = 7e-11
 Identities = 33/88 (37%), Positives = 53/88 (60%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G++LVYD+ N  SFE +  WI+ IEE+A   V K+++GN+  L  +RQV +E+
Sbjct: 82  SYSRGAQGVILVYDIANRWSFEGMDRWIKKIEEHAPG-VPKILVGNRLHLAFKRQVPREQ 140

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAFS 510
            +  A    + F E S   + N+  +F+
Sbjct: 141 AQAYAERLGVTFFEVSPLCNFNIIESFT 168


>AF422143-1|AAL60514.1|  278|Homo sapiens SOCS box containing
           protein RAR2A protein.
          Length = 278

 Score = 75.4 bits (177), Expect = 2e-13
 Identities = 37/76 (48%), Positives = 49/76 (64%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           + YD L K LL+GD  VGK+ IL    + A    +    GID+K  TI LDG++VKL++W
Sbjct: 9   QAYDFLLKFLLVGDRDVGKSEILESLQDGAAESPYSHLGGIDYKTTTILLDGQRVKLKLW 68

Query: 209 DTAGQERFRTITTAYS 256
           DT+GQ RF TI  +YS
Sbjct: 69  DTSGQGRFCTIFRSYS 84



 Score = 66.9 bits (156), Expect = 7e-11
 Identities = 33/88 (37%), Positives = 53/88 (60%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G++LVYD+ N  SFE +  WI+ IEE+A   V K+++GN+  L  +RQV +E+
Sbjct: 82  SYSRGAQGVILVYDIANRWSFEGMDRWIKKIEEHAPG-VPKILVGNRLHLAFKRQVPREQ 140

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAFS 510
            +  A    + F E S   + N+  +F+
Sbjct: 141 AQAYAERLGVTFFEVSPLCNFNIIESFT 168


>AF132748-1|AAL75949.1|  277|Homo sapiens Rar-2 protein protein.
          Length = 277

 Score = 75.4 bits (177), Expect = 2e-13
 Identities = 37/76 (48%), Positives = 49/76 (64%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           + YD L K LL+GD  VGK+ IL    + A    +    GID+K  TI LDG++VKL++W
Sbjct: 9   QAYDFLLKFLLVGDRDVGKSEILESLQDGAAESPYSHLGGIDYKTTTILLDGQRVKLKLW 68

Query: 209 DTAGQERFRTITTAYS 256
           DT+GQ RF TI  +YS
Sbjct: 69  DTSGQGRFCTIFRSYS 84



 Score = 66.9 bits (156), Expect = 7e-11
 Identities = 33/88 (37%), Positives = 53/88 (60%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G++LVYD+ N  SFE +  WI+ IEE+A   V K+++GN+  L  +RQV +E+
Sbjct: 82  SYSRGAQGVILVYDIANRWSFEGMDRWIKKIEEHAPG-VPKILVGNRLHLAFKRQVPREQ 140

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAFS 510
            +  A    + F E S   + N+  +F+
Sbjct: 141 AQAYAERLGVTFFEVSPLCNFNIIESFT 168


>AB232637-1|BAF02899.1|  277|Homo sapiens Rab40A protein.
          Length = 277

 Score = 75.4 bits (177), Expect = 2e-13
 Identities = 37/76 (48%), Positives = 49/76 (64%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           + YD L K LL+GD  VGK+ IL    + A    +    GID+K  TI LDG++VKL++W
Sbjct: 9   QAYDFLLKFLLVGDRDVGKSEILESLQDGAAESPYSHLGGIDYKTTTILLDGQRVKLKLW 68

Query: 209 DTAGQERFRTITTAYS 256
           DT+GQ RF TI  +YS
Sbjct: 69  DTSGQGRFCTIFRSYS 84



 Score = 66.9 bits (156), Expect = 7e-11
 Identities = 33/88 (37%), Positives = 53/88 (60%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G++LVYD+ N  SFE +  WI+ IEE+A   V K+++GN+  L  +RQV +E+
Sbjct: 82  SYSRGAQGVILVYDIANRWSFEGMDRWIKKIEEHAPG-VPKILVGNRLHLAFKRQVPREQ 140

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAFS 510
            +  A    + F E S   + N+  +F+
Sbjct: 141 AQAYAERLGVTFFEVSPLCNFNIIESFT 168


>DQ178619-1|ABA03166.1|  211|Homo sapiens RAB38, member RAS oncogene
           family protein.
          Length = 211

 Score = 74.9 bits (176), Expect = 3e-13
 Identities = 35/71 (49%), Positives = 50/71 (70%), Gaps = 1/71 (1%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKK-VKLQIWDTAG 220
           L+KLL+IGD GVGKTSI+ R+    F+  + +TIG+DF ++ +  D +  V+LQ+WD AG
Sbjct: 9   LYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALKVLHWDPETVVRLQLWDIAG 68

Query: 221 QERFRTITTAY 253
           QERF  +T  Y
Sbjct: 69  QERFGNMTRVY 79



 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 26/89 (29%), Positives = 48/89 (53%), Gaps = 6/89 (6%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENAS----ADVEKMILGNKCDLDSQRQVSKE 423
           R +MG  +V+DVT   +FE +  W  +++   S      V  ++L NKCD      ++  
Sbjct: 81  REAMGAFIVFDVTRPATFEAVAKWKNDLDSKLSLPNGKPVSVVLLANKCDQGKDVLMNNG 140

Query: 424 -RGEQLAIEYQ-IKFVETSAKDSLNVEYA 504
            + +Q   E+  + + ETSAK+++N++ A
Sbjct: 141 LKMDQFCKEHGFVGWFETSAKENINIDEA 169


>BT009842-1|AAP88844.1|  211|Homo sapiens RAB38, member RAS oncogene
           family protein.
          Length = 211

 Score = 74.9 bits (176), Expect = 3e-13
 Identities = 35/71 (49%), Positives = 50/71 (70%), Gaps = 1/71 (1%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKK-VKLQIWDTAG 220
           L+KLL+IGD GVGKTSI+ R+    F+  + +TIG+DF ++ +  D +  V+LQ+WD AG
Sbjct: 9   LYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALKVLHWDPETVVRLQLWDIAG 68

Query: 221 QERFRTITTAY 253
           QERF  +T  Y
Sbjct: 69  QERFGNMTRVY 79



 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 26/89 (29%), Positives = 48/89 (53%), Gaps = 6/89 (6%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENAS----ADVEKMILGNKCDLDSQRQVSKE 423
           R +MG  +V+DVT   +FE +  W  +++   S      V  ++L NKCD      ++  
Sbjct: 81  REAMGAFIVFDVTRPATFEAVAKWKNDLDSKLSLPNGKPVSVVLLANKCDQGKDVLMNNG 140

Query: 424 -RGEQLAIEYQ-IKFVETSAKDSLNVEYA 504
            + +Q   E+  + + ETSAK+++N++ A
Sbjct: 141 LKMDQFCKEHGFVGWFETSAKENINIDEA 169


>BC015808-1|AAH15808.1|  211|Homo sapiens RAB38, member RAS oncogene
           family protein.
          Length = 211

 Score = 74.9 bits (176), Expect = 3e-13
 Identities = 35/71 (49%), Positives = 50/71 (70%), Gaps = 1/71 (1%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKK-VKLQIWDTAG 220
           L+KLL+IGD GVGKTSI+ R+    F+  + +TIG+DF ++ +  D +  V+LQ+WD AG
Sbjct: 9   LYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALKVLHWDPETVVRLQLWDIAG 68

Query: 221 QERFRTITTAY 253
           QERF  +T  Y
Sbjct: 69  QERFGNMTRVY 79



 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 26/89 (29%), Positives = 48/89 (53%), Gaps = 6/89 (6%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENAS----ADVEKMILGNKCDLDSQRQVSKE 423
           R +MG  +V+DVT   +FE +  W  +++   S      V  ++L NKCD      ++  
Sbjct: 81  REAMGAFIVFDVTRPATFEAVAKWKNDLDSKLSLPNGKPVSVVLLANKCDQGKDVLMNNG 140

Query: 424 -RGEQLAIEYQ-IKFVETSAKDSLNVEYA 504
            + +Q   E+  + + ETSAK+++N++ A
Sbjct: 141 LKMDQFCKEHGFVGWFETSAKENINIDEA 169


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 111,335,886
Number of Sequences: 237096
Number of extensions: 2358200
Number of successful extensions: 7473
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 6114
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6923
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 9144232952
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -