SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20001
         (745 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Y00371-1|CAA68445.1|  646|Homo sapiens 71 Kd heat shock cognate ...   206   5e-53
BC019816-1|AAH19816.1|  646|Homo sapiens heat shock 70kDa protei...   206   5e-53
BC016660-1|AAH16660.1|  646|Homo sapiens heat shock 70kDa protei...   206   5e-53
BC016179-1|AAH16179.1|  646|Homo sapiens heat shock 70kDa protei...   206   5e-53
AK222628-1|BAD96348.1|  493|Homo sapiens heat shock 70kDa protei...   206   5e-53
AF352832-1|AAK17898.1|  646|Homo sapiens constitutive heat shock...   206   5e-53
AB034951-1|BAB18615.1|  493|Homo sapiens heat shock cognate prot...   206   5e-53
AK222785-1|BAD96505.1|  646|Homo sapiens heat shock 70kDa protei...   205   1e-52
M11717-1|AAA52697.1|  640|Homo sapiens heat shock protein protein.    203   5e-52
M59830-1|AAA63227.1|  641|Homo sapiens heat shock-induced protei...   203   6e-52
M59828-1|AAA63226.1|  641|Homo sapiens heat shock-induced protei...   203   6e-52
DQ451402-1|ABD96830.1|  641|Homo sapiens heat shock 70kDa protei...   203   6e-52
DQ388429-1|ABD48956.1|  641|Homo sapiens heat shock 70kDa protei...   203   6e-52
BC063507-1|AAH63507.1|  641|Homo sapiens heat shock 70kDa protei...   203   6e-52
BC057397-1|AAH57397.1|  641|Homo sapiens heat shock 70kDa protei...   203   6e-52
BC018740-1|AAH18740.1|  641|Homo sapiens HSPA1A protein protein.      203   6e-52
BC009322-1|AAH09322.1|  641|Homo sapiens HSPA1A protein protein.      203   6e-52
BC002453-1|AAH02453.1|  641|Homo sapiens heat shock 70kDa protei...   203   6e-52
BA000025-9|BAB63300.1|  641|Homo sapiens heat shock protein prot...   203   6e-52
BA000025-8|BAB63299.1|  641|Homo sapiens heat shock protein prot...   203   6e-52
AL929592-7|CAI18466.1|  641|Homo sapiens heat shock 70kDa protei...   203   6e-52
AL671762-7|CAI18217.1|  641|Homo sapiens heat shock 70kDa protei...   203   6e-52
AL671762-6|CAI18216.1|  641|Homo sapiens heat shock 70kDa protei...   203   6e-52
AL662834-18|CAI17738.1|  641|Homo sapiens heat shock 70kDa prote...   203   6e-52
AL662834-17|CAI17737.1|  641|Homo sapiens heat shock 70kDa prote...   203   6e-52
AF134726-6|AAD21815.1|  641|Homo sapiens HSP70-2 protein.             203   6e-52
AL929592-5|CAI18464.1|  641|Homo sapiens heat shock 70kDa protei...   202   8e-52
AF134726-7|AAD21816.1|  641|Homo sapiens HSP70-1 protein.             202   8e-52
AB209818-1|BAD93055.1|  709|Homo sapiens heat shock 70kDa protei...   202   8e-52
U56725-1|AAD11466.1|  639|Homo sapiens heat shock protein protein.    202   1e-51
L26336-1|AAA52698.1|  639|Homo sapiens heat shock protein protein.    202   1e-51
DQ489378-1|ABE96830.1|  639|Homo sapiens heat shock 70kDa protei...   202   1e-51
BT009815-1|AAP88817.1|  639|Homo sapiens heat shock 70kDa protei...   202   1e-51
BC001752-1|AAH01752.1|  639|Homo sapiens heat shock 70kDa protei...   202   1e-51
BC036107-1|AAH36107.1|  639|Homo sapiens HSPA2 protein protein.       199   1e-50
M59829-1|AAA63228.1|  641|Homo sapiens heat shock-induced protei...   196   5e-50
D85730-1|BAA32521.1|  641|Homo sapiens Heat shock protein 70 tes...   196   5e-50
DQ383515-1|ABC88476.1|  641|Homo sapiens heat shock 70kDa protei...   196   5e-50
BC034483-1|AAH34483.1|  641|Homo sapiens heat shock 70kDa protei...   196   5e-50
BA000025-10|BAB63301.1|  641|Homo sapiens heat shock protein pro...   196   5e-50
AL929592-4|CAI18463.1|  641|Homo sapiens heat shock 70kDa protei...   196   5e-50
AL671762-4|CAI18215.1|  641|Homo sapiens heat shock 70kDa protei...   196   5e-50
AL662834-15|CAI17736.1|  641|Homo sapiens heat shock 70kDa prote...   196   5e-50
AK223386-1|BAD97106.1|  641|Homo sapiens heat shock 70kDa protei...   196   5e-50
AF134726-8|AAD21817.1|  641|Homo sapiens HSP70-HOM protein.           196   5e-50
X87949-1|CAA61201.1|  653|Homo sapiens BiP protein.                   169   9e-42
M19645-1|AAA52614.1|  653|Homo sapiens protein ( Human 78 kdalto...   169   9e-42
DQ385847-1|ABD04090.1|  654|Homo sapiens heat shock 70kDa protei...   169   9e-42
BC112963-1|AAI12964.1|  655|Homo sapiens HSPA5 protein protein.       169   9e-42
BC020235-1|AAH20235.1|  654|Homo sapiens heat shock 70kDa protei...   169   9e-42
AJ271729-1|CAB71335.1|  654|Homo sapiens glucose-regulated prote...   169   9e-42
AF216292-1|AAF42836.1|  654|Homo sapiens endoplasmic reticulum l...   169   9e-42
AF188611-1|AAF13605.1|  639|Homo sapiens BiP protein protein.         169   9e-42
M11236-1|AAA52696.1|  247|Homo sapiens HSPA1L protein.                142   1e-33
DQ521571-1|ABF47108.1|  643|Homo sapiens heat shock 70kDa protei...   141   2e-33
BC035665-1|AAH35665.1|  643|Homo sapiens heat shock 70kDa protei...   141   2e-33
AL590385-3|CAI16120.1|  643|Homo sapiens heat shock 70kDa protei...   141   2e-33
AK223362-1|BAD97082.1|  643|Homo sapiens heat shock 70kDa protei...   141   2e-33
X51757-1|CAA36061.1|  643|Homo sapiens protein ( Human heat-shoc...   140   4e-33
BC007276-1|AAH07276.2|  587|Homo sapiens HSPA8 protein protein.       134   4e-31
U10149-1|AAC50076.1|  125|Homo sapiens heat shock protein protein.    123   6e-28
L15189-1|AAA67526.1|  679|Homo sapiens MTHSP75 protein.               122   1e-27
DQ531046-1|ABF50973.1|  679|Homo sapiens heat shock 70kDa protei...   122   1e-27
BC030634-1|AAH30634.1|  681|Homo sapiens HSPA9 protein protein.       122   1e-27
BC024034-1|AAH24034.1|  679|Homo sapiens heat shock 70kDa protei...   122   1e-27
BC000478-1|AAH00478.1|  679|Homo sapiens heat shock 70kDa protei...   122   1e-27
AK222758-1|BAD96478.1|  679|Homo sapiens heat shock 70kDa protei...   122   1e-27
AB018045-1|BAA77235.1|  151|Homo sapiens heat shock protein 72 p...   101   3e-21
BC119690-1|AAI19691.1|  509|Homo sapiens heat shock 70kDa protei...    90   7e-18
AF112210-1|AAF17198.1|  509|Homo sapiens heat shock protein hsp7...    90   7e-18
AF143723-1|AAF66640.1|  509|Homo sapiens heat shock protein HSP6...    88   4e-17
DQ185038-1|ABD14419.1|  176|Homo sapiens heat shock 70 kDa prote...    81   5e-15
M24743-1|AAA59844.1|   36|Homo sapiens HSPA2 protein.                  76   1e-13
X67643-1|CAA47886.1|  474|Homo sapiens HS24/P52 protein.               69   1e-11
BC126124-1|AAI26125.1|  840|Homo sapiens heat shock 70kDa protei...    69   1e-11
BC126122-1|AAI26123.1|  840|Homo sapiens heat shock 70kDa protei...    69   1e-11
BC110861-1|AAI10862.1|  840|Homo sapiens heat shock 70kDa protei...    69   1e-11
AB209151-1|BAD92388.1|  782|Homo sapiens heat shock 70kDa protei...    69   1e-11
AB023420-1|BAA75062.1|  840|Homo sapiens apg-2 protein.                69   1e-11
L12723-1|AAA02807.1|  701|Homo sapiens heat shock protein 70 pro...    69   2e-11
EF197155-1|ABM69040.1|  839|Homo sapiens heat shock 70 kDa prote...    67   7e-11
BC040560-1|AAH40560.1|  839|Homo sapiens heat shock 70kDa protei...    67   7e-11
AY290862-1|AAP44471.1|  839|Homo sapiens heat shock protein apg-...    67   7e-11
AC093591-2|AAY40975.1|  839|Homo sapiens unknown protein.              67   7e-11
AB023421-1|BAA75063.1|  839|Homo sapiens apg-1 protein.                67   7e-11
D86956-1|BAA13192.2|  949|Homo sapiens KIAA0201 protein.               66   9e-11
BC037553-1|AAH37553.1|  858|Homo sapiens heat shock 105kDa/110kD...    66   9e-11
AL137142-5|CAI12430.1|  858|Homo sapiens heat shock 105kDa/110kD...    66   9e-11
AL137142-4|CAI12428.1|  814|Homo sapiens heat shock 105kDa/110kD...    66   9e-11
AF039695-1|AAC18044.1|  872|Homo sapiens antigen NY-CO-25 protein.     66   9e-11
AB003334-1|BAA34780.1|  858|Homo sapiens HSP105 alpha protein.         66   9e-11
AB003333-1|BAA34779.1|  814|Homo sapiens HSP105 beta protein.          66   9e-11
U04735-1|AAA16954.1|  471|Homo sapiens microsomal stress 70 prot...    66   2e-10
BC036370-1|AAH36370.1|  471|Homo sapiens stress 70 protein chape...    66   2e-10
AL163206-1|CAB90390.1|  471|Homo sapiens human microsomal stress...    66   2e-10
AF130249-1|AAD21091.1|  471|Homo sapiens STCH protein.                 66   2e-10
AK223282-1|BAD97002.1|  471|Homo sapiens stress 70 protein chape...    64   7e-10
U65785-1|AAC50947.1|  999|Homo sapiens 150 kDa oxygen-regulated ...    61   4e-09
DQ372932-1|ABD14370.1|  999|Homo sapiens 150 kDa oxygen-regulate...    61   4e-09
DQ350134-1|ABC75106.1|  999|Homo sapiens 150 kDa oxygen-regulate...    61   4e-09
BC072436-1|AAH72436.1|  678|Homo sapiens HYOU1 protein protein.        61   4e-09
BC017726-1|AAH17726.1|  657|Homo sapiens Unknown (protein for IM...    61   4e-09
AK222756-1|BAD96476.1|  999|Homo sapiens oxygen regulated protei...    61   5e-09
BC108738-1|AAI08739.1|   88|Homo sapiens HSPA14 protein protein.       60   1e-08
BC065281-1|AAH65281.1|   88|Homo sapiens HSPA14 protein protein.       60   1e-08
X67640-1|CAA47885.1|  266|Homo sapiens HS24/P52 protein.               58   4e-08
AL929592-6|CAI18465.1|  476|Homo sapiens heat shock 70kDa protei...    55   2e-07
AL671762-5|CAM25532.1|  476|Homo sapiens heat shock 70kDa protei...    55   2e-07
AL662834-16|CAM24989.1|  476|Homo sapiens heat shock 70kDa prote...    55   2e-07
AL137142-3|CAI12429.1|  817|Homo sapiens heat shock 105kDa/110kD...    48   3e-05
BT007375-1|AAP36039.1|  148|Homo sapiens heat shock protein, 110...    48   4e-05
BC002526-1|AAH02526.1|  148|Homo sapiens heat shock 70kDa protei...    48   4e-05
X04676-1|CAA28381.1|   22|Homo sapiens protein ( Human hsp 70 ge...    47   8e-05
BC004560-1|AAH04560.1|  147|Homo sapiens HYOU1 protein protein.        37   0.067
BC103893-1|AAI03894.1|  346|Homo sapiens MAGEC3 protein protein.       33   1.4  
AB037748-1|BAA92565.2| 1804|Homo sapiens KIAA1327 protein protein.     31   4.4  
U73737-1|AAB47425.1| 1360|Homo sapiens hMSH6 protein.                  30   7.6  
U54777-1|AAB39212.2| 1360|Homo sapiens hMSH6 protein protein.          30   7.6  
U28946-1|AAC50461.1| 1360|Homo sapiens G/T mismatch binding prot...    30   7.6  
D89646-1|BAA23675.1| 1068|Homo sapiens GTBP-ALT protein.               30   7.6  
D89645-2|BAA23673.1| 1068|Homo sapiens GTBP-ALT protein.               30   7.6  
D89645-1|BAA23674.1| 1360|Homo sapiens GTBP-N protein.                 30   7.6  
BC004246-1|AAH04246.1| 1360|Homo sapiens mutS homolog 6 (E. coli...    30   7.6  
AY082894-1|AAL87401.1| 1358|Homo sapiens mutS homolog 6 (E. coli...    30   7.6  

>Y00371-1|CAA68445.1|  646|Homo sapiens 71 Kd heat shock cognate
           protein protein.
          Length = 646

 Score =  206 bits (504), Expect = 5e-53
 Identities = 120/205 (58%), Positives = 132/205 (64%), Gaps = 6/205 (2%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+K PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPT-TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRV----KTKPFS 416
           M PT T +    +        ++      + +     M  N   R  ++V    +TK F 
Sbjct: 61  MNPTNTVFDAKRLIGRRFDDAVV-----QSDMKHWPFMVVNDAGRPKVQVEYKGETKSFY 115

Query: 417 PRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINE 593
           P +                L            AYFNDSQRQATKDAGTI+GLNVLRIINE
Sbjct: 116 PEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINE 175

Query: 594 PTAAAIAYGLDKKGTGERNVLIFDL 668
           PTAAAIAYGLDKK   ERNVLIFDL
Sbjct: 176 PTAAAIAYGLDKKVGAERNVLIFDL 200



 Score =  134 bits (323), Expect = 4e-31
 Identities = 58/76 (76%), Positives = 69/76 (90%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGR+F+DA VQ+DMKHWPF VV+D G+PK++V YKGE K+F+PEEVSS
Sbjct: 62  NPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSS 121

Query: 434 MVLTKMKETAEAYLGK 481
           MVLTKMKE AEAYLGK
Sbjct: 122 MVLTKMKEIAEAYLGK 137



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTIEDGIFEVKSTAGDT
Sbjct: 202 GGTFDVSILTIEDGIFEVKSTAGDT 226


>BC019816-1|AAH19816.1|  646|Homo sapiens heat shock 70kDa protein 8
           protein.
          Length = 646

 Score =  206 bits (504), Expect = 5e-53
 Identities = 120/205 (58%), Positives = 132/205 (64%), Gaps = 6/205 (2%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+K PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPT-TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRV----KTKPFS 416
           M PT T +    +        ++      + +     M  N   R  ++V    +TK F 
Sbjct: 61  MNPTNTVFDAKRLIGRRFDDAVV-----QSDMKHWPFMVVNDAGRPKVQVEYKGETKSFY 115

Query: 417 PRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINE 593
           P +                L            AYFNDSQRQATKDAGTI+GLNVLRIINE
Sbjct: 116 PEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINE 175

Query: 594 PTAAAIAYGLDKKGTGERNVLIFDL 668
           PTAAAIAYGLDKK   ERNVLIFDL
Sbjct: 176 PTAAAIAYGLDKKVGAERNVLIFDL 200



 Score =  134 bits (323), Expect = 4e-31
 Identities = 58/76 (76%), Positives = 69/76 (90%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGR+F+DA VQ+DMKHWPF VV+D G+PK++V YKGE K+F+PEEVSS
Sbjct: 62  NPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSS 121

Query: 434 MVLTKMKETAEAYLGK 481
           MVLTKMKE AEAYLGK
Sbjct: 122 MVLTKMKEIAEAYLGK 137



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTIEDGIFEVKSTAGDT
Sbjct: 202 GGTFDVSILTIEDGIFEVKSTAGDT 226


>BC016660-1|AAH16660.1|  646|Homo sapiens heat shock 70kDa protein 8
           protein.
          Length = 646

 Score =  206 bits (504), Expect = 5e-53
 Identities = 120/205 (58%), Positives = 132/205 (64%), Gaps = 6/205 (2%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+K PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPT-TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRV----KTKPFS 416
           M PT T +    +        ++      + +     M  N   R  ++V    +TK F 
Sbjct: 61  MNPTNTVFDAKRLIGRRFDDAVV-----QSDMKHWPFMVVNDAGRPKVQVEYKGETKSFY 115

Query: 417 PRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINE 593
           P +                L            AYFNDSQRQATKDAGTI+GLNVLRIINE
Sbjct: 116 PEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINE 175

Query: 594 PTAAAIAYGLDKKGTGERNVLIFDL 668
           PTAAAIAYGLDKK   ERNVLIFDL
Sbjct: 176 PTAAAIAYGLDKKVGAERNVLIFDL 200



 Score =  134 bits (323), Expect = 4e-31
 Identities = 58/76 (76%), Positives = 69/76 (90%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGR+F+DA VQ+DMKHWPF VV+D G+PK++V YKGE K+F+PEEVSS
Sbjct: 62  NPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSS 121

Query: 434 MVLTKMKETAEAYLGK 481
           MVLTKMKE AEAYLGK
Sbjct: 122 MVLTKMKEIAEAYLGK 137



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTIEDGIFEVKSTAGDT
Sbjct: 202 GGTFDVSILTIEDGIFEVKSTAGDT 226


>BC016179-1|AAH16179.1|  646|Homo sapiens heat shock 70kDa protein 8
           protein.
          Length = 646

 Score =  206 bits (504), Expect = 5e-53
 Identities = 120/205 (58%), Positives = 132/205 (64%), Gaps = 6/205 (2%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+K PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPT-TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRV----KTKPFS 416
           M PT T +    +        ++      + +     M  N   R  ++V    +TK F 
Sbjct: 61  MNPTNTVFDAKRLIGRRFDDAVV-----QSDMKHWPFMVVNDAGRPKVQVEYKGETKSFY 115

Query: 417 PRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINE 593
           P +                L            AYFNDSQRQATKDAGTI+GLNVLRIINE
Sbjct: 116 PEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINE 175

Query: 594 PTAAAIAYGLDKKGTGERNVLIFDL 668
           PTAAAIAYGLDKK   ERNVLIFDL
Sbjct: 176 PTAAAIAYGLDKKVGAERNVLIFDL 200



 Score =  134 bits (323), Expect = 4e-31
 Identities = 58/76 (76%), Positives = 69/76 (90%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGR+F+DA VQ+DMKHWPF VV+D G+PK++V YKGE K+F+PEEVSS
Sbjct: 62  NPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSS 121

Query: 434 MVLTKMKETAEAYLGK 481
           MVLTKMKE AEAYLGK
Sbjct: 122 MVLTKMKEIAEAYLGK 137



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTIEDGIFEVKSTAGDT
Sbjct: 202 GGTFDVSILTIEDGIFEVKSTAGDT 226


>AK222628-1|BAD96348.1|  493|Homo sapiens heat shock 70kDa protein 8
           isoform 2 variant protein.
          Length = 493

 Score =  206 bits (504), Expect = 5e-53
 Identities = 120/205 (58%), Positives = 132/205 (64%), Gaps = 6/205 (2%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+K PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPT-TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRV----KTKPFS 416
           M PT T +    +        ++      + +     M  N   R  ++V    +TK F 
Sbjct: 61  MNPTNTVFDAKRLIGRRFDDAVV-----QSDMKHWPFMVVNDAGRPKVQVEYKGETKSFY 115

Query: 417 PRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINE 593
           P +                L            AYFNDSQRQATKDAGTI+GLNVLRIINE
Sbjct: 116 PEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINE 175

Query: 594 PTAAAIAYGLDKKGTGERNVLIFDL 668
           PTAAAIAYGLDKK   ERNVLIFDL
Sbjct: 176 PTAAAIAYGLDKKVGAERNVLIFDL 200



 Score =  134 bits (323), Expect = 4e-31
 Identities = 58/76 (76%), Positives = 69/76 (90%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGR+F+DA VQ+DMKHWPF VV+D G+PK++V YKGE K+F+PEEVSS
Sbjct: 62  NPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSS 121

Query: 434 MVLTKMKETAEAYLGK 481
           MVLTKMKE AEAYLGK
Sbjct: 122 MVLTKMKEIAEAYLGK 137



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTIEDGIFEVKSTAGDT
Sbjct: 202 GGTFDVSILTIEDGIFEVKSTAGDT 226


>AF352832-1|AAK17898.1|  646|Homo sapiens constitutive heat shock
           protein 70 protein.
          Length = 646

 Score =  206 bits (504), Expect = 5e-53
 Identities = 120/205 (58%), Positives = 132/205 (64%), Gaps = 6/205 (2%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+K PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPT-TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRV----KTKPFS 416
           M PT T +    +        ++      + +     M  N   R  ++V    +TK F 
Sbjct: 61  MNPTNTVFDAKRLIGRRFDDAVV-----QSDMKHWPFMVVNDAGRPKVQVEYKGETKSFY 115

Query: 417 PRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINE 593
           P +                L            AYFNDSQRQATKDAGTI+GLNVLRIINE
Sbjct: 116 PEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINE 175

Query: 594 PTAAAIAYGLDKKGTGERNVLIFDL 668
           PTAAAIAYGLDKK   ERNVLIFDL
Sbjct: 176 PTAAAIAYGLDKKVGAERNVLIFDL 200



 Score =  134 bits (323), Expect = 4e-31
 Identities = 58/76 (76%), Positives = 69/76 (90%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGR+F+DA VQ+DMKHWPF VV+D G+PK++V YKGE K+F+PEEVSS
Sbjct: 62  NPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSS 121

Query: 434 MVLTKMKETAEAYLGK 481
           MVLTKMKE AEAYLGK
Sbjct: 122 MVLTKMKEIAEAYLGK 137



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTIEDGIFEVKSTAGDT
Sbjct: 202 GGTFDVSILTIEDGIFEVKSTAGDT 226


>AB034951-1|BAB18615.1|  493|Homo sapiens heat shock cognate protein
           54 protein.
          Length = 493

 Score =  206 bits (504), Expect = 5e-53
 Identities = 120/205 (58%), Positives = 132/205 (64%), Gaps = 6/205 (2%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+K PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPT-TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRV----KTKPFS 416
           M PT T +    +        ++      + +     M  N   R  ++V    +TK F 
Sbjct: 61  MNPTNTVFDAKRLIGRRFDDAVV-----QSDMKHWPFMVVNDAGRPKVQVEYKGETKSFY 115

Query: 417 PRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINE 593
           P +                L            AYFNDSQRQATKDAGTI+GLNVLRIINE
Sbjct: 116 PEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINE 175

Query: 594 PTAAAIAYGLDKKGTGERNVLIFDL 668
           PTAAAIAYGLDKK   ERNVLIFDL
Sbjct: 176 PTAAAIAYGLDKKVGAERNVLIFDL 200



 Score =  134 bits (323), Expect = 4e-31
 Identities = 58/76 (76%), Positives = 69/76 (90%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGR+F+DA VQ+DMKHWPF VV+D G+PK++V YKGE K+F+PEEVSS
Sbjct: 62  NPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSS 121

Query: 434 MVLTKMKETAEAYLGK 481
           MVLTKMKE AEAYLGK
Sbjct: 122 MVLTKMKEIAEAYLGK 137



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTIEDGIFEVKSTAGDT
Sbjct: 202 GGTFDVSILTIEDGIFEVKSTAGDT 226


>AK222785-1|BAD96505.1|  646|Homo sapiens heat shock 70kDa protein 8
           isoform 1 variant protein.
          Length = 646

 Score =  205 bits (500), Expect = 1e-52
 Identities = 119/205 (58%), Positives = 132/205 (64%), Gaps = 6/205 (2%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+K PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPT-TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRV----KTKPFS 416
           M PT T +    +        ++      + +     M  N   R  ++V    +TK F 
Sbjct: 61  MNPTNTVFDAKRLIGRRFDDAVV-----QSDMKHWPFMVVNDAGRPKVQVEYKGETKSFY 115

Query: 417 PRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINE 593
           P +                L            AYFNDSQRQATKDAGTI+GLNVLRIINE
Sbjct: 116 PEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINE 175

Query: 594 PTAAAIAYGLDKKGTGERNVLIFDL 668
           PTAAAIAYGLD+K   ERNVLIFDL
Sbjct: 176 PTAAAIAYGLDEKVGAERNVLIFDL 200



 Score =  134 bits (323), Expect = 4e-31
 Identities = 58/76 (76%), Positives = 69/76 (90%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGR+F+DA VQ+DMKHWPF VV+D G+PK++V YKGE K+F+PEEVSS
Sbjct: 62  NPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSS 121

Query: 434 MVLTKMKETAEAYLGK 481
           MVLTKMKE AEAYLGK
Sbjct: 122 MVLTKMKEIAEAYLGK 137



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTIEDGIFEVKSTAGDT
Sbjct: 202 GGTFDVSILTIEDGIFEVKSTAGDT 226


>M11717-1|AAA52697.1|  640|Homo sapiens heat shock protein protein.
          Length = 640

 Score =  203 bits (496), Expect = 5e-52
 Identities = 118/204 (57%), Positives = 132/204 (64%), Gaps = 5/204 (2%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAKA AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRV----KTKPFSP 419
           + P  Q ++ +    +  K     P   + +        N   +  ++V    +TK F P
Sbjct: 61  LNP--QNTVFDAKRLIGRK--FGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYP 116

Query: 420 RKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEP 596
            +                L            AYFNDSQRQATKDAG I+GLNVLRIINEP
Sbjct: 117 EEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEP 176

Query: 597 TAAAIAYGLDKKGTGERNVLIFDL 668
           TAAAIAYGLD+ G GERNVLIFDL
Sbjct: 177 TAAAIAYGLDRTGKGERNVLIFDL 200



 Score =  131 bits (317), Expect = 2e-30
 Identities = 56/75 (74%), Positives = 67/75 (89%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRKF D  VQ+DMKHWPF+V++DG KPK++V+YKGE K F+PEE+SS
Sbjct: 62  NPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISS 121

Query: 434 MVLTKMKETAEAYLG 478
           MVLTKMKE AEAYLG
Sbjct: 122 MVLTKMKEIAEAYLG 136



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTI+DGIFEVK+TAGDT
Sbjct: 202 GGTFDVSILTIDDGIFEVKATAGDT 226


>M59830-1|AAA63227.1|  641|Homo sapiens heat shock-induced protein
           protein.
          Length = 641

 Score =  203 bits (495), Expect = 6e-52
 Identities = 117/204 (57%), Positives = 132/204 (64%), Gaps = 5/204 (2%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRV----KTKPFSP 419
           + P  Q ++ +    +  K     P   + +        N   +  ++V    +TK F P
Sbjct: 61  LNP--QNTVFDAKRLIGRK--FGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYP 116

Query: 420 RKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEP 596
            +                L            AYFNDSQRQATKDAG I+GLNVLRIINEP
Sbjct: 117 EEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEP 176

Query: 597 TAAAIAYGLDKKGTGERNVLIFDL 668
           TAAAIAYGLD+ G GERNVLIFDL
Sbjct: 177 TAAAIAYGLDRTGKGERNVLIFDL 200



 Score =  131 bits (317), Expect = 2e-30
 Identities = 56/75 (74%), Positives = 67/75 (89%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRKF D  VQ+DMKHWPF+V++DG KPK++V+YKGE K F+PEE+SS
Sbjct: 62  NPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISS 121

Query: 434 MVLTKMKETAEAYLG 478
           MVLTKMKE AEAYLG
Sbjct: 122 MVLTKMKEIAEAYLG 136



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTI+DGIFEVK+TAGDT
Sbjct: 202 GGTFDVSILTIDDGIFEVKATAGDT 226


>M59828-1|AAA63226.1|  641|Homo sapiens heat shock-induced protein
           protein.
          Length = 641

 Score =  203 bits (495), Expect = 6e-52
 Identities = 117/204 (57%), Positives = 132/204 (64%), Gaps = 5/204 (2%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRV----KTKPFSP 419
           + P  Q ++ +    +  K     P   + +        N   +  ++V    +TK F P
Sbjct: 61  LNP--QNTVFDAKRLIGRK--FGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYP 116

Query: 420 RKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEP 596
            +                L            AYFNDSQRQATKDAG I+GLNVLRIINEP
Sbjct: 117 EEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEP 176

Query: 597 TAAAIAYGLDKKGTGERNVLIFDL 668
           TAAAIAYGLD+ G GERNVLIFDL
Sbjct: 177 TAAAIAYGLDRTGKGERNVLIFDL 200



 Score =  131 bits (317), Expect = 2e-30
 Identities = 56/75 (74%), Positives = 67/75 (89%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRKF D  VQ+DMKHWPF+V++DG KPK++V+YKGE K F+PEE+SS
Sbjct: 62  NPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISS 121

Query: 434 MVLTKMKETAEAYLG 478
           MVLTKMKE AEAYLG
Sbjct: 122 MVLTKMKEIAEAYLG 136



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTI+DGIFEVK+TAGDT
Sbjct: 202 GGTFDVSILTIDDGIFEVKATAGDT 226


>DQ451402-1|ABD96830.1|  641|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 641

 Score =  203 bits (495), Expect = 6e-52
 Identities = 117/204 (57%), Positives = 132/204 (64%), Gaps = 5/204 (2%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRV----KTKPFSP 419
           + P  Q ++ +    +  K     P   + +        N   +  ++V    +TK F P
Sbjct: 61  LNP--QNTVFDAKRLIGRK--FGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYP 116

Query: 420 RKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEP 596
            +                L            AYFNDSQRQATKDAG I+GLNVLRIINEP
Sbjct: 117 EEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEP 176

Query: 597 TAAAIAYGLDKKGTGERNVLIFDL 668
           TAAAIAYGLD+ G GERNVLIFDL
Sbjct: 177 TAAAIAYGLDRTGKGERNVLIFDL 200



 Score =  131 bits (317), Expect = 2e-30
 Identities = 56/75 (74%), Positives = 67/75 (89%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRKF D  VQ+DMKHWPF+V++DG KPK++V+YKGE K F+PEE+SS
Sbjct: 62  NPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISS 121

Query: 434 MVLTKMKETAEAYLG 478
           MVLTKMKE AEAYLG
Sbjct: 122 MVLTKMKEIAEAYLG 136



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTI+DGIFEVK+TAGDT
Sbjct: 202 GGTFDVSILTIDDGIFEVKATAGDT 226


>DQ388429-1|ABD48956.1|  641|Homo sapiens heat shock 70kDa protein
           1B protein.
          Length = 641

 Score =  203 bits (495), Expect = 6e-52
 Identities = 117/204 (57%), Positives = 132/204 (64%), Gaps = 5/204 (2%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRV----KTKPFSP 419
           + P  Q ++ +    +  K     P   + +        N   +  ++V    +TK F P
Sbjct: 61  LNP--QNTVFDAKRLIGRK--FGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYP 116

Query: 420 RKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEP 596
            +                L            AYFNDSQRQATKDAG I+GLNVLRIINEP
Sbjct: 117 EEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEP 176

Query: 597 TAAAIAYGLDKKGTGERNVLIFDL 668
           TAAAIAYGLD+ G GERNVLIFDL
Sbjct: 177 TAAAIAYGLDRTGKGERNVLIFDL 200



 Score =  131 bits (317), Expect = 2e-30
 Identities = 56/75 (74%), Positives = 67/75 (89%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRKF D  VQ+DMKHWPF+V++DG KPK++V+YKGE K F+PEE+SS
Sbjct: 62  NPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISS 121

Query: 434 MVLTKMKETAEAYLG 478
           MVLTKMKE AEAYLG
Sbjct: 122 MVLTKMKEIAEAYLG 136



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTI+DGIFEVK+TAGDT
Sbjct: 202 GGTFDVSILTIDDGIFEVKATAGDT 226


>BC063507-1|AAH63507.1|  641|Homo sapiens heat shock 70kDa protein
           1B protein.
          Length = 641

 Score =  203 bits (495), Expect = 6e-52
 Identities = 117/204 (57%), Positives = 132/204 (64%), Gaps = 5/204 (2%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRV----KTKPFSP 419
           + P  Q ++ +    +  K     P   + +        N   +  ++V    +TK F P
Sbjct: 61  LNP--QNTVFDAKRLIGRK--FGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYP 116

Query: 420 RKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEP 596
            +                L            AYFNDSQRQATKDAG I+GLNVLRIINEP
Sbjct: 117 EEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEP 176

Query: 597 TAAAIAYGLDKKGTGERNVLIFDL 668
           TAAAIAYGLD+ G GERNVLIFDL
Sbjct: 177 TAAAIAYGLDRTGKGERNVLIFDL 200



 Score =  131 bits (317), Expect = 2e-30
 Identities = 56/75 (74%), Positives = 67/75 (89%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRKF D  VQ+DMKHWPF+V++DG KPK++V+YKGE K F+PEE+SS
Sbjct: 62  NPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISS 121

Query: 434 MVLTKMKETAEAYLG 478
           MVLTKMKE AEAYLG
Sbjct: 122 MVLTKMKEIAEAYLG 136



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTI+DGIFEVK+TAGDT
Sbjct: 202 GGTFDVSILTIDDGIFEVKATAGDT 226


>BC057397-1|AAH57397.1|  641|Homo sapiens heat shock 70kDa protein
           1B protein.
          Length = 641

 Score =  203 bits (495), Expect = 6e-52
 Identities = 117/204 (57%), Positives = 132/204 (64%), Gaps = 5/204 (2%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRV----KTKPFSP 419
           + P  Q ++ +    +  K     P   + +        N   +  ++V    +TK F P
Sbjct: 61  LNP--QNTVFDAKRLIGRK--FGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYP 116

Query: 420 RKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEP 596
            +                L            AYFNDSQRQATKDAG I+GLNVLRIINEP
Sbjct: 117 EEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEP 176

Query: 597 TAAAIAYGLDKKGTGERNVLIFDL 668
           TAAAIAYGLD+ G GERNVLIFDL
Sbjct: 177 TAAAIAYGLDRTGKGERNVLIFDL 200



 Score =  131 bits (317), Expect = 2e-30
 Identities = 56/75 (74%), Positives = 67/75 (89%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRKF D  VQ+DMKHWPF+V++DG KPK++V+YKGE K F+PEE+SS
Sbjct: 62  NPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISS 121

Query: 434 MVLTKMKETAEAYLG 478
           MVLTKMKE AEAYLG
Sbjct: 122 MVLTKMKEIAEAYLG 136



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTI+DGIFEVK+TAGDT
Sbjct: 202 GGTFDVSILTIDDGIFEVKATAGDT 226


>BC018740-1|AAH18740.1|  641|Homo sapiens HSPA1A protein protein.
          Length = 641

 Score =  203 bits (495), Expect = 6e-52
 Identities = 117/204 (57%), Positives = 132/204 (64%), Gaps = 5/204 (2%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRV----KTKPFSP 419
           + P  Q ++ +    +  K     P   + +        N   +  ++V    +TK F P
Sbjct: 61  LNP--QNTVFDAKRLIGRK--FGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYP 116

Query: 420 RKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEP 596
            +                L            AYFNDSQRQATKDAG I+GLNVLRIINEP
Sbjct: 117 EEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEP 176

Query: 597 TAAAIAYGLDKKGTGERNVLIFDL 668
           TAAAIAYGLD+ G GERNVLIFDL
Sbjct: 177 TAAAIAYGLDRTGKGERNVLIFDL 200



 Score =  131 bits (317), Expect = 2e-30
 Identities = 56/75 (74%), Positives = 67/75 (89%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRKF D  VQ+DMKHWPF+V++DG KPK++V+YKGE K F+PEE+SS
Sbjct: 62  NPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISS 121

Query: 434 MVLTKMKETAEAYLG 478
           MVLTKMKE AEAYLG
Sbjct: 122 MVLTKMKEIAEAYLG 136



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTI+DGIFEVK+TAGDT
Sbjct: 202 GGTFDVSILTIDDGIFEVKATAGDT 226


>BC009322-1|AAH09322.1|  641|Homo sapiens HSPA1A protein protein.
          Length = 641

 Score =  203 bits (495), Expect = 6e-52
 Identities = 117/204 (57%), Positives = 132/204 (64%), Gaps = 5/204 (2%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRV----KTKPFSP 419
           + P  Q ++ +    +  K     P   + +        N   +  ++V    +TK F P
Sbjct: 61  LNP--QNTVFDAKRLIGRK--FGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYP 116

Query: 420 RKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEP 596
            +                L            AYFNDSQRQATKDAG I+GLNVLRIINEP
Sbjct: 117 EEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEP 176

Query: 597 TAAAIAYGLDKKGTGERNVLIFDL 668
           TAAAIAYGLD+ G GERNVLIFDL
Sbjct: 177 TAAAIAYGLDRTGKGERNVLIFDL 200



 Score =  131 bits (317), Expect = 2e-30
 Identities = 56/75 (74%), Positives = 67/75 (89%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRKF D  VQ+DMKHWPF+V++DG KPK++V+YKGE K F+PEE+SS
Sbjct: 62  NPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISS 121

Query: 434 MVLTKMKETAEAYLG 478
           MVLTKMKE AEAYLG
Sbjct: 122 MVLTKMKEIAEAYLG 136



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTI+DGIFEVK+TAGDT
Sbjct: 202 GGTFDVSILTIDDGIFEVKATAGDT 226


>BC002453-1|AAH02453.1|  641|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 641

 Score =  203 bits (495), Expect = 6e-52
 Identities = 117/204 (57%), Positives = 132/204 (64%), Gaps = 5/204 (2%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRV----KTKPFSP 419
           + P  Q ++ +    +  K     P   + +        N   +  ++V    +TK F P
Sbjct: 61  LNP--QNTVFDAKRLIGRK--FGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYP 116

Query: 420 RKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEP 596
            +                L            AYFNDSQRQATKDAG I+GLNVLRIINEP
Sbjct: 117 EEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEP 176

Query: 597 TAAAIAYGLDKKGTGERNVLIFDL 668
           TAAAIAYGLD+ G GERNVLIFDL
Sbjct: 177 TAAAIAYGLDRTGKGERNVLIFDL 200



 Score =  131 bits (317), Expect = 2e-30
 Identities = 56/75 (74%), Positives = 67/75 (89%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRKF D  VQ+DMKHWPF+V++DG KPK++V+YKGE K F+PEE+SS
Sbjct: 62  NPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISS 121

Query: 434 MVLTKMKETAEAYLG 478
           MVLTKMKE AEAYLG
Sbjct: 122 MVLTKMKEIAEAYLG 136



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTI+DGIFEVK+TAGDT
Sbjct: 202 GGTFDVSILTIDDGIFEVKATAGDT 226


>BA000025-9|BAB63300.1|  641|Homo sapiens heat shock protein
           protein.
          Length = 641

 Score =  203 bits (495), Expect = 6e-52
 Identities = 117/204 (57%), Positives = 132/204 (64%), Gaps = 5/204 (2%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRV----KTKPFSP 419
           + P  Q ++ +    +  K     P   + +        N   +  ++V    +TK F P
Sbjct: 61  LNP--QNTVFDAKRLIGRK--FGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYP 116

Query: 420 RKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEP 596
            +                L            AYFNDSQRQATKDAG I+GLNVLRIINEP
Sbjct: 117 EEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEP 176

Query: 597 TAAAIAYGLDKKGTGERNVLIFDL 668
           TAAAIAYGLD+ G GERNVLIFDL
Sbjct: 177 TAAAIAYGLDRTGKGERNVLIFDL 200



 Score =  131 bits (317), Expect = 2e-30
 Identities = 56/75 (74%), Positives = 67/75 (89%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRKF D  VQ+DMKHWPF+V++DG KPK++V+YKGE K F+PEE+SS
Sbjct: 62  NPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISS 121

Query: 434 MVLTKMKETAEAYLG 478
           MVLTKMKE AEAYLG
Sbjct: 122 MVLTKMKEIAEAYLG 136



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTI+DGIFEVK+TAGDT
Sbjct: 202 GGTFDVSILTIDDGIFEVKATAGDT 226


>BA000025-8|BAB63299.1|  641|Homo sapiens heat shock protein
           protein.
          Length = 641

 Score =  203 bits (495), Expect = 6e-52
 Identities = 117/204 (57%), Positives = 132/204 (64%), Gaps = 5/204 (2%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRV----KTKPFSP 419
           + P  Q ++ +    +  K     P   + +        N   +  ++V    +TK F P
Sbjct: 61  LNP--QNTVFDAKRLIGRK--FGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYP 116

Query: 420 RKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEP 596
            +                L            AYFNDSQRQATKDAG I+GLNVLRIINEP
Sbjct: 117 EEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEP 176

Query: 597 TAAAIAYGLDKKGTGERNVLIFDL 668
           TAAAIAYGLD+ G GERNVLIFDL
Sbjct: 177 TAAAIAYGLDRTGKGERNVLIFDL 200



 Score =  131 bits (317), Expect = 2e-30
 Identities = 56/75 (74%), Positives = 67/75 (89%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRKF D  VQ+DMKHWPF+V++DG KPK++V+YKGE K F+PEE+SS
Sbjct: 62  NPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISS 121

Query: 434 MVLTKMKETAEAYLG 478
           MVLTKMKE AEAYLG
Sbjct: 122 MVLTKMKEIAEAYLG 136



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTI+DGIFEVK+TAGDT
Sbjct: 202 GGTFDVSILTIDDGIFEVKATAGDT 226


>AL929592-7|CAI18466.1|  641|Homo sapiens heat shock 70kDa protein
           1B protein.
          Length = 641

 Score =  203 bits (495), Expect = 6e-52
 Identities = 117/204 (57%), Positives = 132/204 (64%), Gaps = 5/204 (2%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRV----KTKPFSP 419
           + P  Q ++ +    +  K     P   + +        N   +  ++V    +TK F P
Sbjct: 61  LNP--QNTVFDAKRLIGRK--FGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYP 116

Query: 420 RKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEP 596
            +                L            AYFNDSQRQATKDAG I+GLNVLRIINEP
Sbjct: 117 EEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEP 176

Query: 597 TAAAIAYGLDKKGTGERNVLIFDL 668
           TAAAIAYGLD+ G GERNVLIFDL
Sbjct: 177 TAAAIAYGLDRTGKGERNVLIFDL 200



 Score =  131 bits (317), Expect = 2e-30
 Identities = 56/75 (74%), Positives = 67/75 (89%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRKF D  VQ+DMKHWPF+V++DG KPK++V+YKGE K F+PEE+SS
Sbjct: 62  NPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISS 121

Query: 434 MVLTKMKETAEAYLG 478
           MVLTKMKE AEAYLG
Sbjct: 122 MVLTKMKEIAEAYLG 136



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTI+DGIFEVK+TAGDT
Sbjct: 202 GGTFDVSILTIDDGIFEVKATAGDT 226


>AL671762-7|CAI18217.1|  641|Homo sapiens heat shock 70kDa protein
           1B protein.
          Length = 641

 Score =  203 bits (495), Expect = 6e-52
 Identities = 117/204 (57%), Positives = 132/204 (64%), Gaps = 5/204 (2%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRV----KTKPFSP 419
           + P  Q ++ +    +  K     P   + +        N   +  ++V    +TK F P
Sbjct: 61  LNP--QNTVFDAKRLIGRK--FGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYP 116

Query: 420 RKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEP 596
            +                L            AYFNDSQRQATKDAG I+GLNVLRIINEP
Sbjct: 117 EEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEP 176

Query: 597 TAAAIAYGLDKKGTGERNVLIFDL 668
           TAAAIAYGLD+ G GERNVLIFDL
Sbjct: 177 TAAAIAYGLDRTGKGERNVLIFDL 200



 Score =  131 bits (317), Expect = 2e-30
 Identities = 56/75 (74%), Positives = 67/75 (89%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRKF D  VQ+DMKHWPF+V++DG KPK++V+YKGE K F+PEE+SS
Sbjct: 62  NPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISS 121

Query: 434 MVLTKMKETAEAYLG 478
           MVLTKMKE AEAYLG
Sbjct: 122 MVLTKMKEIAEAYLG 136



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTI+DGIFEVK+TAGDT
Sbjct: 202 GGTFDVSILTIDDGIFEVKATAGDT 226


>AL671762-6|CAI18216.1|  641|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 641

 Score =  203 bits (495), Expect = 6e-52
 Identities = 117/204 (57%), Positives = 132/204 (64%), Gaps = 5/204 (2%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRV----KTKPFSP 419
           + P  Q ++ +    +  K     P   + +        N   +  ++V    +TK F P
Sbjct: 61  LNP--QNTVFDAKRLIGRK--FGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYP 116

Query: 420 RKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEP 596
            +                L            AYFNDSQRQATKDAG I+GLNVLRIINEP
Sbjct: 117 EEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEP 176

Query: 597 TAAAIAYGLDKKGTGERNVLIFDL 668
           TAAAIAYGLD+ G GERNVLIFDL
Sbjct: 177 TAAAIAYGLDRTGKGERNVLIFDL 200



 Score =  131 bits (317), Expect = 2e-30
 Identities = 56/75 (74%), Positives = 67/75 (89%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRKF D  VQ+DMKHWPF+V++DG KPK++V+YKGE K F+PEE+SS
Sbjct: 62  NPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISS 121

Query: 434 MVLTKMKETAEAYLG 478
           MVLTKMKE AEAYLG
Sbjct: 122 MVLTKMKEIAEAYLG 136



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTI+DGIFEVK+TAGDT
Sbjct: 202 GGTFDVSILTIDDGIFEVKATAGDT 226


>AL662834-18|CAI17738.1|  641|Homo sapiens heat shock 70kDa protein
           1B protein.
          Length = 641

 Score =  203 bits (495), Expect = 6e-52
 Identities = 117/204 (57%), Positives = 132/204 (64%), Gaps = 5/204 (2%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRV----KTKPFSP 419
           + P  Q ++ +    +  K     P   + +        N   +  ++V    +TK F P
Sbjct: 61  LNP--QNTVFDAKRLIGRK--FGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYP 116

Query: 420 RKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEP 596
            +                L            AYFNDSQRQATKDAG I+GLNVLRIINEP
Sbjct: 117 EEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEP 176

Query: 597 TAAAIAYGLDKKGTGERNVLIFDL 668
           TAAAIAYGLD+ G GERNVLIFDL
Sbjct: 177 TAAAIAYGLDRTGKGERNVLIFDL 200



 Score =  131 bits (317), Expect = 2e-30
 Identities = 56/75 (74%), Positives = 67/75 (89%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRKF D  VQ+DMKHWPF+V++DG KPK++V+YKGE K F+PEE+SS
Sbjct: 62  NPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISS 121

Query: 434 MVLTKMKETAEAYLG 478
           MVLTKMKE AEAYLG
Sbjct: 122 MVLTKMKEIAEAYLG 136



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTI+DGIFEVK+TAGDT
Sbjct: 202 GGTFDVSILTIDDGIFEVKATAGDT 226


>AL662834-17|CAI17737.1|  641|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 641

 Score =  203 bits (495), Expect = 6e-52
 Identities = 117/204 (57%), Positives = 132/204 (64%), Gaps = 5/204 (2%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRV----KTKPFSP 419
           + P  Q ++ +    +  K     P   + +        N   +  ++V    +TK F P
Sbjct: 61  LNP--QNTVFDAKRLIGRK--FGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYP 116

Query: 420 RKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEP 596
            +                L            AYFNDSQRQATKDAG I+GLNVLRIINEP
Sbjct: 117 EEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEP 176

Query: 597 TAAAIAYGLDKKGTGERNVLIFDL 668
           TAAAIAYGLD+ G GERNVLIFDL
Sbjct: 177 TAAAIAYGLDRTGKGERNVLIFDL 200



 Score =  131 bits (317), Expect = 2e-30
 Identities = 56/75 (74%), Positives = 67/75 (89%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRKF D  VQ+DMKHWPF+V++DG KPK++V+YKGE K F+PEE+SS
Sbjct: 62  NPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISS 121

Query: 434 MVLTKMKETAEAYLG 478
           MVLTKMKE AEAYLG
Sbjct: 122 MVLTKMKEIAEAYLG 136



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTI+DGIFEVK+TAGDT
Sbjct: 202 GGTFDVSILTIDDGIFEVKATAGDT 226


>AF134726-6|AAD21815.1|  641|Homo sapiens HSP70-2 protein.
          Length = 641

 Score =  203 bits (495), Expect = 6e-52
 Identities = 117/204 (57%), Positives = 132/204 (64%), Gaps = 5/204 (2%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRV----KTKPFSP 419
           + P  Q ++ +    +  K     P   + +        N   +  ++V    +TK F P
Sbjct: 61  LNP--QNTVFDAKRLIGRK--FGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYP 116

Query: 420 RKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEP 596
            +                L            AYFNDSQRQATKDAG I+GLNVLRIINEP
Sbjct: 117 EEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEP 176

Query: 597 TAAAIAYGLDKKGTGERNVLIFDL 668
           TAAAIAYGLD+ G GERNVLIFDL
Sbjct: 177 TAAAIAYGLDRTGKGERNVLIFDL 200



 Score =  131 bits (317), Expect = 2e-30
 Identities = 56/75 (74%), Positives = 67/75 (89%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRKF D  VQ+DMKHWPF+V++DG KPK++V+YKGE K F+PEE+SS
Sbjct: 62  NPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISS 121

Query: 434 MVLTKMKETAEAYLG 478
           MVLTKMKE AEAYLG
Sbjct: 122 MVLTKMKEIAEAYLG 136



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTI+DGIFEVK+TAGDT
Sbjct: 202 GGTFDVSILTIDDGIFEVKATAGDT 226


>AL929592-5|CAI18464.1|  641|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 641

 Score =  202 bits (494), Expect = 8e-52
 Identities = 117/204 (57%), Positives = 131/204 (64%), Gaps = 5/204 (2%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVK----TKPFSP 419
           + P  Q ++ +    +  K     P   + +        N   +  ++V     TK F P
Sbjct: 61  LNP--QNTVFDAKRLIGRK--FGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGDTKAFYP 116

Query: 420 RKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEP 596
            +                L            AYFNDSQRQATKDAG I+GLNVLRIINEP
Sbjct: 117 EEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEP 176

Query: 597 TAAAIAYGLDKKGTGERNVLIFDL 668
           TAAAIAYGLD+ G GERNVLIFDL
Sbjct: 177 TAAAIAYGLDRTGKGERNVLIFDL 200



 Score =  130 bits (314), Expect = 5e-30
 Identities = 55/75 (73%), Positives = 67/75 (89%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRKF D  VQ+DMKHWPF+V++DG KPK++V+YKG+ K F+PEE+SS
Sbjct: 62  NPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGDTKAFYPEEISS 121

Query: 434 MVLTKMKETAEAYLG 478
           MVLTKMKE AEAYLG
Sbjct: 122 MVLTKMKEIAEAYLG 136



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTI+DGIFEVK+TAGDT
Sbjct: 202 GGTFDVSILTIDDGIFEVKATAGDT 226


>AF134726-7|AAD21816.1|  641|Homo sapiens HSP70-1 protein.
          Length = 641

 Score =  202 bits (494), Expect = 8e-52
 Identities = 117/204 (57%), Positives = 131/204 (64%), Gaps = 5/204 (2%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVK----TKPFSP 419
           + P  Q ++ +    +  K     P   + +        N   +  ++V     TK F P
Sbjct: 61  LNP--QNTVFDAKRLIGRK--FGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGDTKAFYP 116

Query: 420 RKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEP 596
            +                L            AYFNDSQRQATKDAG I+GLNVLRIINEP
Sbjct: 117 EEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEP 176

Query: 597 TAAAIAYGLDKKGTGERNVLIFDL 668
           TAAAIAYGLD+ G GERNVLIFDL
Sbjct: 177 TAAAIAYGLDRTGKGERNVLIFDL 200



 Score =  130 bits (314), Expect = 5e-30
 Identities = 55/75 (73%), Positives = 67/75 (89%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRKF D  VQ+DMKHWPF+V++DG KPK++V+YKG+ K F+PEE+SS
Sbjct: 62  NPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGDTKAFYPEEISS 121

Query: 434 MVLTKMKETAEAYLG 478
           MVLTKMKE AEAYLG
Sbjct: 122 MVLTKMKEIAEAYLG 136



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTI+DGIFEVK+TAGDT
Sbjct: 202 GGTFDVSILTIDDGIFEVKATAGDT 226


>AB209818-1|BAD93055.1|  709|Homo sapiens heat shock 70kDa protein
           1A variant protein.
          Length = 709

 Score =  202 bits (494), Expect = 8e-52
 Identities = 117/204 (57%), Positives = 131/204 (64%), Gaps = 5/204 (2%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 69  MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 128

Query: 252 MTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVK----TKPFSP 419
           + P  Q ++ +    +  K     P   + +        N   +  ++V     TK F P
Sbjct: 129 LNP--QNTVFDAKRLIGRK--FGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGDTKAFYP 184

Query: 420 RKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEP 596
            +                L            AYFNDSQRQATKDAG I+GLNVLRIINEP
Sbjct: 185 EEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEP 244

Query: 597 TAAAIAYGLDKKGTGERNVLIFDL 668
           TAAAIAYGLD+ G GERNVLIFDL
Sbjct: 245 TAAAIAYGLDRTGKGERNVLIFDL 268



 Score =  130 bits (314), Expect = 5e-30
 Identities = 55/75 (73%), Positives = 67/75 (89%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRKF D  VQ+DMKHWPF+V++DG KPK++V+YKG+ K F+PEE+SS
Sbjct: 130 NPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGDTKAFYPEEISS 189

Query: 434 MVLTKMKETAEAYLG 478
           MVLTKMKE AEAYLG
Sbjct: 190 MVLTKMKEIAEAYLG 204



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTI+DGIFEVK+TAGDT
Sbjct: 270 GGTFDVSILTIDDGIFEVKATAGDT 294


>U56725-1|AAD11466.1|  639|Homo sapiens heat shock protein protein.
          Length = 639

 Score =  202 bits (492), Expect = 1e-51
 Identities = 117/203 (57%), Positives = 131/203 (64%), Gaps = 5/203 (2%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           A+ PA+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM
Sbjct: 3   ARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 62

Query: 255 TPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVK--TKPFSPRKS 428
            PT   ++ +    +  K                V+    + +  +  K  TK F P + 
Sbjct: 63  NPTN--TIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEI 120

Query: 429 VPWCXXXXXXXXXXILANCAECS-YHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAA 605
                          L      +     AYFNDSQRQATKDAGTI+GLNVLRIINEPTAA
Sbjct: 121 SSMVLTKMKEIAEAYLGGKVHSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAA 180

Query: 606 AIAYGLDKKGT--GERNVLIFDL 668
           AIAYGLDKKG   GE+NVLIFDL
Sbjct: 181 AIAYGLDKKGCAGGEKNVLIFDL 203



 Score =  143 bits (346), Expect = 7e-34
 Identities = 64/75 (85%), Positives = 70/75 (93%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NTIFDAKRLIGRKFEDATVQ+DMKHWPF VVS+GGKPK++V YKGE KTFFPEE+SS
Sbjct: 63  NPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEISS 122

Query: 434 MVLTKMKETAEAYLG 478
           MVLTKMKE AEAYLG
Sbjct: 123 MVLTKMKEIAEAYLG 137



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTIEDGIFEVKSTAGDT
Sbjct: 205 GGTFDVSILTIEDGIFEVKSTAGDT 229


>L26336-1|AAA52698.1|  639|Homo sapiens heat shock protein protein.
          Length = 639

 Score =  202 bits (492), Expect = 1e-51
 Identities = 117/203 (57%), Positives = 131/203 (64%), Gaps = 5/203 (2%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           A+ PA+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM
Sbjct: 3   ARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 62

Query: 255 TPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVK--TKPFSPRKS 428
            PT   ++ +    +  K                V+    + +  +  K  TK F P + 
Sbjct: 63  NPTN--TIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEI 120

Query: 429 VPWCXXXXXXXXXXILANCAECS-YHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAA 605
                          L      +     AYFNDSQRQATKDAGTI+GLNVLRIINEPTAA
Sbjct: 121 SSMVLTKMKEIAEAYLGGKVHSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAA 180

Query: 606 AIAYGLDKKGT--GERNVLIFDL 668
           AIAYGLDKKG   GE+NVLIFDL
Sbjct: 181 AIAYGLDKKGCAGGEKNVLIFDL 203



 Score =  143 bits (346), Expect = 7e-34
 Identities = 64/75 (85%), Positives = 70/75 (93%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NTIFDAKRLIGRKFEDATVQ+DMKHWPF VVS+GGKPK++V YKGE KTFFPEE+SS
Sbjct: 63  NPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEISS 122

Query: 434 MVLTKMKETAEAYLG 478
           MVLTKMKE AEAYLG
Sbjct: 123 MVLTKMKEIAEAYLG 137



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTIEDGIFEVKSTAGDT
Sbjct: 205 GGTFDVSILTIEDGIFEVKSTAGDT 229


>DQ489378-1|ABE96830.1|  639|Homo sapiens heat shock 70kDa protein 2
           protein.
          Length = 639

 Score =  202 bits (492), Expect = 1e-51
 Identities = 117/203 (57%), Positives = 131/203 (64%), Gaps = 5/203 (2%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           A+ PA+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM
Sbjct: 3   ARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 62

Query: 255 TPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVK--TKPFSPRKS 428
            PT   ++ +    +  K                V+    + +  +  K  TK F P + 
Sbjct: 63  NPTN--TIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEI 120

Query: 429 VPWCXXXXXXXXXXILANCAECS-YHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAA 605
                          L      +     AYFNDSQRQATKDAGTI+GLNVLRIINEPTAA
Sbjct: 121 SSMVLTKMKEIAEAYLGGKVHSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAA 180

Query: 606 AIAYGLDKKGT--GERNVLIFDL 668
           AIAYGLDKKG   GE+NVLIFDL
Sbjct: 181 AIAYGLDKKGCAGGEKNVLIFDL 203



 Score =  143 bits (346), Expect = 7e-34
 Identities = 64/75 (85%), Positives = 70/75 (93%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NTIFDAKRLIGRKFEDATVQ+DMKHWPF VVS+GGKPK++V YKGE KTFFPEE+SS
Sbjct: 63  NPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEISS 122

Query: 434 MVLTKMKETAEAYLG 478
           MVLTKMKE AEAYLG
Sbjct: 123 MVLTKMKEIAEAYLG 137



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTIEDGIFEVKSTAGDT
Sbjct: 205 GGTFDVSILTIEDGIFEVKSTAGDT 229


>BT009815-1|AAP88817.1|  639|Homo sapiens heat shock 70kDa protein 2
           protein.
          Length = 639

 Score =  202 bits (492), Expect = 1e-51
 Identities = 117/203 (57%), Positives = 131/203 (64%), Gaps = 5/203 (2%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           A+ PA+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM
Sbjct: 3   ARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 62

Query: 255 TPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVK--TKPFSPRKS 428
            PT   ++ +    +  K                V+    + +  +  K  TK F P + 
Sbjct: 63  NPTN--TIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEI 120

Query: 429 VPWCXXXXXXXXXXILANCAECS-YHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAA 605
                          L      +     AYFNDSQRQATKDAGTI+GLNVLRIINEPTAA
Sbjct: 121 SSMVLTKMKEIAEAYLGGKVHSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAA 180

Query: 606 AIAYGLDKKGT--GERNVLIFDL 668
           AIAYGLDKKG   GE+NVLIFDL
Sbjct: 181 AIAYGLDKKGCAGGEKNVLIFDL 203



 Score =  143 bits (346), Expect = 7e-34
 Identities = 64/75 (85%), Positives = 70/75 (93%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NTIFDAKRLIGRKFEDATVQ+DMKHWPF VVS+GGKPK++V YKGE KTFFPEE+SS
Sbjct: 63  NPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEISS 122

Query: 434 MVLTKMKETAEAYLG 478
           MVLTKMKE AEAYLG
Sbjct: 123 MVLTKMKEIAEAYLG 137



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTIEDGIFEVKSTAGDT
Sbjct: 205 GGTFDVSILTIEDGIFEVKSTAGDT 229


>BC001752-1|AAH01752.1|  639|Homo sapiens heat shock 70kDa protein 2
           protein.
          Length = 639

 Score =  202 bits (492), Expect = 1e-51
 Identities = 117/203 (57%), Positives = 131/203 (64%), Gaps = 5/203 (2%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           A+ PA+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM
Sbjct: 3   ARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 62

Query: 255 TPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVK--TKPFSPRKS 428
            PT   ++ +    +  K                V+    + +  +  K  TK F P + 
Sbjct: 63  NPTN--TIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEI 120

Query: 429 VPWCXXXXXXXXXXILANCAECS-YHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAA 605
                          L      +     AYFNDSQRQATKDAGTI+GLNVLRIINEPTAA
Sbjct: 121 SSMVLTKMKEIAEAYLGGKVHSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAA 180

Query: 606 AIAYGLDKKGT--GERNVLIFDL 668
           AIAYGLDKKG   GE+NVLIFDL
Sbjct: 181 AIAYGLDKKGCAGGEKNVLIFDL 203



 Score =  143 bits (346), Expect = 7e-34
 Identities = 64/75 (85%), Positives = 70/75 (93%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NTIFDAKRLIGRKFEDATVQ+DMKHWPF VVS+GGKPK++V YKGE KTFFPEE+SS
Sbjct: 63  NPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEISS 122

Query: 434 MVLTKMKETAEAYLG 478
           MVLTKMKE AEAYLG
Sbjct: 123 MVLTKMKEIAEAYLG 137



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTIEDGIFEVKSTAGDT
Sbjct: 205 GGTFDVSILTIEDGIFEVKSTAGDT 229


>BC036107-1|AAH36107.1|  639|Homo sapiens HSPA2 protein protein.
          Length = 639

 Score =  199 bits (485), Expect = 1e-50
 Identities = 116/203 (57%), Positives = 130/203 (64%), Gaps = 5/203 (2%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           A+ PA+GIDLG TYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM
Sbjct: 3   ARGPAIGIDLGPTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 62

Query: 255 TPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVK--TKPFSPRKS 428
            PT   ++ +    +  K                V+    + +  +  K  TK F P + 
Sbjct: 63  NPTN--TIFDAKRLIGRKFGDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEI 120

Query: 429 VPWCXXXXXXXXXXILANCAECS-YHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAA 605
                          L      +     AYFNDSQRQATKDAGTI+GLNVLRIINEPTAA
Sbjct: 121 SSMVLTKMKEIAEAYLGGKVHSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAA 180

Query: 606 AIAYGLDKKGT--GERNVLIFDL 668
           AIAYGLDKKG   GE+NVLIFDL
Sbjct: 181 AIAYGLDKKGCAGGEKNVLIFDL 203



 Score =  140 bits (339), Expect = 5e-33
 Identities = 63/75 (84%), Positives = 69/75 (92%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NTIFDAKRLIGRKF DATVQ+DMKHWPF VVS+GGKPK++V YKGE KTFFPEE+SS
Sbjct: 63  NPTNTIFDAKRLIGRKFGDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEISS 122

Query: 434 MVLTKMKETAEAYLG 478
           MVLTKMKE AEAYLG
Sbjct: 123 MVLTKMKEIAEAYLG 137



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTIEDGIFEVKSTAGDT
Sbjct: 205 GGTFDVSILTIEDGIFEVKSTAGDT 229


>M59829-1|AAA63228.1|  641|Homo sapiens heat shock-induced protein
           protein.
          Length = 641

 Score =  196 bits (479), Expect = 5e-50
 Identities = 115/201 (57%), Positives = 128/201 (63%), Gaps = 3/201 (1%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           AK  A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM
Sbjct: 4   AKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 63

Query: 255 TPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVK--TKPFSPRKS 428
            P  Q ++ +    +  K           L    V+    + +  +  K   K F P + 
Sbjct: 64  NP--QNTVFDAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEI 121

Query: 429 VPWCXXXXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAA 605
                          L +          AYFNDSQRQATKDAG I+GLNVLRIINEPTAA
Sbjct: 122 SSMVLTKLKETAEAFLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAA 181

Query: 606 AIAYGLDKKGTGERNVLIFDL 668
           AIAYGLDK G GER+VLIFDL
Sbjct: 182 AIAYGLDKGGQGERHVLIFDL 202



 Score =  129 bits (312), Expect = 9e-30
 Identities = 55/75 (73%), Positives = 68/75 (90%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRKF D  VQADMK WPF+V+++GGKPK+ V+YKGE+K F+PEE+SS
Sbjct: 64  NPQNTVFDAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEISS 123

Query: 434 MVLTKMKETAEAYLG 478
           MVLTK+KETAEA+LG
Sbjct: 124 MVLTKLKETAEAFLG 138



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTI+DGIFEVK+TAGDT
Sbjct: 204 GGTFDVSILTIDDGIFEVKATAGDT 228


>D85730-1|BAA32521.1|  641|Homo sapiens Heat shock protein 70 testis
           variant protein.
          Length = 641

 Score =  196 bits (479), Expect = 5e-50
 Identities = 115/201 (57%), Positives = 128/201 (63%), Gaps = 3/201 (1%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           AK  A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM
Sbjct: 4   AKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 63

Query: 255 TPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVK--TKPFSPRKS 428
            P  Q ++ +    +  K           L    V+    + +  +  K   K F P + 
Sbjct: 64  NP--QNTVFDAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEI 121

Query: 429 VPWCXXXXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAA 605
                          L +          AYFNDSQRQATKDAG I+GLNVLRIINEPTAA
Sbjct: 122 SSMVLTKLKETAEAFLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAA 181

Query: 606 AIAYGLDKKGTGERNVLIFDL 668
           AIAYGLDK G GER+VLIFDL
Sbjct: 182 AIAYGLDKGGQGERHVLIFDL 202



 Score =  129 bits (312), Expect = 9e-30
 Identities = 55/75 (73%), Positives = 68/75 (90%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRKF D  VQADMK WPF+V+++GGKPK+ V+YKGE+K F+PEE+SS
Sbjct: 64  NPQNTVFDAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEISS 123

Query: 434 MVLTKMKETAEAYLG 478
           MVLTK+KETAEA+LG
Sbjct: 124 MVLTKLKETAEAFLG 138



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTI+DGIFEVK+TAGDT
Sbjct: 204 GGTFDVSILTIDDGIFEVKATAGDT 228


>DQ383515-1|ABC88476.1|  641|Homo sapiens heat shock 70kDa protein
           1-like protein.
          Length = 641

 Score =  196 bits (479), Expect = 5e-50
 Identities = 115/201 (57%), Positives = 128/201 (63%), Gaps = 3/201 (1%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           AK  A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM
Sbjct: 4   AKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 63

Query: 255 TPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVK--TKPFSPRKS 428
            P  Q ++ +    +  K           L    V+    + +  +  K   K F P + 
Sbjct: 64  NP--QNTVFDAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEI 121

Query: 429 VPWCXXXXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAA 605
                          L +          AYFNDSQRQATKDAG I+GLNVLRIINEPTAA
Sbjct: 122 SSMVLTKLKETAEAFLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAA 181

Query: 606 AIAYGLDKKGTGERNVLIFDL 668
           AIAYGLDK G GER+VLIFDL
Sbjct: 182 AIAYGLDKGGQGERHVLIFDL 202



 Score =  129 bits (312), Expect = 9e-30
 Identities = 55/75 (73%), Positives = 68/75 (90%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRKF D  VQADMK WPF+V+++GGKPK+ V+YKGE+K F+PEE+SS
Sbjct: 64  NPQNTVFDAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEISS 123

Query: 434 MVLTKMKETAEAYLG 478
           MVLTK+KETAEA+LG
Sbjct: 124 MVLTKLKETAEAFLG 138



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTI+DGIFEVK+TAGDT
Sbjct: 204 GGTFDVSILTIDDGIFEVKATAGDT 228


>BC034483-1|AAH34483.1|  641|Homo sapiens heat shock 70kDa protein
           1-like protein.
          Length = 641

 Score =  196 bits (479), Expect = 5e-50
 Identities = 115/201 (57%), Positives = 128/201 (63%), Gaps = 3/201 (1%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           AK  A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM
Sbjct: 4   AKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 63

Query: 255 TPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVK--TKPFSPRKS 428
            P  Q ++ +    +  K           L    V+    + +  +  K   K F P + 
Sbjct: 64  NP--QNTVFDAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEI 121

Query: 429 VPWCXXXXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAA 605
                          L +          AYFNDSQRQATKDAG I+GLNVLRIINEPTAA
Sbjct: 122 SSMVLTKLKETAEAFLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAA 181

Query: 606 AIAYGLDKKGTGERNVLIFDL 668
           AIAYGLDK G GER+VLIFDL
Sbjct: 182 AIAYGLDKGGQGERHVLIFDL 202



 Score =  129 bits (312), Expect = 9e-30
 Identities = 55/75 (73%), Positives = 68/75 (90%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRKF D  VQADMK WPF+V+++GGKPK+ V+YKGE+K F+PEE+SS
Sbjct: 64  NPQNTVFDAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEISS 123

Query: 434 MVLTKMKETAEAYLG 478
           MVLTK+KETAEA+LG
Sbjct: 124 MVLTKLKETAEAFLG 138



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTI+DGIFEVK+TAGDT
Sbjct: 204 GGTFDVSILTIDDGIFEVKATAGDT 228


>BA000025-10|BAB63301.1|  641|Homo sapiens heat shock protein
           protein.
          Length = 641

 Score =  196 bits (479), Expect = 5e-50
 Identities = 115/201 (57%), Positives = 128/201 (63%), Gaps = 3/201 (1%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           AK  A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM
Sbjct: 4   AKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 63

Query: 255 TPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVK--TKPFSPRKS 428
            P  Q ++ +    +  K           L    V+    + +  +  K   K F P + 
Sbjct: 64  NP--QNTVFDAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEI 121

Query: 429 VPWCXXXXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAA 605
                          L +          AYFNDSQRQATKDAG I+GLNVLRIINEPTAA
Sbjct: 122 SSMVLTKLKETAEAFLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAA 181

Query: 606 AIAYGLDKKGTGERNVLIFDL 668
           AIAYGLDK G GER+VLIFDL
Sbjct: 182 AIAYGLDKGGQGERHVLIFDL 202



 Score =  129 bits (312), Expect = 9e-30
 Identities = 55/75 (73%), Positives = 68/75 (90%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRKF D  VQADMK WPF+V+++GGKPK+ V+YKGE+K F+PEE+SS
Sbjct: 64  NPQNTVFDAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEISS 123

Query: 434 MVLTKMKETAEAYLG 478
           MVLTK+KETAEA+LG
Sbjct: 124 MVLTKLKETAEAFLG 138



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTI+DGIFEVK+TAGDT
Sbjct: 204 GGTFDVSILTIDDGIFEVKATAGDT 228


>AL929592-4|CAI18463.1|  641|Homo sapiens heat shock 70kDa protein
           1-like protein.
          Length = 641

 Score =  196 bits (479), Expect = 5e-50
 Identities = 115/201 (57%), Positives = 128/201 (63%), Gaps = 3/201 (1%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           AK  A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM
Sbjct: 4   AKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 63

Query: 255 TPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVK--TKPFSPRKS 428
            P  Q ++ +    +  K           L    V+    + +  +  K   K F P + 
Sbjct: 64  NP--QNTVFDAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEI 121

Query: 429 VPWCXXXXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAA 605
                          L +          AYFNDSQRQATKDAG I+GLNVLRIINEPTAA
Sbjct: 122 SSMVLTKLKETAEAFLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAA 181

Query: 606 AIAYGLDKKGTGERNVLIFDL 668
           AIAYGLDK G GER+VLIFDL
Sbjct: 182 AIAYGLDKGGQGERHVLIFDL 202



 Score =  129 bits (312), Expect = 9e-30
 Identities = 55/75 (73%), Positives = 68/75 (90%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRKF D  VQADMK WPF+V+++GGKPK+ V+YKGE+K F+PEE+SS
Sbjct: 64  NPQNTVFDAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEISS 123

Query: 434 MVLTKMKETAEAYLG 478
           MVLTK+KETAEA+LG
Sbjct: 124 MVLTKLKETAEAFLG 138



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTI+DGIFEVK+TAGDT
Sbjct: 204 GGTFDVSILTIDDGIFEVKATAGDT 228


>AL671762-4|CAI18215.1|  641|Homo sapiens heat shock 70kDa protein
           1-like protein.
          Length = 641

 Score =  196 bits (479), Expect = 5e-50
 Identities = 115/201 (57%), Positives = 128/201 (63%), Gaps = 3/201 (1%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           AK  A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM
Sbjct: 4   AKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 63

Query: 255 TPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVK--TKPFSPRKS 428
            P  Q ++ +    +  K           L    V+    + +  +  K   K F P + 
Sbjct: 64  NP--QNTVFDAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEI 121

Query: 429 VPWCXXXXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAA 605
                          L +          AYFNDSQRQATKDAG I+GLNVLRIINEPTAA
Sbjct: 122 SSMVLTKLKETAEAFLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAA 181

Query: 606 AIAYGLDKKGTGERNVLIFDL 668
           AIAYGLDK G GER+VLIFDL
Sbjct: 182 AIAYGLDKGGQGERHVLIFDL 202



 Score =  129 bits (312), Expect = 9e-30
 Identities = 55/75 (73%), Positives = 68/75 (90%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRKF D  VQADMK WPF+V+++GGKPK+ V+YKGE+K F+PEE+SS
Sbjct: 64  NPQNTVFDAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEISS 123

Query: 434 MVLTKMKETAEAYLG 478
           MVLTK+KETAEA+LG
Sbjct: 124 MVLTKLKETAEAFLG 138



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTI+DGIFEVK+TAGDT
Sbjct: 204 GGTFDVSILTIDDGIFEVKATAGDT 228


>AL662834-15|CAI17736.1|  641|Homo sapiens heat shock 70kDa protein
           1-like protein.
          Length = 641

 Score =  196 bits (479), Expect = 5e-50
 Identities = 115/201 (57%), Positives = 128/201 (63%), Gaps = 3/201 (1%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           AK  A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM
Sbjct: 4   AKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 63

Query: 255 TPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVK--TKPFSPRKS 428
            P  Q ++ +    +  K           L    V+    + +  +  K   K F P + 
Sbjct: 64  NP--QNTVFDAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEI 121

Query: 429 VPWCXXXXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAA 605
                          L +          AYFNDSQRQATKDAG I+GLNVLRIINEPTAA
Sbjct: 122 SSMVLTKLKETAEAFLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAA 181

Query: 606 AIAYGLDKKGTGERNVLIFDL 668
           AIAYGLDK G GER+VLIFDL
Sbjct: 182 AIAYGLDKGGQGERHVLIFDL 202



 Score =  129 bits (312), Expect = 9e-30
 Identities = 55/75 (73%), Positives = 68/75 (90%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRKF D  VQADMK WPF+V+++GGKPK+ V+YKGE+K F+PEE+SS
Sbjct: 64  NPQNTVFDAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEISS 123

Query: 434 MVLTKMKETAEAYLG 478
           MVLTK+KETAEA+LG
Sbjct: 124 MVLTKLKETAEAFLG 138



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTI+DGIFEVK+TAGDT
Sbjct: 204 GGTFDVSILTIDDGIFEVKATAGDT 228


>AK223386-1|BAD97106.1|  641|Homo sapiens heat shock 70kDa protein
           1-like variant protein.
          Length = 641

 Score =  196 bits (479), Expect = 5e-50
 Identities = 115/201 (57%), Positives = 128/201 (63%), Gaps = 3/201 (1%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           AK  A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM
Sbjct: 4   AKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 63

Query: 255 TPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVK--TKPFSPRKS 428
            P  Q ++ +    +  K           L    V+    + +  +  K   K F P + 
Sbjct: 64  NP--QNTVFDAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEI 121

Query: 429 VPWCXXXXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAA 605
                          L +          AYFNDSQRQATKDAG I+GLNVLRIINEPTAA
Sbjct: 122 SSMVLTKLKETAEAFLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAA 181

Query: 606 AIAYGLDKKGTGERNVLIFDL 668
           AIAYGLDK G GER+VLIFDL
Sbjct: 182 AIAYGLDKGGQGERHVLIFDL 202



 Score =  129 bits (312), Expect = 9e-30
 Identities = 55/75 (73%), Positives = 68/75 (90%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRKF D  VQADMK WPF+V+++GGKPK+ V+YKGE+K F+PEE+SS
Sbjct: 64  NPQNTVFDAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEISS 123

Query: 434 MVLTKMKETAEAYLG 478
           MVLTK+KETAEA+LG
Sbjct: 124 MVLTKLKETAEAFLG 138



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTI+DGIFEVK+TAGDT
Sbjct: 204 GGTFDVSILTIDDGIFEVKATAGDT 228


>AF134726-8|AAD21817.1|  641|Homo sapiens HSP70-HOM protein.
          Length = 641

 Score =  196 bits (479), Expect = 5e-50
 Identities = 115/201 (57%), Positives = 128/201 (63%), Gaps = 3/201 (1%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           AK  A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM
Sbjct: 4   AKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 63

Query: 255 TPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVK--TKPFSPRKS 428
            P  Q ++ +    +  K           L    V+    + +  +  K   K F P + 
Sbjct: 64  NP--QNTVFDAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEI 121

Query: 429 VPWCXXXXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAA 605
                          L +          AYFNDSQRQATKDAG I+GLNVLRIINEPTAA
Sbjct: 122 SSMVLTKLKETAEAFLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAA 181

Query: 606 AIAYGLDKKGTGERNVLIFDL 668
           AIAYGLDK G GER+VLIFDL
Sbjct: 182 AIAYGLDKGGQGERHVLIFDL 202



 Score =  129 bits (312), Expect = 9e-30
 Identities = 55/75 (73%), Positives = 68/75 (90%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRKF D  VQADMK WPF+V+++GGKPK+ V+YKGE+K F+PEE+SS
Sbjct: 64  NPQNTVFDAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEISS 123

Query: 434 MVLTKMKETAEAYLG 478
           MVLTK+KETAEA+LG
Sbjct: 124 MVLTKLKETAEAFLG 138



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTI+DGIFEVK+TAGDT
Sbjct: 204 GGTFDVSILTIDDGIFEVKATAGDT 228


>X87949-1|CAA61201.1|  653|Homo sapiens BiP protein.
          Length = 653

 Score =  169 bits (411), Expect = 9e-42
 Identities = 101/201 (50%), Positives = 126/201 (62%), Gaps = 8/201 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTP-T 263
           VGIDLGTTYSCVGVF++G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+   P  
Sbjct: 31  VGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPEN 90

Query: 264 TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRV-----KTKPFSPRKS 428
           T +    +     +      P+    +  L       +++ +I+V     +TK F+P + 
Sbjct: 91  TVFDAKRLIGRTWN-----DPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEI 145

Query: 429 VPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAA 605
                          L            AYFND+QRQATKDAGTI+GLNV+RIINEPTAA
Sbjct: 146 SAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAA 205

Query: 606 AIAYGLDKKGTGERNVLIFDL 668
           AIAYGLDK+  GE+N+L+FDL
Sbjct: 206 AIAYGLDKR-EGEKNILVFDL 225



 Score = 98.3 bits (234), Expect = 3e-20
 Identities = 49/77 (63%), Positives = 59/77 (76%), Gaps = 1/77 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAY-KGEDKTFFPEEVS 430
           +P NT+FDAKRLIGR + D +VQ D+K  PF+VV    KP I+V    G+ KTF PEE+S
Sbjct: 87  NPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEIS 146

Query: 431 SMVLTKMKETAEAYLGK 481
           +MVLTKMKETAEAYLGK
Sbjct: 147 AMVLTKMKETAEAYLGK 163



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 18/25 (72%), Positives = 23/25 (92%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+LTI++G+FEV +T GDT
Sbjct: 227 GGTFDVSLLTIDNGVFEVVATNGDT 251


>M19645-1|AAA52614.1|  653|Homo sapiens protein ( Human 78 kdalton
           glucose-regulated protein (GRP78) gene, complete cds. ).
          Length = 653

 Score =  169 bits (411), Expect = 9e-42
 Identities = 101/201 (50%), Positives = 126/201 (62%), Gaps = 8/201 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTP-T 263
           VGIDLGTTYSCVGVF++G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+   P  
Sbjct: 31  VGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPEN 90

Query: 264 TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRV-----KTKPFSPRKS 428
           T +    +     +      P+    +  L       +++ +I+V     +TK F+P + 
Sbjct: 91  TVFDAKRLIGRTWN-----DPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEI 145

Query: 429 VPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAA 605
                          L            AYFND+QRQATKDAGTI+GLNV+RIINEPTAA
Sbjct: 146 SAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAA 205

Query: 606 AIAYGLDKKGTGERNVLIFDL 668
           AIAYGLDK+  GE+N+L+FDL
Sbjct: 206 AIAYGLDKR-EGEKNILVFDL 225



 Score = 98.3 bits (234), Expect = 3e-20
 Identities = 49/77 (63%), Positives = 59/77 (76%), Gaps = 1/77 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAY-KGEDKTFFPEEVS 430
           +P NT+FDAKRLIGR + D +VQ D+K  PF+VV    KP I+V    G+ KTF PEE+S
Sbjct: 87  NPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEIS 146

Query: 431 SMVLTKMKETAEAYLGK 481
           +MVLTKMKETAEAYLGK
Sbjct: 147 AMVLTKMKETAEAYLGK 163



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 18/25 (72%), Positives = 23/25 (92%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+LTI++G+FEV +T GDT
Sbjct: 227 GGTFDVSLLTIDNGVFEVVATNGDT 251


>DQ385847-1|ABD04090.1|  654|Homo sapiens heat shock 70kDa protein 5
           (glucose-regulated protein, 78kDa) protein.
          Length = 654

 Score =  169 bits (411), Expect = 9e-42
 Identities = 101/201 (50%), Positives = 126/201 (62%), Gaps = 8/201 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTP-T 263
           VGIDLGTTYSCVGVF++G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+   P  
Sbjct: 31  VGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPEN 90

Query: 264 TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRV-----KTKPFSPRKS 428
           T +    +     +      P+    +  L       +++ +I+V     +TK F+P + 
Sbjct: 91  TVFDAKRLIGRTWN-----DPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEI 145

Query: 429 VPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAA 605
                          L            AYFND+QRQATKDAGTI+GLNV+RIINEPTAA
Sbjct: 146 SAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAA 205

Query: 606 AIAYGLDKKGTGERNVLIFDL 668
           AIAYGLDK+  GE+N+L+FDL
Sbjct: 206 AIAYGLDKR-EGEKNILVFDL 225



 Score = 98.3 bits (234), Expect = 3e-20
 Identities = 49/77 (63%), Positives = 59/77 (76%), Gaps = 1/77 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAY-KGEDKTFFPEEVS 430
           +P NT+FDAKRLIGR + D +VQ D+K  PF+VV    KP I+V    G+ KTF PEE+S
Sbjct: 87  NPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEIS 146

Query: 431 SMVLTKMKETAEAYLGK 481
           +MVLTKMKETAEAYLGK
Sbjct: 147 AMVLTKMKETAEAYLGK 163



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 18/25 (72%), Positives = 23/25 (92%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+LTI++G+FEV +T GDT
Sbjct: 227 GGTFDVSLLTIDNGVFEVVATNGDT 251


>BC112963-1|AAI12964.1|  655|Homo sapiens HSPA5 protein protein.
          Length = 655

 Score =  169 bits (411), Expect = 9e-42
 Identities = 101/201 (50%), Positives = 126/201 (62%), Gaps = 8/201 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTP-T 263
           VGIDLGTTYSCVGVF++G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+   P  
Sbjct: 32  VGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPEN 91

Query: 264 TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRV-----KTKPFSPRKS 428
           T +    +     +      P+    +  L       +++ +I+V     +TK F+P + 
Sbjct: 92  TVFDAKRLIGRTWN-----DPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEI 146

Query: 429 VPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAA 605
                          L            AYFND+QRQATKDAGTI+GLNV+RIINEPTAA
Sbjct: 147 SAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAA 206

Query: 606 AIAYGLDKKGTGERNVLIFDL 668
           AIAYGLDK+  GE+N+L+FDL
Sbjct: 207 AIAYGLDKR-EGEKNILVFDL 226



 Score = 98.3 bits (234), Expect = 3e-20
 Identities = 49/77 (63%), Positives = 59/77 (76%), Gaps = 1/77 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAY-KGEDKTFFPEEVS 430
           +P NT+FDAKRLIGR + D +VQ D+K  PF+VV    KP I+V    G+ KTF PEE+S
Sbjct: 88  NPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEIS 147

Query: 431 SMVLTKMKETAEAYLGK 481
           +MVLTKMKETAEAYLGK
Sbjct: 148 AMVLTKMKETAEAYLGK 164



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 18/25 (72%), Positives = 23/25 (92%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+LTI++G+FEV +T GDT
Sbjct: 228 GGTFDVSLLTIDNGVFEVVATNGDT 252


>BC020235-1|AAH20235.1|  654|Homo sapiens heat shock 70kDa protein 5
           (glucose-regulated protein, 78kDa) protein.
          Length = 654

 Score =  169 bits (411), Expect = 9e-42
 Identities = 101/201 (50%), Positives = 126/201 (62%), Gaps = 8/201 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTP-T 263
           VGIDLGTTYSCVGVF++G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+   P  
Sbjct: 31  VGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPEN 90

Query: 264 TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRV-----KTKPFSPRKS 428
           T +    +     +      P+    +  L       +++ +I+V     +TK F+P + 
Sbjct: 91  TVFDAKRLIGRTWN-----DPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEI 145

Query: 429 VPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAA 605
                          L            AYFND+QRQATKDAGTI+GLNV+RIINEPTAA
Sbjct: 146 SAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAA 205

Query: 606 AIAYGLDKKGTGERNVLIFDL 668
           AIAYGLDK+  GE+N+L+FDL
Sbjct: 206 AIAYGLDKR-EGEKNILVFDL 225



 Score = 98.3 bits (234), Expect = 3e-20
 Identities = 49/77 (63%), Positives = 59/77 (76%), Gaps = 1/77 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAY-KGEDKTFFPEEVS 430
           +P NT+FDAKRLIGR + D +VQ D+K  PF+VV    KP I+V    G+ KTF PEE+S
Sbjct: 87  NPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEIS 146

Query: 431 SMVLTKMKETAEAYLGK 481
           +MVLTKMKETAEAYLGK
Sbjct: 147 AMVLTKMKETAEAYLGK 163



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 18/25 (72%), Positives = 23/25 (92%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+LTI++G+FEV +T GDT
Sbjct: 227 GGTFDVSLLTIDNGVFEVVATNGDT 251


>AJ271729-1|CAB71335.1|  654|Homo sapiens glucose-regulated protein
           protein.
          Length = 654

 Score =  169 bits (411), Expect = 9e-42
 Identities = 101/201 (50%), Positives = 126/201 (62%), Gaps = 8/201 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTP-T 263
           VGIDLGTTYSCVGVF++G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+   P  
Sbjct: 31  VGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPEN 90

Query: 264 TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRV-----KTKPFSPRKS 428
           T +    +     +      P+    +  L       +++ +I+V     +TK F+P + 
Sbjct: 91  TVFDAKRLIGRTWN-----DPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEI 145

Query: 429 VPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAA 605
                          L            AYFND+QRQATKDAGTI+GLNV+RIINEPTAA
Sbjct: 146 SAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAA 205

Query: 606 AIAYGLDKKGTGERNVLIFDL 668
           AIAYGLDK+  GE+N+L+FDL
Sbjct: 206 AIAYGLDKR-EGEKNILVFDL 225



 Score = 98.3 bits (234), Expect = 3e-20
 Identities = 49/77 (63%), Positives = 59/77 (76%), Gaps = 1/77 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAY-KGEDKTFFPEEVS 430
           +P NT+FDAKRLIGR + D +VQ D+K  PF+VV    KP I+V    G+ KTF PEE+S
Sbjct: 87  NPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEIS 146

Query: 431 SMVLTKMKETAEAYLGK 481
           +MVLTKMKETAEAYLGK
Sbjct: 147 AMVLTKMKETAEAYLGK 163



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 18/25 (72%), Positives = 23/25 (92%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+LTI++G+FEV +T GDT
Sbjct: 227 GGTFDVSLLTIDNGVFEVVATNGDT 251


>AF216292-1|AAF42836.1|  654|Homo sapiens endoplasmic reticulum
           lumenal Ca2+ binding protein grp78 protein.
          Length = 654

 Score =  169 bits (411), Expect = 9e-42
 Identities = 101/201 (50%), Positives = 126/201 (62%), Gaps = 8/201 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTP-T 263
           VGIDLGTTYSCVGVF++G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+   P  
Sbjct: 31  VGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPEN 90

Query: 264 TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRV-----KTKPFSPRKS 428
           T +    +     +      P+    +  L       +++ +I+V     +TK F+P + 
Sbjct: 91  TVFDAKRLIGRTWN-----DPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEI 145

Query: 429 VPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAA 605
                          L            AYFND+QRQATKDAGTI+GLNV+RIINEPTAA
Sbjct: 146 SAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAA 205

Query: 606 AIAYGLDKKGTGERNVLIFDL 668
           AIAYGLDK+  GE+N+L+FDL
Sbjct: 206 AIAYGLDKR-EGEKNILVFDL 225



 Score = 98.3 bits (234), Expect = 3e-20
 Identities = 49/77 (63%), Positives = 59/77 (76%), Gaps = 1/77 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAY-KGEDKTFFPEEVS 430
           +P NT+FDAKRLIGR + D +VQ D+K  PF+VV    KP I+V    G+ KTF PEE+S
Sbjct: 87  NPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEIS 146

Query: 431 SMVLTKMKETAEAYLGK 481
           +MVLTKMKETAEAYLGK
Sbjct: 147 AMVLTKMKETAEAYLGK 163



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 18/25 (72%), Positives = 23/25 (92%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+LTI++G+FEV +T GDT
Sbjct: 227 GGTFDVSLLTIDNGVFEVVATNGDT 251


>AF188611-1|AAF13605.1|  639|Homo sapiens BiP protein protein.
          Length = 639

 Score =  169 bits (411), Expect = 9e-42
 Identities = 101/201 (50%), Positives = 126/201 (62%), Gaps = 8/201 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTP-T 263
           VGIDLGTTYSCVGVF++G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+   P  
Sbjct: 13  VGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPEN 72

Query: 264 TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRV-----KTKPFSPRKS 428
           T +    +     +      P+    +  L       +++ +I+V     +TK F+P + 
Sbjct: 73  TVFDAKRLIGRTWN-----DPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEI 127

Query: 429 VPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAA 605
                          L            AYFND+QRQATKDAGTI+GLNV+RIINEPTAA
Sbjct: 128 SAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAA 187

Query: 606 AIAYGLDKKGTGERNVLIFDL 668
           AIAYGLDK+  GE+N+L+FDL
Sbjct: 188 AIAYGLDKR-EGEKNILVFDL 207



 Score = 98.3 bits (234), Expect = 3e-20
 Identities = 49/77 (63%), Positives = 59/77 (76%), Gaps = 1/77 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAY-KGEDKTFFPEEVS 430
           +P NT+FDAKRLIGR + D +VQ D+K  PF+VV    KP I+V    G+ KTF PEE+S
Sbjct: 69  NPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEIS 128

Query: 431 SMVLTKMKETAEAYLGK 481
           +MVLTKMKETAEAYLGK
Sbjct: 129 AMVLTKMKETAEAYLGK 145



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 18/25 (72%), Positives = 23/25 (92%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+LTI++G+FEV +T GDT
Sbjct: 209 GGTFDVSLLTIDNGVFEVVATNGDT 233


>M11236-1|AAA52696.1|  247|Homo sapiens HSPA1L protein.
          Length = 247

 Score =  142 bits (344), Expect = 1e-33
 Identities = 61/76 (80%), Positives = 72/76 (94%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P+NT+FDAKRLIGRKF D TVQ+DMKHWPF+VVS GGKPK++V Y+GEDKTF+PEE+SS
Sbjct: 64  NPHNTVFDAKRLIGRKFADTTVQSDMKHWPFKVVSGGGKPKVRVCYRGEDKTFYPEEISS 123

Query: 434 MVLTKMKETAEAYLGK 481
           MVLTKMKETAEAYLG+
Sbjct: 124 MVLTKMKETAEAYLGQ 139



 Score =  114 bits (274), Expect = 4e-25
 Identities = 51/58 (87%), Positives = 55/58 (94%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           AVGIDLGTTYSCVGVFQ G+VEI+ANDQGNRTTPSYVAFTDTERL+GDAAKNQ A+ P
Sbjct: 8   AVGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFTDTERLVGDAAKNQAALNP 65



 Score = 84.2 bits (199), Expect = 4e-16
 Identities = 40/52 (76%), Positives = 46/52 (88%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           YF++SQRQATKDAG I+GL VL IINE TAAAIAYGLD++  G+RNVLIFDL
Sbjct: 151 YFSNSQRQATKDAGAIAGLKVLPIINEATAAAIAYGLDRRRAGKRNVLIFDL 202



 Score = 48.0 bits (109), Expect = 4e-05
 Identities = 20/25 (80%), Positives = 24/25 (96%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+LTI+ G+FEVK+TAGDT
Sbjct: 204 GGTFDVSVLTIDAGVFEVKATAGDT 228


>DQ521571-1|ABF47108.1|  643|Homo sapiens heat shock 70kDa protein 6
           (HSP70B') protein.
          Length = 643

 Score =  141 bits (342), Expect = 2e-33
 Identities = 60/76 (78%), Positives = 72/76 (94%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P+NT+FDAKRLIGRKF D TVQ+DMKHWPF VVS+GGKPK++V Y+GEDKTF+PEE+SS
Sbjct: 64  NPHNTVFDAKRLIGRKFADTTVQSDMKHWPFRVVSEGGKPKVRVCYRGEDKTFYPEEISS 123

Query: 434 MVLTKMKETAEAYLGK 481
           MVL+KMKETAEAYLG+
Sbjct: 124 MVLSKMKETAEAYLGQ 139



 Score =  112 bits (269), Expect = 1e-24
 Identities = 50/58 (86%), Positives = 55/58 (94%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           AVGIDLGTTYSCVGVFQ G+VEI+ANDQGNRTTPSYVAFTDTERL+GDAAK+Q A+ P
Sbjct: 8   AVGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFTDTERLVGDAAKSQAALNP 65



 Score =  103 bits (246), Expect = 9e-22
 Identities = 48/53 (90%), Positives = 51/53 (96%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD++G GERNVLIFDL
Sbjct: 150 AYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDRRGAGERNVLIFDL 202



 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 19/25 (76%), Positives = 24/25 (96%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+L+I+ G+FEVK+TAGDT
Sbjct: 204 GGTFDVSVLSIDAGVFEVKATAGDT 228


>BC035665-1|AAH35665.1|  643|Homo sapiens heat shock 70kDa protein 6
           (HSP70B') protein.
          Length = 643

 Score =  141 bits (342), Expect = 2e-33
 Identities = 60/76 (78%), Positives = 72/76 (94%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P+NT+FDAKRLIGRKF D TVQ+DMKHWPF VVS+GGKPK++V Y+GEDKTF+PEE+SS
Sbjct: 64  NPHNTVFDAKRLIGRKFADTTVQSDMKHWPFRVVSEGGKPKVRVCYRGEDKTFYPEEISS 123

Query: 434 MVLTKMKETAEAYLGK 481
           MVL+KMKETAEAYLG+
Sbjct: 124 MVLSKMKETAEAYLGQ 139



 Score =  112 bits (269), Expect = 1e-24
 Identities = 50/58 (86%), Positives = 55/58 (94%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           AVGIDLGTTYSCVGVFQ G+VEI+ANDQGNRTTPSYVAFTDTERL+GDAAK+Q A+ P
Sbjct: 8   AVGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFTDTERLVGDAAKSQAALNP 65



 Score =  103 bits (246), Expect = 9e-22
 Identities = 48/53 (90%), Positives = 51/53 (96%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD++G GERNVLIFDL
Sbjct: 150 AYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDRRGAGERNVLIFDL 202



 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 19/25 (76%), Positives = 24/25 (96%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+L+I+ G+FEVK+TAGDT
Sbjct: 204 GGTFDVSVLSIDAGVFEVKATAGDT 228


>AL590385-3|CAI16120.1|  643|Homo sapiens heat shock 70kDa protein 6
           (HSP70B') protein.
          Length = 643

 Score =  141 bits (342), Expect = 2e-33
 Identities = 60/76 (78%), Positives = 72/76 (94%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P+NT+FDAKRLIGRKF D TVQ+DMKHWPF VVS+GGKPK++V Y+GEDKTF+PEE+SS
Sbjct: 64  NPHNTVFDAKRLIGRKFADTTVQSDMKHWPFRVVSEGGKPKVRVCYRGEDKTFYPEEISS 123

Query: 434 MVLTKMKETAEAYLGK 481
           MVL+KMKETAEAYLG+
Sbjct: 124 MVLSKMKETAEAYLGQ 139



 Score =  112 bits (269), Expect = 1e-24
 Identities = 50/58 (86%), Positives = 55/58 (94%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           AVGIDLGTTYSCVGVFQ G+VEI+ANDQGNRTTPSYVAFTDTERL+GDAAK+Q A+ P
Sbjct: 8   AVGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFTDTERLVGDAAKSQAALNP 65



 Score =  103 bits (246), Expect = 9e-22
 Identities = 48/53 (90%), Positives = 51/53 (96%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD++G GERNVLIFDL
Sbjct: 150 AYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDRRGAGERNVLIFDL 202



 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 19/25 (76%), Positives = 24/25 (96%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+L+I+ G+FEVK+TAGDT
Sbjct: 204 GGTFDVSVLSIDAGVFEVKATAGDT 228


>AK223362-1|BAD97082.1|  643|Homo sapiens heat shock 70kDa protein 6
           (HSP70B') variant protein.
          Length = 643

 Score =  141 bits (342), Expect = 2e-33
 Identities = 60/76 (78%), Positives = 72/76 (94%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P+NT+FDAKRLIGRKF D TVQ+DMKHWPF VVS+GGKPK++V Y+GEDKTF+PEE+SS
Sbjct: 64  NPHNTVFDAKRLIGRKFADTTVQSDMKHWPFRVVSEGGKPKVRVCYRGEDKTFYPEEISS 123

Query: 434 MVLTKMKETAEAYLGK 481
           MVL+KMKETAEAYLG+
Sbjct: 124 MVLSKMKETAEAYLGQ 139



 Score =  112 bits (269), Expect = 1e-24
 Identities = 50/58 (86%), Positives = 55/58 (94%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           AVGIDLGTTYSCVGVFQ G+VEI+ANDQGNRTTPSYVAFTDTERL+GDAAK+Q A+ P
Sbjct: 8   AVGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFTDTERLVGDAAKSQAALNP 65



 Score =  101 bits (242), Expect = 3e-21
 Identities = 47/53 (88%), Positives = 50/53 (94%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD++G GERNV IFDL
Sbjct: 150 AYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDRRGAGERNVFIFDL 202



 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 19/25 (76%), Positives = 24/25 (96%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+L+I+ G+FEVK+TAGDT
Sbjct: 204 GGTFDVSVLSIDAGVFEVKATAGDT 228


>X51757-1|CAA36061.1|  643|Homo sapiens protein ( Human heat-shock
           protein HSP70B' gene. ).
          Length = 643

 Score =  140 bits (340), Expect = 4e-33
 Identities = 60/76 (78%), Positives = 72/76 (94%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P+NT+FDAKRLIGRKF D TVQ+DMKHWPF VVS+GGKPK+ V+Y+GEDKTF+PEE+SS
Sbjct: 64  NPHNTVFDAKRLIGRKFADTTVQSDMKHWPFRVVSEGGKPKVPVSYRGEDKTFYPEEISS 123

Query: 434 MVLTKMKETAEAYLGK 481
           MVL+KMKETAEAYLG+
Sbjct: 124 MVLSKMKETAEAYLGQ 139



 Score =  112 bits (269), Expect = 1e-24
 Identities = 50/58 (86%), Positives = 55/58 (94%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           AVGIDLGTTYSCVGVFQ G+VEI+ANDQGNRTTPSYVAFTDTERL+GDAAK+Q A+ P
Sbjct: 8   AVGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFTDTERLVGDAAKSQAALNP 65



 Score =  103 bits (246), Expect = 9e-22
 Identities = 48/53 (90%), Positives = 51/53 (96%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD++G GERNVLIFDL
Sbjct: 150 AYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDRRGAGERNVLIFDL 202



 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 19/25 (76%), Positives = 24/25 (96%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+L+I+ G+FEVK+TAGDT
Sbjct: 204 GGTFDVSVLSIDAGVFEVKATAGDT 228


>BC007276-1|AAH07276.2|  587|Homo sapiens HSPA8 protein protein.
          Length = 587

 Score =  134 bits (323), Expect = 4e-31
 Identities = 58/76 (76%), Positives = 69/76 (90%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGR+F+DA VQ+DMKHWPF VV+D G+PK++V YKGE K+F+PEEVSS
Sbjct: 3   NPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSS 62

Query: 434 MVLTKMKETAEAYLGK 481
           MVLTKMKE AEAYLGK
Sbjct: 63  MVLTKMKEIAEAYLGK 78



 Score =  100 bits (240), Expect = 5e-21
 Identities = 49/53 (92%), Positives = 50/53 (94%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYFNDSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKK   ERNVLIFDL
Sbjct: 89  AYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDL 141



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTIEDGIFEVKSTAGDT
Sbjct: 143 GGTFDVSILTIEDGIFEVKSTAGDT 167


>U10149-1|AAC50076.1|  125|Homo sapiens heat shock protein protein.
          Length = 125

 Score =  123 bits (297), Expect = 6e-28
 Identities = 54/64 (84%), Positives = 60/64 (93%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NTIFDAKRLIGRKFEDATVQ+DMKHWPF VVS+GGKPK++V YKGE KTFFPEE+SS
Sbjct: 62  NPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEISS 121

Query: 434 MVLT 445
           MVLT
Sbjct: 122 MVLT 125



 Score =  122 bits (295), Expect = 1e-27
 Identities = 58/63 (92%), Positives = 60/63 (95%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM 254
           A+ PA+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIG AAKNQVAM
Sbjct: 3   ARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIG-AAKNQVAM 61

Query: 255 TPT 263
            PT
Sbjct: 62  NPT 64


>L15189-1|AAA67526.1|  679|Homo sapiens MTHSP75 protein.
          Length = 679

 Score =  122 bits (294), Expect = 1e-27
 Identities = 82/213 (38%), Positives = 113/213 (53%), Gaps = 3/213 (1%)
 Frame = +3

Query: 39  RTSNKTD*KYKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTE 215
           R  ++ D   +  K   VGIDLGTT SCV V +  + +++ N +G RTTPS VAFT D E
Sbjct: 39  RLVSRRDYASEAIKGAVVGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGE 98

Query: 216 RLIGDAAKNQVAMTPT-TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HI 392
           RL+G  AK Q    P  T Y+   +         + K   +     +     +      +
Sbjct: 99  RLVGMPAKRQAVTNPNNTFYATKRLIGRRYDDPEVQKDIKNVPFKIVRASNGDA----WV 154

Query: 393 RVKTKPFSPRKSVPWCXXXXXXXXXXILANCAECSYHG-SAYFNDSQRQATKDAGTISGL 569
               K +SP +   +            L + A+ +     AYFNDSQRQATKDAG ISGL
Sbjct: 155 EAHGKLYSPSQIGAFVLMKMKETAENYLGHTAKNAVITVPAYFNDSQRQATKDAGQISGL 214

Query: 570 NVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NVLR+INEPTAAA+AYGLDK  + ++ + ++DL
Sbjct: 215 NVLRVINEPTAAALAYGLDK--SEDKVIAVYDL 245



 Score = 66.9 bits (156), Expect = 7e-11
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEVS 430
           +PNNT +  KRLIGR+++D  VQ D+K+ PF++V +  G   +    +   K + P ++ 
Sbjct: 112 NPNNTFYATKRLIGRRYDDPEVQKDIKNVPFKIVRASNGDAWV----EAHGKLYSPSQIG 167

Query: 431 SMVLTKMKETAEAYLG 478
           + VL KMKETAE YLG
Sbjct: 168 AFVLMKMKETAENYLG 183



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 19/25 (76%), Positives = 22/25 (88%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFD+SIL I+ G+FEVKST GDT
Sbjct: 247 GGTFDISILEIQKGVFEVKSTNGDT 271


>DQ531046-1|ABF50973.1|  679|Homo sapiens heat shock 70kDa protein
           9B (mortalin-2) protein.
          Length = 679

 Score =  122 bits (294), Expect = 1e-27
 Identities = 82/213 (38%), Positives = 113/213 (53%), Gaps = 3/213 (1%)
 Frame = +3

Query: 39  RTSNKTD*KYKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTE 215
           R  ++ D   +  K   VGIDLGTT SCV V +  + +++ N +G RTTPS VAFT D E
Sbjct: 39  RLVSRRDYASEAIKGAVVGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGE 98

Query: 216 RLIGDAAKNQVAMTPT-TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HI 392
           RL+G  AK Q    P  T Y+   +         + K   +     +     +      +
Sbjct: 99  RLVGMPAKRQAVTNPNNTFYATKRLIGRRYDDPEVQKDIKNVPFKIVRASNGDA----WV 154

Query: 393 RVKTKPFSPRKSVPWCXXXXXXXXXXILANCAECSYHG-SAYFNDSQRQATKDAGTISGL 569
               K +SP +   +            L + A+ +     AYFNDSQRQATKDAG ISGL
Sbjct: 155 EAHGKLYSPSQIGAFVLMKMKETAENYLGHTAKNAVITVPAYFNDSQRQATKDAGQISGL 214

Query: 570 NVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NVLR+INEPTAAA+AYGLDK  + ++ + ++DL
Sbjct: 215 NVLRVINEPTAAALAYGLDK--SEDKVIAVYDL 245



 Score = 66.9 bits (156), Expect = 7e-11
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEVS 430
           +PNNT +  KRLIGR+++D  VQ D+K+ PF++V +  G   +    +   K + P ++ 
Sbjct: 112 NPNNTFYATKRLIGRRYDDPEVQKDIKNVPFKIVRASNGDAWV----EAHGKLYSPSQIG 167

Query: 431 SMVLTKMKETAEAYLG 478
           + VL KMKETAE YLG
Sbjct: 168 AFVLMKMKETAENYLG 183



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 19/25 (76%), Positives = 22/25 (88%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFD+SIL I+ G+FEVKST GDT
Sbjct: 247 GGTFDISILEIQKGVFEVKSTNGDT 271


>BC030634-1|AAH30634.1|  681|Homo sapiens HSPA9 protein protein.
          Length = 681

 Score =  122 bits (294), Expect = 1e-27
 Identities = 82/213 (38%), Positives = 112/213 (52%), Gaps = 3/213 (1%)
 Frame = +3

Query: 39  RTSNKTD*KYKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTE 215
           R  ++ D   +  K   VGIDLGTT SCV V +  + +++ N +G RTTPS VAFT D E
Sbjct: 41  RLVSRRDYASEAIKGAVVGIDLGTTNSCVAVMEGKRAKVLENAEGARTTPSVVAFTADGE 100

Query: 216 RLIGDAAKNQVAMTPT-TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HI 392
           RL+G  AK Q    P  T Y+   +         + K   +     +     +      +
Sbjct: 101 RLVGMPAKRQAVTNPNNTFYATKRLIGRRYDDPEVQKDIKNVPFKIVRASNGDA----WV 156

Query: 393 RVKTKPFSPRKSVPWCXXXXXXXXXXILANCAECSYHG-SAYFNDSQRQATKDAGTISGL 569
               K +SP +   +            L   A+ +     AYFNDSQRQATKDAG ISGL
Sbjct: 157 EAHGKLYSPSQIGAFVLMKMKETAENYLGRTAKNAVITVPAYFNDSQRQATKDAGQISGL 216

Query: 570 NVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NVLR+INEPTAAA+AYGLDK  + ++ + ++DL
Sbjct: 217 NVLRVINEPTAAALAYGLDK--SEDKVIAVYDL 247



 Score = 68.1 bits (159), Expect = 3e-11
 Identities = 33/80 (41%), Positives = 51/80 (63%), Gaps = 1/80 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEVS 430
           +PNNT +  KRLIGR+++D  VQ D+K+ PF++V +  G   +    +   K + P ++ 
Sbjct: 114 NPNNTFYATKRLIGRRYDDPEVQKDIKNVPFKIVRASNGDAWV----EAHGKLYSPSQIG 169

Query: 431 SMVLTKMKETAEAYLGKLCR 490
           + VL KMKETAE YLG+  +
Sbjct: 170 AFVLMKMKETAENYLGRTAK 189



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 19/25 (76%), Positives = 22/25 (88%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFD+SIL I+ G+FEVKST GDT
Sbjct: 249 GGTFDISILEIQKGVFEVKSTNGDT 273


>BC024034-1|AAH24034.1|  679|Homo sapiens heat shock 70kDa protein 9
           (mortalin) protein.
          Length = 679

 Score =  122 bits (294), Expect = 1e-27
 Identities = 82/213 (38%), Positives = 112/213 (52%), Gaps = 3/213 (1%)
 Frame = +3

Query: 39  RTSNKTD*KYKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTE 215
           R  ++ D   +  K   VGIDLGTT SCV V +  + +++ N +G RTTPS VAFT D E
Sbjct: 39  RLVSRRDYASEAIKGAVVGIDLGTTNSCVAVMEGKRAKVLENAEGARTTPSVVAFTADGE 98

Query: 216 RLIGDAAKNQVAMTPT-TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HI 392
           RL+G  AK Q    P  T Y+   +         + K   +     +     +      +
Sbjct: 99  RLVGMPAKRQAVTNPNNTFYATKRLIGRRYDDPEVQKDIKNVPFKIVRASNGDA----WV 154

Query: 393 RVKTKPFSPRKSVPWCXXXXXXXXXXILANCAECSYHG-SAYFNDSQRQATKDAGTISGL 569
               K +SP +   +            L   A+ +     AYFNDSQRQATKDAG ISGL
Sbjct: 155 EAHGKLYSPSQIGAFVLMKMKETAENYLGRTAKNAVITVPAYFNDSQRQATKDAGQISGL 214

Query: 570 NVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NVLR+INEPTAAA+AYGLDK  + ++ + ++DL
Sbjct: 215 NVLRVINEPTAAALAYGLDK--SEDKVIAVYDL 245



 Score = 68.1 bits (159), Expect = 3e-11
 Identities = 33/80 (41%), Positives = 51/80 (63%), Gaps = 1/80 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEVS 430
           +PNNT +  KRLIGR+++D  VQ D+K+ PF++V +  G   +    +   K + P ++ 
Sbjct: 112 NPNNTFYATKRLIGRRYDDPEVQKDIKNVPFKIVRASNGDAWV----EAHGKLYSPSQIG 167

Query: 431 SMVLTKMKETAEAYLGKLCR 490
           + VL KMKETAE YLG+  +
Sbjct: 168 AFVLMKMKETAENYLGRTAK 187



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 19/25 (76%), Positives = 22/25 (88%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFD+SIL I+ G+FEVKST GDT
Sbjct: 247 GGTFDISILEIQKGVFEVKSTNGDT 271


>BC000478-1|AAH00478.1|  679|Homo sapiens heat shock 70kDa protein 9
           (mortalin) protein.
          Length = 679

 Score =  122 bits (294), Expect = 1e-27
 Identities = 82/213 (38%), Positives = 112/213 (52%), Gaps = 3/213 (1%)
 Frame = +3

Query: 39  RTSNKTD*KYKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTE 215
           R  ++ D   +  K   VGIDLGTT SCV V +  + +++ N +G RTTPS VAFT D E
Sbjct: 39  RLVSRRDYASEAIKGAVVGIDLGTTNSCVAVMEGKRAKVLENAEGARTTPSVVAFTADGE 98

Query: 216 RLIGDAAKNQVAMTPT-TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HI 392
           RL+G  AK Q    P  T Y+   +         + K   +     +     +      +
Sbjct: 99  RLVGMPAKRQAVTNPNNTFYATKRLIGRRYDDPEVQKDIKNVPFKIVRASNGDA----WV 154

Query: 393 RVKTKPFSPRKSVPWCXXXXXXXXXXILANCAECSYHG-SAYFNDSQRQATKDAGTISGL 569
               K +SP +   +            L   A+ +     AYFNDSQRQATKDAG ISGL
Sbjct: 155 EAHGKLYSPSQIGAFVLMKMKETAENYLGRTAKNAVITVPAYFNDSQRQATKDAGQISGL 214

Query: 570 NVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NVLR+INEPTAAA+AYGLDK  + ++ + ++DL
Sbjct: 215 NVLRVINEPTAAALAYGLDK--SEDKVIAVYDL 245



 Score = 68.1 bits (159), Expect = 3e-11
 Identities = 33/80 (41%), Positives = 51/80 (63%), Gaps = 1/80 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEVS 430
           +PNNT +  KRLIGR+++D  VQ D+K+ PF++V +  G   +    +   K + P ++ 
Sbjct: 112 NPNNTFYATKRLIGRRYDDPEVQKDIKNVPFKIVRASNGDAWV----EAHGKLYSPSQIG 167

Query: 431 SMVLTKMKETAEAYLGKLCR 490
           + VL KMKETAE YLG+  +
Sbjct: 168 AFVLMKMKETAENYLGRTAK 187



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 19/25 (76%), Positives = 22/25 (88%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFD+SIL I+ G+FEVKST GDT
Sbjct: 247 GGTFDISILEIQKGVFEVKSTNGDT 271


>AK222758-1|BAD96478.1|  679|Homo sapiens heat shock 70kDa protein
           9B precursor variant protein.
          Length = 679

 Score =  122 bits (294), Expect = 1e-27
 Identities = 82/213 (38%), Positives = 113/213 (53%), Gaps = 3/213 (1%)
 Frame = +3

Query: 39  RTSNKTD*KYKMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTE 215
           R  ++ D   +  K   VGIDLGTT SCV V +  + +++ N +G RTTPS VAFT D E
Sbjct: 39  RLVSRRDYASEAIKGAVVGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGE 98

Query: 216 RLIGDAAKNQVAMTPT-TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HI 392
           RL+G  AK Q    P  T Y+   +         + K   +     +     +      +
Sbjct: 99  RLVGMPAKRQAVTNPNNTFYATKRLIGRRYDDPEVQKDIKNVPFKIVRASNGDA----WV 154

Query: 393 RVKTKPFSPRKSVPWCXXXXXXXXXXILANCAECSYHG-SAYFNDSQRQATKDAGTISGL 569
               K +SP +   +            L + A+ +     AYFNDSQRQATKDAG ISGL
Sbjct: 155 EAHGKLYSPSQIGAFVLMKMKETAENYLGHTAKNAVITVPAYFNDSQRQATKDAGQISGL 214

Query: 570 NVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NVLR+INEPTAAA+AYGLDK  + ++ + ++DL
Sbjct: 215 NVLRVINEPTAAALAYGLDK--SEDKVIAVYDL 245



 Score = 66.9 bits (156), Expect = 7e-11
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEVS 430
           +PNNT +  KRLIGR+++D  VQ D+K+ PF++V +  G   +    +   K + P ++ 
Sbjct: 112 NPNNTFYATKRLIGRRYDDPEVQKDIKNVPFKIVRASNGDAWV----EAHGKLYSPSQIG 167

Query: 431 SMVLTKMKETAEAYLG 478
           + VL KMKETAE YLG
Sbjct: 168 AFVLMKMKETAENYLG 183



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 18/25 (72%), Positives = 21/25 (84%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GG FD+SIL I+ G+FEVKST GDT
Sbjct: 247 GGAFDISILEIQKGVFEVKSTNGDT 271


>AB018045-1|BAA77235.1|  151|Homo sapiens heat shock protein 72
           protein.
          Length = 151

 Score =  101 bits (242), Expect = 3e-21
 Identities = 48/53 (90%), Positives = 50/53 (94%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLD+ G GERNVLIFDL
Sbjct: 62  AYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDL 114



 Score = 92.7 bits (220), Expect = 1e-18
 Identities = 38/50 (76%), Positives = 46/50 (92%)
 Frame = +2

Query: 329 MKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLG 478
           MKHWPF+V++DG KPK++V+YKGE K F+PEE+SSMVLTKMKE AEAYLG
Sbjct: 1   MKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLG 50



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTI+DGIFEVK+TAGDT
Sbjct: 116 GGTFDVSILTIDDGIFEVKATAGDT 140


>BC119690-1|AAI19691.1|  509|Homo sapiens heat shock 70kDa protein
           14 protein.
          Length = 509

 Score = 90.2 bits (214), Expect = 7e-18
 Identities = 61/199 (30%), Positives = 102/199 (51%), Gaps = 5/199 (2%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAK-NQVAMTPT 263
           A+G+ LG T +CV V++ G+  ++AND G+R TP+ VA+++ E ++G AAK +++     
Sbjct: 3   AIGVHLGCTSACVAVYKDGRAGVVANDAGDRVTPAVVAYSENEEIVGLAAKQSRIRNISN 62

Query: 264 TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRV--KTKPFSPRKSVPW 437
           T   +  +    SS     K       S+  V+E N + R  I    +TK  +P      
Sbjct: 63  TVMKVKQILGRSSSDPQAQK---YIAESKCLVIEKNGKLRYEIDTGEETKFVNPEDVARL 119

Query: 438 CXXXXXXXXXXILANCAECSYHGSAY-FNDSQRQATKDAGTISGLNVLRIINEPTAAAIA 614
                      +L + A        + F + Q+ A  +A   +G NVLR+I+EP+AA +A
Sbjct: 120 IFSKMKETAHSVLGSDANDVVITVPFDFGEKQKNALGEAARAAGFNVLRLIHEPSAALLA 179

Query: 615 YGLDKKG-TGERNVLIFDL 668
           YG+ +   TG+ N+L+F L
Sbjct: 180 YGIGQDSPTGKSNILVFKL 198



 Score = 46.8 bits (106), Expect = 8e-05
 Identities = 23/73 (31%), Positives = 39/73 (53%)
 Frame = +2

Query: 260 NNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSMV 439
           +NT+   K+++GR   D   Q  +      V+   GK + ++    E K   PE+V+ ++
Sbjct: 61  SNTVMKVKQILGRSSSDPQAQKYIAESKCLVIEKNGKLRYEIDTGEETKFVNPEDVARLI 120

Query: 440 LTKMKETAEAYLG 478
            +KMKETA + LG
Sbjct: 121 FSKMKETAHSVLG 133


>AF112210-1|AAF17198.1|  509|Homo sapiens heat shock protein
           hsp70-related protein protein.
          Length = 509

 Score = 90.2 bits (214), Expect = 7e-18
 Identities = 61/199 (30%), Positives = 102/199 (51%), Gaps = 5/199 (2%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAK-NQVAMTPT 263
           A+G+ LG T +CV V++ G+  ++AND G+R TP+ VA+++ E ++G AAK +++     
Sbjct: 3   AIGVHLGCTSACVAVYKDGRAGVVANDAGDRVTPAVVAYSENEEIVGLAAKQSRIRNISN 62

Query: 264 TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRV--KTKPFSPRKSVPW 437
           T   +  +    SS     K       S+  V+E N + R  I    +TK  +P      
Sbjct: 63  TVMKVKQILGRSSSDPQAQK---YIAESKCLVIEKNGKLRYEIDTGEETKFVNPEDVARL 119

Query: 438 CXXXXXXXXXXILANCAECSYHGSAY-FNDSQRQATKDAGTISGLNVLRIINEPTAAAIA 614
                      +L + A        + F + Q+ A  +A   +G NVLR+I+EP+AA +A
Sbjct: 120 IFSKMKETAHSVLGSDANDVVITVPFDFGEKQKNALGEAARAAGFNVLRLIHEPSAALLA 179

Query: 615 YGLDKKG-TGERNVLIFDL 668
           YG+ +   TG+ N+L+F L
Sbjct: 180 YGIGQDSPTGKSNILVFKL 198



 Score = 46.8 bits (106), Expect = 8e-05
 Identities = 23/73 (31%), Positives = 39/73 (53%)
 Frame = +2

Query: 260 NNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSMV 439
           +NT+   K+++GR   D   Q  +      V+   GK + ++    E K   PE+V+ ++
Sbjct: 61  SNTVMKVKQILGRSSSDPQAQKYIAESKCLVIEKNGKLRYEIDTGEETKFVNPEDVARLI 120

Query: 440 LTKMKETAEAYLG 478
            +KMKETA + LG
Sbjct: 121 FSKMKETAHSVLG 133


>AF143723-1|AAF66640.1|  509|Homo sapiens heat shock protein HSP60
           protein.
          Length = 509

 Score = 87.8 bits (208), Expect = 4e-17
 Identities = 60/199 (30%), Positives = 101/199 (50%), Gaps = 5/199 (2%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAK-NQVAMTPT 263
           A+G+ LG T +C  V++ G+  ++AND G+R TP+ VA+++ E ++G AAK +++     
Sbjct: 3   AIGVHLGCTSACEAVYKDGRAGVVANDAGDRVTPAVVAYSENEEIVGLAAKQSRIRNISN 62

Query: 264 TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRV--KTKPFSPRKSVPW 437
           T   +  +    SS     K       S+  V+E N + R  I    +TK  +P      
Sbjct: 63  TVMKVKQILGRSSSDPQAQK---YIAESKCLVIEKNGKLRYEIDTGEETKFVNPEDVARL 119

Query: 438 CXXXXXXXXXXILANCAECSYHGSAY-FNDSQRQATKDAGTISGLNVLRIINEPTAAAIA 614
                      +L + A        + F + Q+ A  +A   +G NVLR+I+EP+AA +A
Sbjct: 120 IFSKMKETAHSVLGSDANDVVITVPFDFGEKQKNALGEAARAAGFNVLRLIHEPSAALLA 179

Query: 615 YGLDKKG-TGERNVLIFDL 668
           YG+ +   TG+ N+L+F L
Sbjct: 180 YGIGQDSPTGKSNILVFKL 198



 Score = 46.8 bits (106), Expect = 8e-05
 Identities = 23/73 (31%), Positives = 39/73 (53%)
 Frame = +2

Query: 260 NNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSMV 439
           +NT+   K+++GR   D   Q  +      V+   GK + ++    E K   PE+V+ ++
Sbjct: 61  SNTVMKVKQILGRSSSDPQAQKYIAESKCLVIEKNGKLRYEIDTGEETKFVNPEDVARLI 120

Query: 440 LTKMKETAEAYLG 478
            +KMKETA + LG
Sbjct: 121 FSKMKETAHSVLG 133


>DQ185038-1|ABD14419.1|  176|Homo sapiens heat shock 70 kDa protein
           9B protein.
          Length = 176

 Score = 80.6 bits (190), Expect = 5e-15
 Identities = 38/53 (71%), Positives = 47/53 (88%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYFNDSQRQATKDAG ISGL+VLR+INEPTAAA+AYGLDK  + ++ + ++DL
Sbjct: 63  AYFNDSQRQATKDAGQISGLSVLRVINEPTAAALAYGLDK--SEDKVIAVYDL 113



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 19/25 (76%), Positives = 22/25 (88%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFD+SIL I+ G+FEVKST GDT
Sbjct: 115 GGTFDISILEIQKGVFEVKSTNGDT 139



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 22/55 (40%), Positives = 34/55 (61%), Gaps = 1/55 (1%)
 Frame = +2

Query: 317 VQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLG 478
           VQ D+K+ PF++V +  G  +++       K + P ++ + VL KMKETAE YLG
Sbjct: 1   VQKDIKNVPFKIVRASNGDARVEA----HGKLYSPSQIGAFVLMKMKETAENYLG 51


>M24743-1|AAA59844.1|   36|Homo sapiens HSPA2 protein.
          Length = 36

 Score = 76.2 bits (179), Expect = 1e-13
 Identities = 34/36 (94%), Positives = 35/36 (97%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNR 179
           MAKA A+GIDLGTTYSCVGVFQHGKVEIIANDQGNR
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNR 36


>X67643-1|CAA47886.1|  474|Homo sapiens HS24/P52 protein.
          Length = 474

 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 59/195 (30%), Positives = 95/195 (48%), Gaps = 14/195 (7%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP--T 263
           VGIDLG     V V + G +E IAN+  +R TP+ ++F    R IG AAK+QV      T
Sbjct: 4   VGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQVISNAKNT 63

Query: 264 TQ---------YSMPNVSSDVSSKM--LLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
            Q         +S P V ++ S+    ++  PT  TG+ +++ ME           + + 
Sbjct: 64  VQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGI-KVTYME-----------EERN 111

Query: 411 FSPRKSVPWCXXXXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+  +               +L     +C      ++ D++R++  DA  I+GLN LR++
Sbjct: 112 FTTEQVTAMLLSKLKETAESVLKKPVVDCVVSVPCFYTDAERRSVMDATQIAGLNCLRLM 171

Query: 588 NEPTAAAIAYGLDKK 632
           NE TA A+AYG+ K+
Sbjct: 172 NETTAVALAYGIYKQ 186



 Score = 57.6 bits (133), Expect = 4e-08
 Identities = 30/74 (40%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMV 439
           NT+   KR  GR F D  V+A+  +  +++V    G   IKV Y  E++ F  E+V++M+
Sbjct: 62  NTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEERNFTTEQVTAML 121

Query: 440 LTKMKETAEAYLGK 481
           L+K+KETAE+ L K
Sbjct: 122 LSKLKETAESVLKK 135


>BC126124-1|AAI26125.1|  840|Homo sapiens heat shock 70kDa protein 4
           protein.
          Length = 840

 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 59/195 (30%), Positives = 95/195 (48%), Gaps = 14/195 (7%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP--T 263
           VGIDLG     V V + G +E IAN+  +R TP+ ++F    R IG AAK+QV      T
Sbjct: 4   VGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQVISNAKNT 63

Query: 264 TQ---------YSMPNVSSDVSSKM--LLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
            Q         +S P V ++ S+    ++  PT  TG+ +++ ME           + + 
Sbjct: 64  VQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGI-KVTYME-----------EERN 111

Query: 411 FSPRKSVPWCXXXXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+  +               +L     +C      ++ D++R++  DA  I+GLN LR++
Sbjct: 112 FTTEQVTAMLLSKLKETAESVLKKPVVDCVVSVPCFYTDAERRSVMDATQIAGLNCLRLM 171

Query: 588 NEPTAAAIAYGLDKK 632
           NE TA A+AYG+ K+
Sbjct: 172 NETTAVALAYGIYKQ 186



 Score = 57.6 bits (133), Expect = 4e-08
 Identities = 30/74 (40%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMV 439
           NT+   KR  GR F D  V+A+  +  +++V    G   IKV Y  E++ F  E+V++M+
Sbjct: 62  NTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEERNFTTEQVTAML 121

Query: 440 LTKMKETAEAYLGK 481
           L+K+KETAE+ L K
Sbjct: 122 LSKLKETAESVLKK 135


>BC126122-1|AAI26123.1|  840|Homo sapiens heat shock 70kDa protein 4
           protein.
          Length = 840

 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 59/195 (30%), Positives = 95/195 (48%), Gaps = 14/195 (7%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP--T 263
           VGIDLG     V V + G +E IAN+  +R TP+ ++F    R IG AAK+QV      T
Sbjct: 4   VGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQVISNAKNT 63

Query: 264 TQ---------YSMPNVSSDVSSKM--LLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
            Q         +S P V ++ S+    ++  PT  TG+ +++ ME           + + 
Sbjct: 64  VQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGI-KVTYME-----------EERN 111

Query: 411 FSPRKSVPWCXXXXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+  +               +L     +C      ++ D++R++  DA  I+GLN LR++
Sbjct: 112 FTTEQVTAMLLSKLKETAESVLKKPVVDCVVSVPCFYTDAERRSVMDATQIAGLNCLRLM 171

Query: 588 NEPTAAAIAYGLDKK 632
           NE TA A+AYG+ K+
Sbjct: 172 NETTAVALAYGIYKQ 186



 Score = 57.6 bits (133), Expect = 4e-08
 Identities = 30/74 (40%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMV 439
           NT+   KR  GR F D  V+A+  +  +++V    G   IKV Y  E++ F  E+V++M+
Sbjct: 62  NTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEERNFTTEQVTAML 121

Query: 440 LTKMKETAEAYLGK 481
           L+K+KETAE+ L K
Sbjct: 122 LSKLKETAESVLKK 135


>BC110861-1|AAI10862.1|  840|Homo sapiens heat shock 70kDa protein 4
           protein.
          Length = 840

 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 59/195 (30%), Positives = 95/195 (48%), Gaps = 14/195 (7%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP--T 263
           VGIDLG     V V + G +E IAN+  +R TP+ ++F    R IG AAK+QV      T
Sbjct: 4   VGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQVISNAKNT 63

Query: 264 TQ---------YSMPNVSSDVSSKM--LLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
            Q         +S P V ++ S+    ++  PT  TG+ +++ ME           + + 
Sbjct: 64  VQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGI-KVTYME-----------EERN 111

Query: 411 FSPRKSVPWCXXXXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+  +               +L     +C      ++ D++R++  DA  I+GLN LR++
Sbjct: 112 FTTEQVTAMLLSKLKETAESVLKKPVVDCVVSVPCFYTDAERRSVMDATQIAGLNCLRLM 171

Query: 588 NEPTAAAIAYGLDKK 632
           NE TA A+AYG+ K+
Sbjct: 172 NETTAVALAYGIYKQ 186



 Score = 57.6 bits (133), Expect = 4e-08
 Identities = 30/74 (40%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMV 439
           NT+   KR  GR F D  V+A+  +  +++V    G   IKV Y  E++ F  E+V++M+
Sbjct: 62  NTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEERNFTTEQVTAML 121

Query: 440 LTKMKETAEAYLGK 481
           L+K+KETAE+ L K
Sbjct: 122 LSKLKETAESVLKK 135


>AB209151-1|BAD92388.1|  782|Homo sapiens heat shock 70kDa protein 4
           isoform a variant protein.
          Length = 782

 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 59/195 (30%), Positives = 95/195 (48%), Gaps = 14/195 (7%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP--T 263
           VGIDLG     V V + G +E IAN+  +R TP+ ++F    R IG AAK+QV      T
Sbjct: 27  VGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQVISNAKNT 86

Query: 264 TQ---------YSMPNVSSDVSSKM--LLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
            Q         +S P V ++ S+    ++  PT  TG+ +++ ME           + + 
Sbjct: 87  VQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGI-KVTYME-----------EERN 134

Query: 411 FSPRKSVPWCXXXXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+  +               +L     +C      ++ D++R++  DA  I+GLN LR++
Sbjct: 135 FTTEQVTAMLLSKLKETAESVLKKPVVDCVVSVPCFYTDAERRSVMDATQIAGLNCLRLM 194

Query: 588 NEPTAAAIAYGLDKK 632
           NE TA A+AYG+ K+
Sbjct: 195 NETTAVALAYGIYKQ 209



 Score = 57.6 bits (133), Expect = 4e-08
 Identities = 30/74 (40%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMV 439
           NT+   KR  GR F D  V+A+  +  +++V    G   IKV Y  E++ F  E+V++M+
Sbjct: 85  NTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEERNFTTEQVTAML 144

Query: 440 LTKMKETAEAYLGK 481
           L+K+KETAE+ L K
Sbjct: 145 LSKLKETAESVLKK 158


>AB023420-1|BAA75062.1|  840|Homo sapiens apg-2 protein.
          Length = 840

 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 59/195 (30%), Positives = 95/195 (48%), Gaps = 14/195 (7%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP--T 263
           VGIDLG     V V + G +E IAN+  +R TP+ ++F    R IG AAK+QV      T
Sbjct: 4   VGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQVISNAKNT 63

Query: 264 TQ---------YSMPNVSSDVSSKM--LLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
            Q         +S P V ++ S+    ++  PT  TG+ +++ ME           + + 
Sbjct: 64  VQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGI-KVTYME-----------EERN 111

Query: 411 FSPRKSVPWCXXXXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+  +               +L     +C      ++ D++R++  DA  I+GLN LR++
Sbjct: 112 FTTEQVTAMLLSKLKETAESVLKKPVVDCVVSVPCFYTDAERRSVMDATQIAGLNCLRLM 171

Query: 588 NEPTAAAIAYGLDKK 632
           NE TA A+AYG+ K+
Sbjct: 172 NETTAVALAYGIYKQ 186



 Score = 57.6 bits (133), Expect = 4e-08
 Identities = 30/74 (40%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMV 439
           NT+   KR  GR F D  V+A+  +  +++V    G   IKV Y  E++ F  E+V++M+
Sbjct: 62  NTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEERNFTTEQVTAML 121

Query: 440 LTKMKETAEAYLGK 481
           L+K+KETAE+ L K
Sbjct: 122 LSKLKETAESVLKK 135


>L12723-1|AAA02807.1|  701|Homo sapiens heat shock protein 70
           protein.
          Length = 701

 Score = 68.9 bits (161), Expect = 2e-11
 Identities = 59/195 (30%), Positives = 95/195 (48%), Gaps = 14/195 (7%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP--T 263
           VGIDLG     V V + G +E IAN+  +R TP+ ++F    R IG AAK+QV      T
Sbjct: 4   VGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQVISNAKNT 63

Query: 264 TQ---------YSMPNVSSDVSSKM--LLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
            Q         +S P V ++ S+    ++  PT  TG+ +++ ME           + + 
Sbjct: 64  VQGFKRFHGRAFSDPFVEAEKSNLAYDIVQWPTGLTGI-KVTYME-----------EERN 111

Query: 411 FSPRKSVPWCXXXXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+  +               +L     +C      ++ D++R++  DA  I+GLN LR++
Sbjct: 112 FTTEQVTAMLLSKLKETAESVLKKPVVDCVVSVPCFYTDAERRSVMDATQIAGLNCLRLM 171

Query: 588 NEPTAAAIAYGLDKK 632
           NE TA A+AYG+ K+
Sbjct: 172 NETTAVALAYGIYKQ 186



 Score = 57.6 bits (133), Expect = 4e-08
 Identities = 30/74 (40%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMV 439
           NT+   KR  GR F D  V+A+  +  +++V    G   IKV Y  E++ F  E+V++M+
Sbjct: 62  NTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQWPTGLTGIKVTYMEEERNFTTEQVTAML 121

Query: 440 LTKMKETAEAYLGK 481
           L+K+KETAE+ L K
Sbjct: 122 LSKLKETAESVLKK 135


>EF197155-1|ABM69040.1|  839|Homo sapiens heat shock 70 kDa protein
           4-like protein protein.
          Length = 839

 Score = 66.9 bits (156), Expect = 7e-11
 Identities = 46/183 (25%), Positives = 82/183 (44%), Gaps = 2/183 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP-TT 266
           VGIDLG     + V + G +E IAN+  +R TP+ ++     R IG+AAK+Q+      T
Sbjct: 4   VGIDLGFLNCYIAVARSGGIETIANEYSDRCTPACISLGSRTRAIGNAAKSQIVTNVRNT 63

Query: 267 QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSVPWCXX 446
            +    +        ++             +   +   +     + +PF+  +       
Sbjct: 64  IHGFKKLHGRSFDDPIVQTERIRLPYELQKMPNGSAGVKVRYLEEERPFAIEQVTGMLLA 123

Query: 447 XXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL 623
                    L    A+C     ++F D++R++   A  ++GLN LR++NE TA A+AYG+
Sbjct: 124 KLKETSENALKKPVADCVISIPSFFTDAERRSVMAAAQVAGLNCLRLMNETTAVALAYGI 183

Query: 624 DKK 632
            K+
Sbjct: 184 YKQ 186



 Score = 55.6 bits (128), Expect = 2e-07
 Identities = 30/74 (40%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMV 439
           NTI   K+L GR F+D  VQ +    P+E+     G   +KV Y  E++ F  E+V+ M+
Sbjct: 62  NTIHGFKKLHGRSFDDPIVQTERIRLPYELQKMPNGSAGVKVRYLEEERPFAIEQVTGML 121

Query: 440 LTKMKETAEAYLGK 481
           L K+KET+E  L K
Sbjct: 122 LAKLKETSENALKK 135


>BC040560-1|AAH40560.1|  839|Homo sapiens heat shock 70kDa protein
           4-like protein.
          Length = 839

 Score = 66.9 bits (156), Expect = 7e-11
 Identities = 46/183 (25%), Positives = 82/183 (44%), Gaps = 2/183 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP-TT 266
           VGIDLG     + V + G +E IAN+  +R TP+ ++     R IG+AAK+Q+      T
Sbjct: 4   VGIDLGFLNCYIAVARSGGIETIANEYSDRCTPACISLGSRTRAIGNAAKSQIVTNVRNT 63

Query: 267 QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSVPWCXX 446
            +    +        ++             +   +   +     + +PF+  +       
Sbjct: 64  IHGFKKLHGRSFDDPIVQTERIRLPYELQKMPNGSAGVKVRYLEEERPFAIEQVTGMLLA 123

Query: 447 XXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL 623
                    L    A+C     ++F D++R++   A  ++GLN LR++NE TA A+AYG+
Sbjct: 124 KLKETSENALKKPVADCVISIPSFFTDAERRSVMAAAQVAGLNCLRLMNETTAVALAYGI 183

Query: 624 DKK 632
            K+
Sbjct: 184 YKQ 186



 Score = 55.6 bits (128), Expect = 2e-07
 Identities = 30/74 (40%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMV 439
           NTI   K+L GR F+D  VQ +    P+E+     G   +KV Y  E++ F  E+V+ M+
Sbjct: 62  NTIHGFKKLHGRSFDDPIVQTERIRLPYELQKMPNGSAGVKVRYLEEERPFAIEQVTGML 121

Query: 440 LTKMKETAEAYLGK 481
           L K+KET+E  L K
Sbjct: 122 LAKLKETSENALKK 135


>AY290862-1|AAP44471.1|  839|Homo sapiens heat shock protein apg-1
           protein.
          Length = 839

 Score = 66.9 bits (156), Expect = 7e-11
 Identities = 46/183 (25%), Positives = 82/183 (44%), Gaps = 2/183 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP-TT 266
           VGIDLG     + V + G +E IAN+  +R TP+ ++     R IG+AAK+Q+      T
Sbjct: 4   VGIDLGFLNCYIAVARSGGIETIANEYSDRCTPACISLGSRTRAIGNAAKSQIVTNVRNT 63

Query: 267 QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSVPWCXX 446
            +    +        ++             +   +   +     + +PF+  +       
Sbjct: 64  IHGFKKLHGRSFDDPIVQTERIRLPYELQKMPNGSAGVKVRYLEEERPFAIEQVTGMLLA 123

Query: 447 XXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL 623
                    L    A+C     ++F D++R++   A  ++GLN LR++NE TA A+AYG+
Sbjct: 124 KLKETSENALKKPVADCVISIPSFFTDAERRSVMAAAQVAGLNCLRLMNETTAVALAYGI 183

Query: 624 DKK 632
            K+
Sbjct: 184 YKQ 186



 Score = 55.6 bits (128), Expect = 2e-07
 Identities = 30/74 (40%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMV 439
           NTI   K+L GR F+D  VQ +    P+E+     G   +KV Y  E++ F  E+V+ M+
Sbjct: 62  NTIHGFKKLHGRSFDDPIVQTERIRLPYELQKMPNGSAGVKVRYLEEERPFAIEQVTGML 121

Query: 440 LTKMKETAEAYLGK 481
           L K+KET+E  L K
Sbjct: 122 LAKLKETSENALKK 135


>AC093591-2|AAY40975.1|  839|Homo sapiens unknown protein.
          Length = 839

 Score = 66.9 bits (156), Expect = 7e-11
 Identities = 46/183 (25%), Positives = 82/183 (44%), Gaps = 2/183 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP-TT 266
           VGIDLG     + V + G +E IAN+  +R TP+ ++     R IG+AAK+Q+      T
Sbjct: 4   VGIDLGFLNCYIAVARSGGIETIANEYSDRCTPACISLGSRTRAIGNAAKSQIVTNVRNT 63

Query: 267 QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSVPWCXX 446
            +    +        ++             +   +   +     + +PF+  +       
Sbjct: 64  IHGFKKLHGRSFDDPIVQTERIRLPYELQKMPNGSAGVKVRYLEEERPFAIEQVTGMLLA 123

Query: 447 XXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL 623
                    L    A+C     ++F D++R++   A  ++GLN LR++NE TA A+AYG+
Sbjct: 124 KLKETSENALKKPVADCVISIPSFFTDAERRSVMAAAQVAGLNCLRLMNETTAVALAYGI 183

Query: 624 DKK 632
            K+
Sbjct: 184 YKQ 186



 Score = 55.6 bits (128), Expect = 2e-07
 Identities = 30/74 (40%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMV 439
           NTI   K+L GR F+D  VQ +    P+E+     G   +KV Y  E++ F  E+V+ M+
Sbjct: 62  NTIHGFKKLHGRSFDDPIVQTERIRLPYELQKMPNGSAGVKVRYLEEERPFAIEQVTGML 121

Query: 440 LTKMKETAEAYLGK 481
           L K+KET+E  L K
Sbjct: 122 LAKLKETSENALKK 135


>AB023421-1|BAA75063.1|  839|Homo sapiens apg-1 protein.
          Length = 839

 Score = 66.9 bits (156), Expect = 7e-11
 Identities = 46/183 (25%), Positives = 82/183 (44%), Gaps = 2/183 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP-TT 266
           VGIDLG     + V + G +E IAN+  +R TP+ ++     R IG+AAK+Q+      T
Sbjct: 4   VGIDLGFLNCYIAVARSGGIETIANEYSDRCTPACISLGSRTRAIGNAAKSQIVTNVRNT 63

Query: 267 QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSVPWCXX 446
            +    +        ++             +   +   +     + +PF+  +       
Sbjct: 64  IHGFKKLHGRSFDDPIVQTERIRLPYELQKMPNGSAGVKVRYLEEERPFAIEQVTGMLLA 123

Query: 447 XXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL 623
                    L    A+C     ++F D++R++   A  ++GLN LR++NE TA A+AYG+
Sbjct: 124 KLKETSENALKKPVADCVISIPSFFTDAERRSVMAAAQVAGLNCLRLMNETTAVALAYGI 183

Query: 624 DKK 632
            K+
Sbjct: 184 YKQ 186



 Score = 55.6 bits (128), Expect = 2e-07
 Identities = 30/74 (40%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMV 439
           NTI   K+L GR F+D  VQ +    P+E+     G   +KV Y  E++ F  E+V+ M+
Sbjct: 62  NTIHGFKKLHGRSFDDPIVQTERIRLPYELQKMPNGSAGVKVRYLEEERPFAIEQVTGML 121

Query: 440 LTKMKETAEAYLGK 481
           L K+KET+E  L K
Sbjct: 122 LAKLKETSENALKK 135


>D86956-1|BAA13192.2|  949|Homo sapiens KIAA0201 protein.
          Length = 949

 Score = 66.5 bits (155), Expect = 9e-11
 Identities = 47/183 (25%), Positives = 81/183 (44%), Gaps = 2/183 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN-QVAMTPTT 266
           VG+D+G+    + V + G +E IAN+  +R TPS ++F    R IG AAKN Q+     T
Sbjct: 95  VGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSKNRTIGVAAKNQQITHANNT 154

Query: 267 QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSVPWCXX 446
             +         +   + K   +     + +    +  +     +   FS  +       
Sbjct: 155 VSNFKRFHGRAFNDPFIQKEKENLSYDLVPLKNGGVGIKVMYMGEEHLFSVEQITAMLLT 214

Query: 447 XXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL 623
                    L     +C     ++F D++R++  DA  I GLN LR++N+ TA A+ YG+
Sbjct: 215 KLKETAENSLKKPVTDCVISVPSFFTDAERRSVLDAAQIVGLNCLRLMNDMTAVALNYGI 274

Query: 624 DKK 632
            K+
Sbjct: 275 YKQ 277



 Score = 60.1 bits (139), Expect = 8e-09
 Identities = 31/75 (41%), Positives = 47/75 (62%), Gaps = 1/75 (1%)
 Frame = +2

Query: 260 NNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSM 436
           NNT+ + KR  GR F D  +Q + ++  +++V    G   IKV Y GE+  F  E++++M
Sbjct: 152 NNTVSNFKRFHGRAFNDPFIQKEKENLSYDLVPLKNGGVGIKVMYMGEEHLFSVEQITAM 211

Query: 437 VLTKMKETAEAYLGK 481
           +LTK+KETAE  L K
Sbjct: 212 LLTKLKETAENSLKK 226


>BC037553-1|AAH37553.1|  858|Homo sapiens heat shock 105kDa/110kDa
           protein 1 protein.
          Length = 858

 Score = 66.5 bits (155), Expect = 9e-11
 Identities = 47/183 (25%), Positives = 81/183 (44%), Gaps = 2/183 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN-QVAMTPTT 266
           VG+D+G+    + V + G +E IAN+  +R TPS ++F    R IG AAKN Q+     T
Sbjct: 4   VGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSKNRTIGVAAKNQQITHANNT 63

Query: 267 QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSVPWCXX 446
             +         +   + K   +     + +    +  +     +   FS  +       
Sbjct: 64  VSNFKRFHGRAFNDPFIQKEKENLSYDLVPLKNGGVGIKVMYMGEEHLFSVEQITAMLLT 123

Query: 447 XXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL 623
                    L     +C     ++F D++R++  DA  I GLN LR++N+ TA A+ YG+
Sbjct: 124 KLKETAENSLKKPVTDCVISVPSFFTDAERRSVLDAAQIVGLNCLRLMNDMTAVALNYGI 183

Query: 624 DKK 632
            K+
Sbjct: 184 YKQ 186



 Score = 60.1 bits (139), Expect = 8e-09
 Identities = 31/75 (41%), Positives = 47/75 (62%), Gaps = 1/75 (1%)
 Frame = +2

Query: 260 NNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSM 436
           NNT+ + KR  GR F D  +Q + ++  +++V    G   IKV Y GE+  F  E++++M
Sbjct: 61  NNTVSNFKRFHGRAFNDPFIQKEKENLSYDLVPLKNGGVGIKVMYMGEEHLFSVEQITAM 120

Query: 437 VLTKMKETAEAYLGK 481
           +LTK+KETAE  L K
Sbjct: 121 LLTKLKETAENSLKK 135


>AL137142-5|CAI12430.1|  858|Homo sapiens heat shock 105kDa/110kDa
           protein 1 protein.
          Length = 858

 Score = 66.5 bits (155), Expect = 9e-11
 Identities = 47/183 (25%), Positives = 81/183 (44%), Gaps = 2/183 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN-QVAMTPTT 266
           VG+D+G+    + V + G +E IAN+  +R TPS ++F    R IG AAKN Q+     T
Sbjct: 4   VGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSKNRTIGVAAKNQQITHANNT 63

Query: 267 QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSVPWCXX 446
             +         +   + K   +     + +    +  +     +   FS  +       
Sbjct: 64  VSNFKRFHGRAFNDPFIQKEKENLSYDLVPLKNGGVGIKVMYMGEEHLFSVEQITAMLLT 123

Query: 447 XXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL 623
                    L     +C     ++F D++R++  DA  I GLN LR++N+ TA A+ YG+
Sbjct: 124 KLKETAENSLKKPVTDCVISVPSFFTDAERRSVLDAAQIVGLNCLRLMNDMTAVALNYGI 183

Query: 624 DKK 632
            K+
Sbjct: 184 YKQ 186



 Score = 60.1 bits (139), Expect = 8e-09
 Identities = 31/75 (41%), Positives = 47/75 (62%), Gaps = 1/75 (1%)
 Frame = +2

Query: 260 NNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSM 436
           NNT+ + KR  GR F D  +Q + ++  +++V    G   IKV Y GE+  F  E++++M
Sbjct: 61  NNTVSNFKRFHGRAFNDPFIQKEKENLSYDLVPLKNGGVGIKVMYMGEEHLFSVEQITAM 120

Query: 437 VLTKMKETAEAYLGK 481
           +LTK+KETAE  L K
Sbjct: 121 LLTKLKETAENSLKK 135


>AL137142-4|CAI12428.1|  814|Homo sapiens heat shock 105kDa/110kDa
           protein 1 protein.
          Length = 814

 Score = 66.5 bits (155), Expect = 9e-11
 Identities = 47/183 (25%), Positives = 81/183 (44%), Gaps = 2/183 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN-QVAMTPTT 266
           VG+D+G+    + V + G +E IAN+  +R TPS ++F    R IG AAKN Q+     T
Sbjct: 4   VGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSKNRTIGVAAKNQQITHANNT 63

Query: 267 QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSVPWCXX 446
             +         +   + K   +     + +    +  +     +   FS  +       
Sbjct: 64  VSNFKRFHGRAFNDPFIQKEKENLSYDLVPLKNGGVGIKVMYMGEEHLFSVEQITAMLLT 123

Query: 447 XXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL 623
                    L     +C     ++F D++R++  DA  I GLN LR++N+ TA A+ YG+
Sbjct: 124 KLKETAENSLKKPVTDCVISVPSFFTDAERRSVLDAAQIVGLNCLRLMNDMTAVALNYGI 183

Query: 624 DKK 632
            K+
Sbjct: 184 YKQ 186



 Score = 60.1 bits (139), Expect = 8e-09
 Identities = 31/75 (41%), Positives = 47/75 (62%), Gaps = 1/75 (1%)
 Frame = +2

Query: 260 NNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSM 436
           NNT+ + KR  GR F D  +Q + ++  +++V    G   IKV Y GE+  F  E++++M
Sbjct: 61  NNTVSNFKRFHGRAFNDPFIQKEKENLSYDLVPLKNGGVGIKVMYMGEEHLFSVEQITAM 120

Query: 437 VLTKMKETAEAYLGK 481
           +LTK+KETAE  L K
Sbjct: 121 LLTKLKETAENSLKK 135


>AF039695-1|AAC18044.1|  872|Homo sapiens antigen NY-CO-25 protein.
          Length = 872

 Score = 66.5 bits (155), Expect = 9e-11
 Identities = 47/183 (25%), Positives = 81/183 (44%), Gaps = 2/183 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN-QVAMTPTT 266
           VG+D+G+    + V + G +E IAN+  +R TPS ++F    R IG AAKN Q+     T
Sbjct: 18  VGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSKNRTIGVAAKNQQITHANNT 77

Query: 267 QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSVPWCXX 446
             +         +   + K   +     + +    +  +     +   FS  +       
Sbjct: 78  VSNFKRFHGRAFNDPFIQKEKENLSYDLVPLKNGGVGIKVMYMGEEHLFSVEQITAMLLT 137

Query: 447 XXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL 623
                    L     +C     ++F D++R++  DA  I GLN LR++N+ TA A+ YG+
Sbjct: 138 KLKETAENSLKKPVTDCVISVPSFFTDAERRSVLDAAQIVGLNCLRLMNDMTAVALNYGI 197

Query: 624 DKK 632
            K+
Sbjct: 198 YKQ 200



 Score = 60.1 bits (139), Expect = 8e-09
 Identities = 31/75 (41%), Positives = 47/75 (62%), Gaps = 1/75 (1%)
 Frame = +2

Query: 260 NNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSM 436
           NNT+ + KR  GR F D  +Q + ++  +++V    G   IKV Y GE+  F  E++++M
Sbjct: 75  NNTVSNFKRFHGRAFNDPFIQKEKENLSYDLVPLKNGGVGIKVMYMGEEHLFSVEQITAM 134

Query: 437 VLTKMKETAEAYLGK 481
           +LTK+KETAE  L K
Sbjct: 135 LLTKLKETAENSLKK 149


>AB003334-1|BAA34780.1|  858|Homo sapiens HSP105 alpha protein.
          Length = 858

 Score = 66.5 bits (155), Expect = 9e-11
 Identities = 47/183 (25%), Positives = 81/183 (44%), Gaps = 2/183 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN-QVAMTPTT 266
           VG+D+G+    + V + G +E IAN+  +R TPS ++F    R IG AAKN Q+     T
Sbjct: 4   VGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSKNRTIGVAAKNQQITHANNT 63

Query: 267 QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSVPWCXX 446
             +         +   + K   +     + +    +  +     +   FS  +       
Sbjct: 64  VSNFKRFHGRAFNDPFIQKEKENLSYDLVPLKNGGVGIKVMYMGEEHLFSVEQITAMLLT 123

Query: 447 XXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL 623
                    L     +C     ++F D++R++  DA  I GLN LR++N+ TA A+ YG+
Sbjct: 124 KLKETAENSLKKPVTDCVISVPSFFTDAERRSVLDAAQIVGLNCLRLMNDMTAVALNYGI 183

Query: 624 DKK 632
            K+
Sbjct: 184 YKQ 186



 Score = 60.1 bits (139), Expect = 8e-09
 Identities = 31/75 (41%), Positives = 47/75 (62%), Gaps = 1/75 (1%)
 Frame = +2

Query: 260 NNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSM 436
           NNT+ + KR  GR F D  +Q + ++  +++V    G   IKV Y GE+  F  E++++M
Sbjct: 61  NNTVSNFKRFHGRAFNDPFIQKEKENLSYDLVPLKNGGVGIKVMYMGEEHLFSVEQITAM 120

Query: 437 VLTKMKETAEAYLGK 481
           +LTK+KETAE  L K
Sbjct: 121 LLTKLKETAENSLKK 135


>AB003333-1|BAA34779.1|  814|Homo sapiens HSP105 beta protein.
          Length = 814

 Score = 66.5 bits (155), Expect = 9e-11
 Identities = 47/183 (25%), Positives = 81/183 (44%), Gaps = 2/183 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN-QVAMTPTT 266
           VG+D+G+    + V + G +E IAN+  +R TPS ++F    R IG AAKN Q+     T
Sbjct: 4   VGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSKNRTIGVAAKNQQITHANNT 63

Query: 267 QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSVPWCXX 446
             +         +   + K   +     + +    +  +     +   FS  +       
Sbjct: 64  VSNFKRFHGRAFNDPFIQKEKENLSYDLVPLKNGGVGIKVMYMGEEHLFSVEQITAMLLT 123

Query: 447 XXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL 623
                    L     +C     ++F D++R++  DA  I GLN LR++N+ TA A+ YG+
Sbjct: 124 KLKETAENSLKKPVTDCVISVPSFFTDAERRSVLDAAQIVGLNCLRLMNDMTAVALNYGI 183

Query: 624 DKK 632
            K+
Sbjct: 184 YKQ 186



 Score = 60.1 bits (139), Expect = 8e-09
 Identities = 31/75 (41%), Positives = 47/75 (62%), Gaps = 1/75 (1%)
 Frame = +2

Query: 260 NNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSM 436
           NNT+ + KR  GR F D  +Q + ++  +++V    G   IKV Y GE+  F  E++++M
Sbjct: 61  NNTVSNFKRFHGRAFNDPFIQKEKENLSYDLVPLKNGGVGIKVMYMGEEHLFSVEQITAM 120

Query: 437 VLTKMKETAEAYLGK 481
           +LTK+KETAE  L K
Sbjct: 121 LLTKLKETAENSLKK 135


>U04735-1|AAA16954.1|  471|Homo sapiens microsomal stress 70 protein
           ATPase core protein.
          Length = 471

 Score = 65.7 bits (153), Expect = 2e-10
 Identities = 34/80 (42%), Positives = 48/80 (60%)
 Frame = +2

Query: 239 EPGGDDPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFP 418
           E    +P NTI+DAKR IG+ F    ++A++  +PF+V++  G  +  V    E  T  P
Sbjct: 86  ELADSNPQNTIYDAKRFIGKIFTAEELEAEIGRYPFKVLNKNGMVEFSVT-SNETITVSP 144

Query: 419 EEVSSMVLTKMKETAEAYLG 478
           E V S +L K+KE AEAYLG
Sbjct: 145 EYVGSRLLLKLKEMAEAYLG 164



 Score = 52.8 bits (121), Expect = 1e-06
 Identities = 27/53 (50%), Positives = 37/53 (69%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           A F+  QR +T +A  ++GL +LR+INEPTAAA+AYGL K      +VL+ DL
Sbjct: 176 AEFDLKQRNSTIEAANLAGLKILRVINEPTAAAMAYGLHKADV--FHVLVIDL 226



 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 24/48 (50%), Positives = 34/48 (70%), Gaps = 2/48 (4%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVF--QHGKVEIIANDQGNRTTPSYVAFTDTERLIG 227
           +GIDLGTTY  VGVF    GKV++I ++ G+ + PS V+FTD +  +G
Sbjct: 34  IGIDLGTTYCSVGVFFPGTGKVKVIPDENGHISIPSMVSFTDNDVYVG 81


>BC036370-1|AAH36370.1|  471|Homo sapiens stress 70 protein
           chaperone, microsome-associated, 60kDa protein.
          Length = 471

 Score = 65.7 bits (153), Expect = 2e-10
 Identities = 34/80 (42%), Positives = 48/80 (60%)
 Frame = +2

Query: 239 EPGGDDPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFP 418
           E    +P NTI+DAKR IG+ F    ++A++  +PF+V++  G  +  V    E  T  P
Sbjct: 86  ELADSNPQNTIYDAKRFIGKIFTAEELEAEIGRYPFKVLNKNGMVEFSVT-SNETITVSP 144

Query: 419 EEVSSMVLTKMKETAEAYLG 478
           E V S +L K+KE AEAYLG
Sbjct: 145 EYVGSRLLLKLKEMAEAYLG 164



 Score = 52.8 bits (121), Expect = 1e-06
 Identities = 27/53 (50%), Positives = 37/53 (69%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           A F+  QR +T +A  ++GL +LR+INEPTAAA+AYGL K      +VL+ DL
Sbjct: 176 AEFDLKQRNSTIEAANLAGLKILRVINEPTAAAMAYGLHKADV--FHVLVIDL 226



 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 24/48 (50%), Positives = 34/48 (70%), Gaps = 2/48 (4%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVF--QHGKVEIIANDQGNRTTPSYVAFTDTERLIG 227
           +GIDLGTTY  VGVF    GKV++I ++ G+ + PS V+FTD +  +G
Sbjct: 34  IGIDLGTTYCSVGVFFPGTGKVKVIPDENGHISIPSMVSFTDNDVYVG 81


>AL163206-1|CAB90390.1|  471|Homo sapiens human microsomal stress70
           protein ATPase core precursor protein.
          Length = 471

 Score = 65.7 bits (153), Expect = 2e-10
 Identities = 34/80 (42%), Positives = 48/80 (60%)
 Frame = +2

Query: 239 EPGGDDPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFP 418
           E    +P NTI+DAKR IG+ F    ++A++  +PF+V++  G  +  V    E  T  P
Sbjct: 86  ELADSNPQNTIYDAKRFIGKIFTAEELEAEIGRYPFKVLNKNGMVEFSVT-SNETITVSP 144

Query: 419 EEVSSMVLTKMKETAEAYLG 478
           E V S +L K+KE AEAYLG
Sbjct: 145 EYVGSRLLLKLKEMAEAYLG 164



 Score = 52.8 bits (121), Expect = 1e-06
 Identities = 27/53 (50%), Positives = 37/53 (69%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           A F+  QR +T +A  ++GL +LR+INEPTAAA+AYGL K      +VL+ DL
Sbjct: 176 AEFDLKQRNSTIEAANLAGLKILRVINEPTAAAMAYGLHKADV--FHVLVIDL 226



 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 24/48 (50%), Positives = 34/48 (70%), Gaps = 2/48 (4%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVF--QHGKVEIIANDQGNRTTPSYVAFTDTERLIG 227
           +GIDLGTTY  VGVF    GKV++I ++ G+ + PS V+FTD +  +G
Sbjct: 34  IGIDLGTTYCSVGVFFPGTGKVKVIPDENGHISIPSMVSFTDNDVYVG 81


>AF130249-1|AAD21091.1|  471|Homo sapiens STCH protein.
          Length = 471

 Score = 65.7 bits (153), Expect = 2e-10
 Identities = 34/80 (42%), Positives = 48/80 (60%)
 Frame = +2

Query: 239 EPGGDDPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFP 418
           E    +P NTI+DAKR IG+ F    ++A++  +PF+V++  G  +  V    E  T  P
Sbjct: 86  ELADSNPQNTIYDAKRFIGKIFTAEELEAEIGRYPFKVLNKNGMVEFSVT-SNETITVSP 144

Query: 419 EEVSSMVLTKMKETAEAYLG 478
           E V S +L K+KE AEAYLG
Sbjct: 145 EYVGSRLLLKLKEMAEAYLG 164



 Score = 52.8 bits (121), Expect = 1e-06
 Identities = 27/53 (50%), Positives = 37/53 (69%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           A F+  QR +T +A  ++GL +LR+INEPTAAA+AYGL K      +VL+ DL
Sbjct: 176 AEFDLKQRNSTIEAANLAGLKILRVINEPTAAAMAYGLHKADV--FHVLVIDL 226



 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 24/48 (50%), Positives = 34/48 (70%), Gaps = 2/48 (4%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVF--QHGKVEIIANDQGNRTTPSYVAFTDTERLIG 227
           +GIDLGTTY  VGVF    GKV++I ++ G+ + PS V+FTD +  +G
Sbjct: 34  IGIDLGTTYCSVGVFFPGTGKVKVIPDENGHISIPSMVSFTDNDVYVG 81


>AK223282-1|BAD97002.1|  471|Homo sapiens stress 70 protein
           chaperone, microsome-associated, 60kDa precursor variant
           protein.
          Length = 471

 Score = 63.7 bits (148), Expect = 7e-10
 Identities = 34/80 (42%), Positives = 47/80 (58%)
 Frame = +2

Query: 239 EPGGDDPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFP 418
           E    +P NTI DAKR IG+ F    ++A++  +PF+V++  G  +  V    E  T  P
Sbjct: 86  ELADSNPQNTICDAKRFIGKIFTAEELEAEIGRYPFKVLNKNGMVEFSVT-SNETITVSP 144

Query: 419 EEVSSMVLTKMKETAEAYLG 478
           E V S +L K+KE AEAYLG
Sbjct: 145 EYVGSRLLLKLKEMAEAYLG 164



 Score = 52.8 bits (121), Expect = 1e-06
 Identities = 27/53 (50%), Positives = 37/53 (69%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           A F+  QR +T +A  ++GL +LR+INEPTAAA+AYGL K      +VL+ DL
Sbjct: 176 AEFDLKQRNSTIEAANLAGLKILRVINEPTAAAMAYGLHKADV--FHVLVIDL 226



 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 24/48 (50%), Positives = 34/48 (70%), Gaps = 2/48 (4%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVF--QHGKVEIIANDQGNRTTPSYVAFTDTERLIG 227
           +GIDLGTTY  VGVF    GKV++I ++ G+ + PS V+FTD +  +G
Sbjct: 34  IGIDLGTTYCSVGVFFPGTGKVKVIPDENGHISIPSMVSFTDNDVYVG 81


>U65785-1|AAC50947.1|  999|Homo sapiens 150 kDa oxygen-regulated
           protein ORP150 protein.
          Length = 999

 Score = 61.3 bits (142), Expect = 4e-09
 Identities = 50/222 (22%), Positives = 98/222 (44%), Gaps = 11/222 (4%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP-- 260
           + +DLG+    V + + G  +EI+ N +  R TP  V   + ER  GD+A +     P  
Sbjct: 36  MSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLKENERFFGDSAASMAIKNPKA 95

Query: 261 TTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANL---RSR*HIRVKTK-PFSPRKS 428
           T +Y    +     +      P  +   +R    E      R   H ++ ++  FSP + 
Sbjct: 96  TLRYFQHLLGKQADN------PHVALYQARFPEHELTFDPQRQTVHFQISSQLQFSPEEV 149

Query: 429 VPWCXXXXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAA 605
           +                    +       +FN ++R+A   A  ++GL VL++IN+ TA 
Sbjct: 150 LGMVLNYSRSLAEDFAEQPIKDAVITVPVFFNQAERRAVLQAARMAGLKVLQLINDNTAT 209

Query: 606 AIAYGLDKK---GTGERNVLIFDLAAVPSTCPSLPSRMVSSR 722
           A++YG+ ++    T  +N++ +D+ +  + C  +  +MV ++
Sbjct: 210 ALSYGVFRRKDINTTAQNIMFYDMGSGSTVCTIVTYQMVKTK 251


>DQ372932-1|ABD14370.1|  999|Homo sapiens 150 kDa oxygen-regulated
           protein variant 1 protein.
          Length = 999

 Score = 61.3 bits (142), Expect = 4e-09
 Identities = 50/222 (22%), Positives = 98/222 (44%), Gaps = 11/222 (4%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP-- 260
           + +DLG+    V + + G  +EI+ N +  R TP  V   + ER  GD+A +     P  
Sbjct: 36  MSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLKENERFFGDSAASMAIKNPKA 95

Query: 261 TTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANL---RSR*HIRVKTK-PFSPRKS 428
           T +Y    +     +      P  +   +R    E      R   H ++ ++  FSP + 
Sbjct: 96  TLRYFQHLLGKQADN------PHVALYQARFPEHELTFDPQRQTVHFQISSQLQFSPEEV 149

Query: 429 VPWCXXXXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAA 605
           +                    +       +FN ++R+A   A  ++GL VL++IN+ TA 
Sbjct: 150 LGMVLNYSRSLAEDFAEQPIKDAVITVPVFFNQAERRAVLQAARMAGLKVLQLINDNTAT 209

Query: 606 AIAYGLDKK---GTGERNVLIFDLAAVPSTCPSLPSRMVSSR 722
           A++YG+ ++    T  +N++ +D+ +  + C  +  +MV ++
Sbjct: 210 ALSYGVFRRKDINTTAQNIMFYDMGSGSTVCTIVTYQMVKTK 251


>DQ350134-1|ABC75106.1|  999|Homo sapiens 150 kDa oxygen-regulated
           protein protein.
          Length = 999

 Score = 61.3 bits (142), Expect = 4e-09
 Identities = 50/222 (22%), Positives = 98/222 (44%), Gaps = 11/222 (4%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP-- 260
           + +DLG+    V + + G  +EI+ N +  R TP  V   + ER  GD+A +     P  
Sbjct: 36  MSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLKENERFFGDSAASMAIKNPKA 95

Query: 261 TTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANL---RSR*HIRVKTK-PFSPRKS 428
           T +Y    +     +      P  +   +R    E      R   H ++ ++  FSP + 
Sbjct: 96  TLRYFQHLLGKQADN------PHVALYQARFPEHELTFDPQRQTVHFQISSQLQFSPEEV 149

Query: 429 VPWCXXXXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAA 605
           +                    +       +FN ++R+A   A  ++GL VL++IN+ TA 
Sbjct: 150 LGMVLNYSRSLAEDFAEQPIKDAVITVPVFFNQAERRAVLQAARMAGLKVLQLINDNTAT 209

Query: 606 AIAYGLDKK---GTGERNVLIFDLAAVPSTCPSLPSRMVSSR 722
           A++YG+ ++    T  +N++ +D+ +  + C  +  +MV ++
Sbjct: 210 ALSYGVFRRKDINTTAQNIMFYDMGSGSTVCTIVTYQMVKTK 251


>BC072436-1|AAH72436.1|  678|Homo sapiens HYOU1 protein protein.
          Length = 678

 Score = 61.3 bits (142), Expect = 4e-09
 Identities = 50/222 (22%), Positives = 98/222 (44%), Gaps = 11/222 (4%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP-- 260
           + +DLG+    V + + G  +EI+ N +  R TP  V   + ER  GD+A +     P  
Sbjct: 36  MSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLKENERFFGDSAASMAIKNPKA 95

Query: 261 TTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANL---RSR*HIRVKTK-PFSPRKS 428
           T +Y    +     +      P  +   +R    E      R   H ++ ++  FSP + 
Sbjct: 96  TLRYFQHLLGKQADN------PHVALYQARFPEHELTFDPQRQTVHFQISSQLQFSPEEV 149

Query: 429 VPWCXXXXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAA 605
           +                    +       +FN ++R+A   A  ++GL VL++IN+ TA 
Sbjct: 150 LGMVLNYSRSLAEDFAEQPIKDAVITVPVFFNQAERRAVLQAARMAGLKVLQLINDNTAT 209

Query: 606 AIAYGLDKK---GTGERNVLIFDLAAVPSTCPSLPSRMVSSR 722
           A++YG+ ++    T  +N++ +D+ +  + C  +  +MV ++
Sbjct: 210 ALSYGVFRRKDINTTAQNIMFYDMGSGSTVCTIVTYQMVKTK 251


>BC017726-1|AAH17726.1|  657|Homo sapiens Unknown (protein for
           IMAGE:3898847) protein.
          Length = 657

 Score = 61.3 bits (142), Expect = 4e-09
 Identities = 50/222 (22%), Positives = 98/222 (44%), Gaps = 11/222 (4%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP-- 260
           + +DLG+    V + + G  +EI+ N +  R TP  V   + ER  GD+A +     P  
Sbjct: 36  MSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLKENERFFGDSAASMAIKNPKA 95

Query: 261 TTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANL---RSR*HIRVKTK-PFSPRKS 428
           T +Y    +     +      P  +   +R    E      R   H ++ ++  FSP + 
Sbjct: 96  TLRYFQHLLGKQADN------PHVALYQARFPEHELTFDPQRQTVHFQISSQLQFSPEEV 149

Query: 429 VPWCXXXXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAA 605
           +                    +       +FN ++R+A   A  ++GL VL++IN+ TA 
Sbjct: 150 LGMVLNYSRSLAEDFAEQPIKDAVITVPVFFNQAERRAVLQAARMAGLKVLQLINDNTAT 209

Query: 606 AIAYGLDKK---GTGERNVLIFDLAAVPSTCPSLPSRMVSSR 722
           A++YG+ ++    T  +N++ +D+ +  + C  +  +MV ++
Sbjct: 210 ALSYGVFRRKDINTTAQNIMFYDMGSGSTVCTIVTYQMVKTK 251


>AK222756-1|BAD96476.1|  999|Homo sapiens oxygen regulated protein
           precursor variant protein.
          Length = 999

 Score = 60.9 bits (141), Expect = 5e-09
 Identities = 50/222 (22%), Positives = 98/222 (44%), Gaps = 11/222 (4%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP-- 260
           + +DLG+    V + + G  +EI+ N +  R TP  V   + ER  GD+A +     P  
Sbjct: 36  MSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLEENERFFGDSAASMAIKDPKA 95

Query: 261 TTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANL---RSR*HIRVKTK-PFSPRKS 428
           T +Y    +     +      P  +   +R    E      R   H ++ ++  FSP + 
Sbjct: 96  TLRYFQHLLGKQADN------PHVALYQARFPEHELTFDPQRQTVHFQISSQLQFSPEEV 149

Query: 429 VPWCXXXXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAA 605
           +                    +       +FN ++R+A   A  ++GL VL++IN+ TA 
Sbjct: 150 LGMVLNYSRSLAEDFAEQPIKDAVITVPVFFNQAERRAVLQAARMAGLKVLQLINDNTAT 209

Query: 606 AIAYGLDKK---GTGERNVLIFDLAAVPSTCPSLPSRMVSSR 722
           A++YG+ ++    T  +N++ +D+ +  + C  +  +MV ++
Sbjct: 210 ALSYGVFRRKDINTTAQNIMFYDMGSGSTVCTIVTYQMVKTK 251


>BC108738-1|AAI08739.1|   88|Homo sapiens HSPA14 protein protein.
          Length = 88

 Score = 59.7 bits (138), Expect = 1e-08
 Identities = 23/51 (45%), Positives = 38/51 (74%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAK 239
           A+G+ LG T +CV V++ G+  ++AND G+R TP+ VA+++ E ++G AAK
Sbjct: 3   AIGVHLGCTSACVAVYKDGRAGVVANDAGDRVTPAVVAYSENEEIVGLAAK 53


>BC065281-1|AAH65281.1|   88|Homo sapiens HSPA14 protein protein.
          Length = 88

 Score = 59.7 bits (138), Expect = 1e-08
 Identities = 23/51 (45%), Positives = 38/51 (74%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAK 239
           A+G+ LG T +CV V++ G+  ++AND G+R TP+ VA+++ E ++G AAK
Sbjct: 3   AIGVHLGCTSACVAVYKDGRAGVVANDAGDRVTPAVVAYSENEEIVGLAAK 53


>X67640-1|CAA47885.1|  266|Homo sapiens HS24/P52 protein.
          Length = 266

 Score = 57.6 bits (133), Expect = 4e-08
 Identities = 30/74 (40%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMV 439
           NT+   KR  GR F D  V+A+  +  +++V    G   IKV Y  E++ F  E+V++M+
Sbjct: 26  NTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEERNFTTEQVTAML 85

Query: 440 LTKMKETAEAYLGK 481
           L+K+KETAE+ L K
Sbjct: 86  LSKLKETAESVLKK 99



 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 20/48 (41%), Positives = 33/48 (68%)
 Frame = +3

Query: 489 ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK 632
           +C      ++ D++R++  DA  I+GLN LR++NE TA A+AYG+ K+
Sbjct: 103 DCVVSVPCFYTDAERRSVMDATQIAGLNCLRLMNETTAVALAYGIYKQ 150


>AL929592-6|CAI18465.1|  476|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 476

 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 27/39 (69%), Positives = 30/39 (76%), Gaps = 2/39 (5%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVE--IIANDQGNRT 182
           MAKA A+GIDLGTTYSCVGVFQHGK E  ++  D G  T
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKGERNVLIFDLGGGT 39



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTI+DGIFEVK+TAGDT
Sbjct: 37  GGTFDVSILTIDDGIFEVKATAGDT 61


>AL671762-5|CAM25532.1|  476|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 476

 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 27/39 (69%), Positives = 30/39 (76%), Gaps = 2/39 (5%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVE--IIANDQGNRT 182
           MAKA A+GIDLGTTYSCVGVFQHGK E  ++  D G  T
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKGERNVLIFDLGGGT 39



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTI+DGIFEVK+TAGDT
Sbjct: 37  GGTFDVSILTIDDGIFEVKATAGDT 61


>AL662834-16|CAM24989.1|  476|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 476

 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 27/39 (69%), Positives = 30/39 (76%), Gaps = 2/39 (5%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVE--IIANDQGNRT 182
           MAKA A+GIDLGTTYSCVGVFQHGK E  ++  D G  T
Sbjct: 1   MAKAAAIGIDLGTTYSCVGVFQHGKGERNVLIFDLGGGT 39



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTI+DGIFEVK+TAGDT
Sbjct: 37  GGTFDVSILTIDDGIFEVKATAGDT 61


>AL137142-3|CAI12429.1|  817|Homo sapiens heat shock 105kDa/110kDa
           protein 1 protein.
          Length = 817

 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 23/52 (44%), Positives = 33/52 (63%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 245
           VG+D+G+    + V + G +E IAN+  +R TPS ++F    R IG AAKNQ
Sbjct: 4   VGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSKNRTIGVAAKNQ 55



 Score = 44.0 bits (99), Expect = 6e-04
 Identities = 18/41 (43%), Positives = 30/41 (73%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK 632
           ++F D++R++  DA  I GLN LR++N+ TA A+ YG+ K+
Sbjct: 105 SFFTDAERRSVLDAAQIVGLNCLRLMNDMTAVALNYGIYKQ 145


>BT007375-1|AAP36039.1|  148|Homo sapiens heat shock protein, 110
           kDa protein.
          Length = 148

 Score = 48.0 bits (109), Expect = 4e-05
 Identities = 25/53 (47%), Positives = 33/53 (62%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 248
           VGIDLG     V V + G +E IAN+  +R TP+ ++F    R IG AAK+QV
Sbjct: 4   VGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQV 56



 Score = 31.1 bits (67), Expect = 4.4
 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 1/49 (2%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDK 406
           NT+   KR  GR F D  V+A+  +  +++V    G   IKV Y  E++
Sbjct: 62  NTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEEQ 110


>BC002526-1|AAH02526.1|  148|Homo sapiens heat shock 70kDa protein 4
           protein.
          Length = 148

 Score = 48.0 bits (109), Expect = 4e-05
 Identities = 25/53 (47%), Positives = 33/53 (62%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 248
           VGIDLG     V V + G +E IAN+  +R TP+ ++F    R IG AAK+QV
Sbjct: 4   VGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQV 56



 Score = 31.1 bits (67), Expect = 4.4
 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 1/49 (2%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDK 406
           NT+   KR  GR F D  V+A+  +  +++V    G   IKV Y  E++
Sbjct: 62  NTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEEQ 110


>X04676-1|CAA28381.1|   22|Homo sapiens protein ( Human hsp 70 gene
           5' region for 70 kDa heat shock protein. ).
          Length = 22

 Score = 46.8 bits (106), Expect = 8e-05
 Identities = 21/22 (95%), Positives = 21/22 (95%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQ 137
           MAKA AVGIDLGTTYSCVGVFQ
Sbjct: 1   MAKAAAVGIDLGTTYSCVGVFQ 22


>BC004560-1|AAH04560.1|  147|Homo sapiens HYOU1 protein protein.
          Length = 147

 Score = 37.1 bits (82), Expect = 0.067
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           + +DLG+    V + + G  +EI+ N +  R TP  V   + ER  GD+A +     P
Sbjct: 36  MSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLKENERFFGDSAASMAIKNP 93


>BC103893-1|AAI03894.1|  346|Homo sapiens MAGEC3 protein protein.
          Length = 346

 Score = 32.7 bits (71), Expect = 1.4
 Identities = 18/35 (51%), Positives = 25/35 (71%)
 Frame = -2

Query: 468 ASAVSFIFVSTMELTSSGKKVLSSPLYATLILGLP 364
           +S+  F+F S+  L+SS    LSSPL +TLILG+P
Sbjct: 44  SSSFHFLFPSSSSLSSSSP--LSSPLPSTLILGVP 76


>AB037748-1|BAA92565.2| 1804|Homo sapiens KIAA1327 protein protein.
          Length = 1804

 Score = 31.1 bits (67), Expect = 4.4
 Identities = 19/55 (34%), Positives = 24/55 (43%)
 Frame = +3

Query: 99  DLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           D+    S  G    GKV II+    N  TP   A TD E  + DA + +  M  T
Sbjct: 807 DITNQNSLAGGKNQGKVLIISTSTTNDYTPQVSAITDVEGGLSDALRTEENMEGT 861


>U73737-1|AAB47425.1| 1360|Homo sapiens hMSH6 protein.
          Length = 1360

 Score = 30.3 bits (65), Expect = 7.6
 Identities = 17/59 (28%), Positives = 23/59 (38%)
 Frame = +2

Query: 5   TSNRARLLSCFKNK*QD*LKIQNGKSTRSRNRSGYHVLLRWCLPAREGGDHRQRPGQQD 181
           T N  R  S  +N  +    +  G    SR    YH  L W    +   +HR+RP   D
Sbjct: 333 TKNTLRAFSAPQNS-ESQAHVSGGGDDSSRPTVWYHETLEWLKEEKRRDEHRRRPDHPD 390


>U54777-1|AAB39212.2| 1360|Homo sapiens hMSH6 protein protein.
          Length = 1360

 Score = 30.3 bits (65), Expect = 7.6
 Identities = 17/59 (28%), Positives = 23/59 (38%)
 Frame = +2

Query: 5   TSNRARLLSCFKNK*QD*LKIQNGKSTRSRNRSGYHVLLRWCLPAREGGDHRQRPGQQD 181
           T N  R  S  +N  +    +  G    SR    YH  L W    +   +HR+RP   D
Sbjct: 333 TKNTLRAFSAPQNS-ESQAHVSGGGDDSSRPTVWYHETLEWLKEEKRRDEHRRRPDHPD 390


>U28946-1|AAC50461.1| 1360|Homo sapiens G/T mismatch binding protein
           protein.
          Length = 1360

 Score = 30.3 bits (65), Expect = 7.6
 Identities = 17/59 (28%), Positives = 23/59 (38%)
 Frame = +2

Query: 5   TSNRARLLSCFKNK*QD*LKIQNGKSTRSRNRSGYHVLLRWCLPAREGGDHRQRPGQQD 181
           T N  R  S  +N  +    +  G    SR    YH  L W    +   +HR+RP   D
Sbjct: 333 TKNTLRAFSAPQNS-ESQAHVSGGGDDSSRPTVWYHETLEWLKEEKRRDEHRRRPDHPD 390


>D89646-1|BAA23675.1| 1068|Homo sapiens GTBP-ALT protein.
          Length = 1068

 Score = 30.3 bits (65), Expect = 7.6
 Identities = 17/59 (28%), Positives = 23/59 (38%)
 Frame = +2

Query: 5   TSNRARLLSCFKNK*QD*LKIQNGKSTRSRNRSGYHVLLRWCLPAREGGDHRQRPGQQD 181
           T N  R  S  +N  +    +  G    SR    YH  L W    +   +HR+RP   D
Sbjct: 333 TKNTLRAFSAPQNS-ESQAHVSGGGDDSSRPTVWYHETLEWLKEEKRRDEHRRRPDHPD 390


>D89645-2|BAA23673.1| 1068|Homo sapiens GTBP-ALT protein.
          Length = 1068

 Score = 30.3 bits (65), Expect = 7.6
 Identities = 17/59 (28%), Positives = 23/59 (38%)
 Frame = +2

Query: 5   TSNRARLLSCFKNK*QD*LKIQNGKSTRSRNRSGYHVLLRWCLPAREGGDHRQRPGQQD 181
           T N  R  S  +N  +    +  G    SR    YH  L W    +   +HR+RP   D
Sbjct: 333 TKNTLRAFSAPQNS-ESQAHVSGGGDDSSRPTVWYHETLEWLKEEKRRDEHRRRPDHPD 390


>D89645-1|BAA23674.1| 1360|Homo sapiens GTBP-N protein.
          Length = 1360

 Score = 30.3 bits (65), Expect = 7.6
 Identities = 17/59 (28%), Positives = 23/59 (38%)
 Frame = +2

Query: 5   TSNRARLLSCFKNK*QD*LKIQNGKSTRSRNRSGYHVLLRWCLPAREGGDHRQRPGQQD 181
           T N  R  S  +N  +    +  G    SR    YH  L W    +   +HR+RP   D
Sbjct: 333 TKNTLRAFSAPQNS-ESQAHVSGGGDDSSRPTVWYHETLEWLKEEKRRDEHRRRPDHPD 390


>BC004246-1|AAH04246.1| 1360|Homo sapiens mutS homolog 6 (E. coli)
           protein.
          Length = 1360

 Score = 30.3 bits (65), Expect = 7.6
 Identities = 17/59 (28%), Positives = 23/59 (38%)
 Frame = +2

Query: 5   TSNRARLLSCFKNK*QD*LKIQNGKSTRSRNRSGYHVLLRWCLPAREGGDHRQRPGQQD 181
           T N  R  S  +N  +    +  G    SR    YH  L W    +   +HR+RP   D
Sbjct: 333 TKNTLRAFSAPQNS-ESQAHVSGGGDDSSRPTVWYHETLEWLKEEKRRDEHRRRPDHPD 390


>AY082894-1|AAL87401.1| 1358|Homo sapiens mutS homolog 6 (E. coli)
           protein.
          Length = 1358

 Score = 30.3 bits (65), Expect = 7.6
 Identities = 17/59 (28%), Positives = 23/59 (38%)
 Frame = +2

Query: 5   TSNRARLLSCFKNK*QD*LKIQNGKSTRSRNRSGYHVLLRWCLPAREGGDHRQRPGQQD 181
           T N  R  S  +N  +    +  G    SR    YH  L W    +   +HR+RP   D
Sbjct: 333 TKNTLRAFSAPQNS-ESQAHVSGGGDDSSRPTVWYHETLEWLKEEKRRDEHRRRPDHPD 390


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 119,659,565
Number of Sequences: 237096
Number of extensions: 2716576
Number of successful extensions: 7981
Number of sequences better than 10.0: 124
Number of HSP's better than 10.0 without gapping: 7186
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7902
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8903143626
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -