SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30166.Seq
         (892 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X05130-1|CAA28775.1|  508|Homo sapiens protein ( Human mRNA for ...   113   8e-25
M22806-1|AAC13652.1|  508|Homo sapiens prolyl 4-hydroxylase beta...   113   8e-25
J02783-1|AAA61169.1|  508|Homo sapiens P4HB protein.                  113   8e-25
BC071892-1|AAH71892.1|  508|Homo sapiens procollagen-proline, 2-...   113   8e-25
BC029617-1|AAH29617.1|  508|Homo sapiens procollagen-proline, 2-...   113   8e-25
BC010859-1|AAH10859.1|  508|Homo sapiens procollagen-proline, 2-...   113   8e-25
J05016-1|AAA58460.1|  645|Homo sapiens protein disulfide isomera...    90   9e-18
BC011754-1|AAH11754.1|  645|Homo sapiens protein disulfide isome...    90   9e-18
BC006344-1|AAH06344.1|  645|Homo sapiens protein disulfide isome...    90   9e-18
BC001928-1|AAH01928.1|  645|Homo sapiens protein disulfide isome...    90   9e-18
BC000425-1|AAH00425.1|  645|Homo sapiens protein disulfide isome...    90   9e-18
AC093743-1|AAQ96863.1|  645|Homo sapiens unknown protein.              90   9e-18
Z69667-12|CAI95587.1|  226|Homo sapiens protein disulfide isomer...    83   1e-15
Z69667-11|CAO78188.1|  522|Homo sapiens protein disulfide isomer...    83   1e-15
Z69667-10|CAI95586.1|  525|Homo sapiens protein disulfide isomer...    83   1e-15
U19948-1|AAC50401.1|  511|Homo sapiens protein disulfide isomera...    83   1e-15
EF450770-1|ABO43034.1|  555|Homo sapiens protein disulfide isome...    83   1e-15
BC075029-1|AAH75029.1|  519|Homo sapiens PDIA2 protein protein.        83   1e-15
BC000537-1|AAH00537.2|  520|Homo sapiens PDIA2 protein protein.        83   1e-15
AE006463-3|AAK61223.1|  525|Homo sapiens protein disulfide isome...    83   1e-15
AB127078-2|BAE48734.1|  525|Homo sapiens pancreatic protein disu...    83   1e-15
Z49835-1|CAA89996.1|  505|Homo sapiens protein disulfide isomera...    75   3e-13
U75885-1|AAC51518.1|  505|Homo sapiens ER-60 protein protein.          75   3e-13
U42068-1|AAC50331.1|  505|Homo sapiens P58 protein.                    75   3e-13
D83485-1|BAA11928.1|  505|Homo sapiens ER-60 protease protein.         75   3e-13
D16234-1|BAA03759.1|  505|Homo sapiens phospholipase C-alpha pro...    75   3e-13
BC071878-1|AAH71878.1|  505|Homo sapiens protein disulfide isome...    75   3e-13
BC036000-1|AAH36000.4|  505|Homo sapiens protein disulfide isome...    75   3e-13
BC014433-1|AAH14433.1|  505|Homo sapiens protein disulfide isome...    75   3e-13
D49489-1|BAA08450.1|  440|Homo sapiens human P5 protein.               66   2e-10
BC001312-1|AAH01312.1|  440|Homo sapiens protein disulfide isome...    66   2e-10
AC092687-3|AAY24070.1|  440|Homo sapiens unknown protein.              66   2e-10
U79278-1|AAB50217.1|  421|Homo sapiens protein disulfide isomera...    65   3e-10
AK127433-1|BAC86977.1|  492|Homo sapiens protein ( Homo sapiens ...    65   3e-10
BC107422-1|AAI07423.1|  423|Homo sapiens TXNDC10 protein protein.      57   7e-08
BC093794-1|AAH93794.1|  454|Homo sapiens thioredoxin domain cont...    57   7e-08
BC093792-1|AAH93792.1|  454|Homo sapiens thioredoxin domain cont...    57   7e-08
BC032325-1|AAH32325.1|  195|Homo sapiens TXNDC10 protein protein.      57   7e-08
AB058733-1|BAB47459.1|  486|Homo sapiens KIAA1830 protein protein.     57   7e-08
BC052310-1|AAH52310.1|  360|Homo sapiens TXNDC5 protein protein.       53   2e-06
BC001199-1|AAH01199.1|  324|Homo sapiens TXNDC5 protein protein.       53   2e-06
AY358646-1|AAQ89009.1|  432|Homo sapiens disulfide isomerase pro...    53   2e-06
AY326464-1|AAR99514.1|  363|Homo sapiens putative protein STRF8 ...    53   2e-06
AL834423-1|CAD39084.1|  244|Homo sapiens hypothetical protein pr...    53   2e-06
AL133541-2|CAI19473.1|  432|Homo sapiens thioredoxin domain cont...    53   2e-06
AK075291-1|BAC11526.1|  432|Homo sapiens protein ( Homo sapiens ...    53   2e-06
AJ440721-1|CAD29430.1|  363|Homo sapiens thioredoxin related pro...    53   2e-06
BC044936-1|AAH44936.1|  584|Homo sapiens protein disulfide isome...    52   3e-06
BC042607-1|AAH42607.1|  584|Homo sapiens protein disulfide isome...    52   3e-06
AK097476-1|BAC05068.1|  584|Homo sapiens protein ( Homo sapiens ...    52   3e-06
D49490-1|BAA08451.1|  519|Homo sapiens protein disulfide isomera...    50   9e-06
BC005374-1|AAH05374.1|  406|Homo sapiens thioredoxin domain cont...    50   1e-05
AY359048-1|AAQ89407.1|  406|Homo sapiens TXNDC4 protein.               50   1e-05
AL360084-2|CAH70308.1|  406|Homo sapiens thioredoxin domain cont...    50   1e-05
AL358937-2|CAI95319.1|  406|Homo sapiens thioredoxin domain cont...    50   1e-05
AL137072-1|CAH72172.1|  406|Homo sapiens thioredoxin domain cont...    50   1e-05
AJ344330-1|CAC87611.1|  406|Homo sapiens ERp44 protein protein.        50   1e-05
AB011145-1|BAA25499.1|  451|Homo sapiens KIAA0573 protein protein.     50   1e-05
X07077-1|CAA30112.1|  216|Homo sapiens glutathione-insulin trans...    49   2e-05
BC014504-1|AAH14504.1|  185|Homo sapiens P4HB protein protein.         49   2e-05
Z69667-13|CAI95588.1|  154|Homo sapiens protein disulfide isomer...    47   8e-05
BC001625-1|AAH01625.1|  262|Homo sapiens PDIA5 protein protein.        47   8e-05
BC126168-1|AAI26169.1|  793|Homo sapiens DnaJ (Hsp40) homolog, s...    40   0.012
BC117299-1|AAI17300.1|  793|Homo sapiens DnaJ (Hsp40) homolog, s...    40   0.012
AY358577-1|AAQ88940.1|  747|Homo sapiens disulfide isomerase pro...    40   0.012
AL832646-1|CAD89982.1|  792|Homo sapiens hypothetical protein pr...    40   0.012
AL137648-1|CAB70858.1|  464|Homo sapiens hypothetical protein pr...    40   0.012
AK074905-1|BAC11281.1|  277|Homo sapiens protein ( Homo sapiens ...    40   0.012
AK027696-1|BAB55304.1|  793|Homo sapiens protein ( Homo sapiens ...    40   0.012
AK027647-1|BAB55263.1|  793|Homo sapiens protein ( Homo sapiens ...    40   0.012
AK027450-1|BAB55121.1|  768|Homo sapiens protein ( Homo sapiens ...    40   0.012
AF490904-1|AAM09527.1|  747|Homo sapiens macrothioredoxin protein.     40   0.012
AF038503-1|AAN73271.1|  793|Homo sapiens ER-resident protein ERd...    40   0.012
AC105396-1|AAY24240.1|  464|Homo sapiens unknown protein.              40   0.012
BC107425-1|AAI07426.1|  332|Homo sapiens DNAJC10 protein protein.      39   0.021
AY089971-1|AAM09954.1|  275|Homo sapiens macrothioredoxin isofor...    39   0.021
AY010234-1|AAG32626.1|  332|Homo sapiens endoplasmic reticulum D...    39   0.021
AC073951-1|AAX88931.1|  329|Homo sapiens unknown protein.              39   0.021
AF314529-1|AAQ14565.1|  177|Homo sapiens endoplasmic reticulum D...    39   0.028
U78678-1|AAB41631.1|  166|Homo sapiens thioredoxin protein.            38   0.049
CR541917-1|CAG46715.1|  166|Homo sapiens TXN2 protein.                 38   0.049
CR541896-1|CAG46694.1|  166|Homo sapiens TXN2 protein.                 38   0.049
CR456601-1|CAG30487.1|  166|Homo sapiens TXN2 protein.                 38   0.049
BC050610-1|AAH50610.1|  166|Homo sapiens thioredoxin 2 protein.        38   0.049
BC013726-1|AAH13726.1|  166|Homo sapiens thioredoxin 2 protein.        38   0.049
AL022313-1|CAI19226.1|  197|Homo sapiens thioredoxin 2 protein.        38   0.049
AF480262-1|AAN05576.1|  166|Homo sapiens mitochondrial thioredox...    38   0.049
AF276920-1|AAF86467.1|  166|Homo sapiens thioredoxin 2 protein.        38   0.049
BC142650-1|AAI42651.1|  825|Homo sapiens KIAA1344 protein.             38   0.065
CR457152-1|CAG33433.1|  330|Homo sapiens LOC51061 protein.             37   0.11 
BC056874-1|AAH56874.2|  280|Homo sapiens thioredoxin domain cont...    37   0.11 
BC036460-1|AAH36460.1|  280|Homo sapiens thioredoxin domain cont...    37   0.11 
BC018635-1|AAH18635.1|  278|Homo sapiens TXNDC11 protein protein.      37   0.11 
BC013727-1|AAH13727.1|  330|Homo sapiens TXNDC11 protein protein.      37   0.11 
BC002856-1|AAH02856.1|  985|Homo sapiens TXNDC11 protein protein.      37   0.11 
AY358640-1|AAQ89003.1|  280|Homo sapiens TXNDC protein.                37   0.11 
AK075395-1|BAC11593.1|  280|Homo sapiens protein ( Homo sapiens ...    37   0.11 
AK027646-1|BAB55262.1|  958|Homo sapiens protein ( Homo sapiens ...    37   0.11 
AK027464-1|BAB55129.1|  506|Homo sapiens protein ( Homo sapiens ...    37   0.11 
AF131780-1|AAD20043.1|  330|Homo sapiens Unknown protein.              37   0.11 
AB048246-1|BAB20629.1|  280|Homo sapiens thioredoxin-related tra...    37   0.11 
BC150205-1|AAI50206.1|  825|Homo sapiens KIAA1344 protein.             36   0.15 
AJ318051-1|CAC85331.1|  698|Homo sapiens putative sulfhydryl oxi...    36   0.15 
AB037765-1|BAA92582.2|  858|Homo sapiens KIAA1344 protein protein.     36   0.15 
CR392000-1|CAM28352.1|  698|Homo sapiens quiescin Q6 sulfhydryl ...    36   0.20 
AL138781-1|CAI16881.2|  698|Homo sapiens quiescin Q6 sulfhydryl ...    36   0.20 
AK097656-1|BAC05133.1|  553|Homo sapiens protein ( Homo sapiens ...    35   0.34 
EF560747-1|ABQ59057.1|  538|Homo sapiens TXNDC2 protein protein.       35   0.46 
BC050132-1|AAH50132.1|  486|Homo sapiens thioredoxin domain cont...    35   0.46 
AF080095-1|AAK94950.1|  486|Homo sapiens sperm-specific thioredo...    35   0.46 
U97276-1|AAC09010.2|  747|Homo sapiens quiescin protein.               34   0.60 
BC100023-1|AAI00024.1|  747|Homo sapiens quiescin Q6 sulfhydryl ...    34   0.60 
BC017692-1|AAH17692.1|  604|Homo sapiens quiescin Q6 protein.          34   0.60 
BC014372-1|AAH14372.2|  289|Homo sapiens TXNL2 protein protein.        34   0.60 
BC005289-1|AAH05289.1|  335|Homo sapiens thioredoxin-like 2 prot...    34   0.60 
AY358941-1|AAQ89300.1|  747|Homo sapiens QSCN6 protein.                34   0.60 
AL390718-7|CAI14839.1|  604|Homo sapiens quiescin Q6 sulfhydryl ...    34   0.60 
AL390718-6|CAI14838.1|  747|Homo sapiens quiescin Q6 sulfhydryl ...    34   0.60 
AL139123-3|CAC40691.1|  335|Homo sapiens thioredoxin-like 3 prot...    34   0.60 
AJ010841-1|CAA09375.1|  335|Homo sapiens thioredoxin-like protei...    34   0.60 
AF361868-1|AAM00263.1|  604|Homo sapiens sulfhydryl oxidase prot...    34   0.60 
AF118652-1|AAF28844.1|  335|Homo sapiens PKCq-interacting protei...    34   0.60 
AF118649-1|AAF28841.1|  335|Homo sapiens PKCq-interacting protei...    34   0.60 
AB209280-1|BAD92517.1|  753|Homo sapiens quiescin Q6 isoform a v...    34   0.60 
BC036816-1|AAH36816.1|  588|Homo sapiens thioredoxin domain cont...    34   0.80 
AF305596-1|AAN04258.1|  588|Homo sapiens sperm-specific thioredo...    34   0.80 
AF202051-1|AAF20909.2|  588|Homo sapiens NM23-H8 protein.              34   0.80 
BC033787-1|AAH33787.1|  349|Homo sapiens thioredoxin domain cont...    33   1.8  
AY359004-1|AAQ89363.1|  349|Homo sapiens DJ971N18.2 protein.           33   1.8  
AL021396-2|CAC17521.1|  349|Homo sapiens thioredoxin domain cont...    33   1.8  
AK075404-1|BAC11599.1|  349|Homo sapiens protein ( Homo sapiens ...    33   1.8  
AK074838-1|BAC11237.1|  349|Homo sapiens protein ( Homo sapiens ...    33   1.8  
BC109100-1|AAI09101.1|  510|Homo sapiens zinc finger protein 75 ...    32   2.4  
AL831984-1|CAD89900.1|  510|Homo sapiens hypothetical protein pr...    32   2.4  
BC093062-1|AAH93062.1|  258|Homo sapiens TXNDC14 protein protein.      31   5.6  
BC008953-1|AAH08953.1|  172|Homo sapiens thioredoxin domain cont...    31   5.6  
BC008913-1|AAH08913.1|  172|Homo sapiens thioredoxin domain cont...    31   5.6  
BC001493-1|AAH01493.1|  172|Homo sapiens thioredoxin domain cont...    31   5.6  
BC000666-1|AAH00666.1|  296|Homo sapiens thioredoxin domain cont...    31   5.6  
AY358982-1|AAQ89341.1|  172|Homo sapiens ETRP713 protein.              31   5.6  
AY358501-1|AAQ88865.1|  296|Homo sapiens AVLA237 protein.              31   5.6  
AL445685-5|CAI17031.1|  172|Homo sapiens thioredoxin domain cont...    31   5.6  
AL158158-2|CAI14067.1|   85|Homo sapiens thioredoxin protein.          31   5.6  
AK223058-1|BAD96778.1|  296|Homo sapiens thioredoxin-related tra...    31   5.6  
AK075359-1|BAC11569.1|  372|Homo sapiens protein ( Homo sapiens ...    31   5.6  
AF543416-1|AAN34781.1|  172|Homo sapiens thioredoxin-like protei...    31   5.6  
AF132965-1|AAD27740.1|  296|Homo sapiens CGI-31 protein protein.       31   5.6  
AF131758-1|AAD20035.1|  172|Homo sapiens Unknown protein.              31   5.6  
AF065241-1|AAC17430.1|   84|Homo sapiens thioredoxin delta 3 pro...    31   5.6  
AF059753-1|AAG43122.1|  372|Homo sapiens My009 protein protein.        31   5.6  
X77584-1|CAA54687.1|  105|Homo sapiens ATL-derived factor/thiore...    31   7.4  
X54539-1|CAA38410.1|  105|Homo sapiens thioredoxin protein.            31   7.4  
CR407665-1|CAG28593.1|  105|Homo sapiens TXN protein.                  31   7.4  
BC054866-1|AAH54866.1|  105|Homo sapiens thioredoxin protein.          31   7.4  
BC003377-1|AAH03377.1|  105|Homo sapiens thioredoxin protein.          31   7.4  
AY451237-1|AAS66642.1|  296|Homo sapiens proliferation-inducing ...    31   7.4  
AY004872-1|AAF87085.1|  105|Homo sapiens thioredoxin protein.          31   7.4  
AL158158-1|CAI14066.1|  105|Homo sapiens thioredoxin protein.          31   7.4  
AF548001-1|AAN33187.1|  105|Homo sapiens thioredoxin protein.          31   7.4  
AF313911-1|AAG34699.1|  105|Homo sapiens thioredoxin protein.          31   7.4  
L42379-1|AAA89173.1|  793|Homo sapiens bone-derived growth facto...    30   9.8  
J04026-1|AAA74596.1|  105|Homo sapiens thioredoxin protein.            30   9.8  
BC034713-1|AAH34713.1|   78|Homo sapiens DNAJC10 protein protein.      30   9.8  
AF276919-1|AAF86466.1|  105|Homo sapiens thioredoxin 1 protein.        30   9.8  

>X05130-1|CAA28775.1|  508|Homo sapiens protein ( Human mRNA for
           prolyl 4-hydoxylase beta subunit (EC 1.14.11.2)
           (procollagen-L-proline, 2-oxoglutarate:oxygen
           oxidoreductase, 4-hydroxylating). ).
          Length = 508

 Score =  113 bits (272), Expect = 8e-25
 Identities = 51/87 (58%), Positives = 67/87 (77%), Gaps = 3/87 (3%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNG---SPIDYSGGRQADDIISWLKKKTG 426
           S I+LAKVDAT+E DLA+ YGVRGYPT+KFFRNG   SP +Y+ GR+ADDI++WLKK+TG
Sbjct: 75  SEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGREADDIVNWLKKRTG 134

Query: 427 PPAVEVTSAEQAKELIDANTVIVFGFF 507
           P A  +     A+ L++++ V V GFF
Sbjct: 135 PAATTLPDGAAAESLVESSEVAVIGFF 161



 Score = 74.5 bits (175), Expect = 5e-13
 Identities = 34/60 (56%), Positives = 41/60 (68%)
 Frame = +2

Query: 74  LALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           L   D    E++VLVL K+NF   +   +Y  VEF+APWCGHCK+LAPEYAKAA KL  E
Sbjct: 14  LVRADAPEEEDHVLVLRKSNFAEALAAHKYPPVEFHAPWCGHCKALAPEYAKAAGKLKAE 73



 Score = 52.0 bits (119), Expect = 3e-06
 Identities = 27/70 (38%), Positives = 38/70 (54%)
 Frame = +3

Query: 495 IWFLLDQSSARAKTFLSTAQVVDDQVFAIVSDEKVIKELEAEDEDVVLFKNFEEKRVKYX 674
           I F  D  S  AK FL  A+ +DD  F I S+  V  + + + + VVLFK F+E R  + 
Sbjct: 158 IGFFKDVESDSAKQFLQAAEAIDDIPFGITSNSDVFSKYQLDKDGVVLFKKFDEGRNNFE 217

Query: 675 DEEITEDLLN 704
            E   E+LL+
Sbjct: 218 GEVTKENLLD 227



 Score = 49.2 bits (112), Expect = 2e-05
 Identities = 23/44 (52%), Positives = 28/44 (63%), Gaps = 1/44 (2%)
 Frame = +2

Query: 101 EENVLVLSKANFETV-ITTTEYILVEFYAPWCGHCKSLAPEYAK 229
           ++ V VL   NFE V     + + VEFYAPWCGHCK LAP + K
Sbjct: 366 KQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDK 409


>M22806-1|AAC13652.1|  508|Homo sapiens prolyl 4-hydroxylase
           beta-subunit protein.
          Length = 508

 Score =  113 bits (272), Expect = 8e-25
 Identities = 51/87 (58%), Positives = 67/87 (77%), Gaps = 3/87 (3%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNG---SPIDYSGGRQADDIISWLKKKTG 426
           S I+LAKVDAT+E DLA+ YGVRGYPT+KFFRNG   SP +Y+ GR+ADDI++WLKK+TG
Sbjct: 75  SEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGREADDIVNWLKKRTG 134

Query: 427 PPAVEVTSAEQAKELIDANTVIVFGFF 507
           P A  +     A+ L++++ V V GFF
Sbjct: 135 PAATTLPDGAAAESLVESSEVAVIGFF 161



 Score = 83.8 bits (198), Expect = 8e-16
 Identities = 37/65 (56%), Positives = 46/65 (70%)
 Frame = +2

Query: 59  IALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAAT 238
           +A+  L   D    E++VLVL K+NF   +   +Y+LVEFYAPWCGHCK+LAPEYAKAA 
Sbjct: 9   LAVAALVRADAPEEEDHVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAG 68

Query: 239 KLAEE 253
           KL  E
Sbjct: 69  KLKAE 73



 Score = 52.0 bits (119), Expect = 3e-06
 Identities = 27/70 (38%), Positives = 38/70 (54%)
 Frame = +3

Query: 495 IWFLLDQSSARAKTFLSTAQVVDDQVFAIVSDEKVIKELEAEDEDVVLFKNFEEKRVKYX 674
           I F  D  S  AK FL  A+ +DD  F I S+  V  + + + + VVLFK F+E R  + 
Sbjct: 158 IGFFKDVESDSAKQFLQAAEAIDDIPFGITSNSDVFSKYQLDKDGVVLFKKFDEGRNNFE 217

Query: 675 DEEITEDLLN 704
            E   E+LL+
Sbjct: 218 GEVTKENLLD 227



 Score = 49.2 bits (112), Expect = 2e-05
 Identities = 23/44 (52%), Positives = 28/44 (63%), Gaps = 1/44 (2%)
 Frame = +2

Query: 101 EENVLVLSKANFETV-ITTTEYILVEFYAPWCGHCKSLAPEYAK 229
           ++ V VL   NFE V     + + VEFYAPWCGHCK LAP + K
Sbjct: 366 KQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDK 409



 Score = 33.1 bits (72), Expect = 1.4
 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 3/54 (5%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF---RNGSPIDYSGGRQADDIISWLK 414
           I +AK+D+T  +   E+  V  +PTLKFF    + + IDY+G R  D    +L+
Sbjct: 420 IVIAKMDSTANE--VEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLE 471


>J02783-1|AAA61169.1|  508|Homo sapiens P4HB protein.
          Length = 508

 Score =  113 bits (272), Expect = 8e-25
 Identities = 51/87 (58%), Positives = 67/87 (77%), Gaps = 3/87 (3%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNG---SPIDYSGGRQADDIISWLKKKTG 426
           S I+LAKVDAT+E DLA+ YGVRGYPT+KFFRNG   SP +Y+ GR+ADDI++WLKK+TG
Sbjct: 75  SEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGREADDIVNWLKKRTG 134

Query: 427 PPAVEVTSAEQAKELIDANTVIVFGFF 507
           P A  +     A+ L++++ V V GFF
Sbjct: 135 PAATTLRDGAAAESLVESSEVAVIGFF 161



 Score = 83.8 bits (198), Expect = 8e-16
 Identities = 37/65 (56%), Positives = 46/65 (70%)
 Frame = +2

Query: 59  IALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAAT 238
           +A+  L   D    E++VLVL K+NF   +   +Y+LVEFYAPWCGHCK+LAPEYAKAA 
Sbjct: 9   LAVAALVRADAPEEEDHVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAG 68

Query: 239 KLAEE 253
           KL  E
Sbjct: 69  KLKAE 73



 Score = 52.0 bits (119), Expect = 3e-06
 Identities = 27/70 (38%), Positives = 38/70 (54%)
 Frame = +3

Query: 495 IWFLLDQSSARAKTFLSTAQVVDDQVFAIVSDEKVIKELEAEDEDVVLFKNFEEKRVKYX 674
           I F  D  S  AK FL  A+ +DD  F I S+  V  + + + + VVLFK F+E R  + 
Sbjct: 158 IGFFKDVESDSAKQFLQAAEAIDDIPFGITSNSDVFSKYQLDKDGVVLFKKFDEGRNNFE 217

Query: 675 DEEITEDLLN 704
            E   E+LL+
Sbjct: 218 GEVTKENLLD 227



 Score = 46.8 bits (106), Expect = 1e-04
 Identities = 20/34 (58%), Positives = 23/34 (67%), Gaps = 1/34 (2%)
 Frame = +2

Query: 131 NFETV-ITTTEYILVEFYAPWCGHCKSLAPEYAK 229
           NFE V     + + VEFYAPWCGHCK LAP + K
Sbjct: 376 NFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDK 409



 Score = 33.1 bits (72), Expect = 1.4
 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 3/54 (5%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF---RNGSPIDYSGGRQADDIISWLK 414
           I +AK+D+T  +   E+  V  +PTLKFF    + + IDY+G R  D    +L+
Sbjct: 420 IVIAKMDSTANE--VEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLE 471


>BC071892-1|AAH71892.1|  508|Homo sapiens procollagen-proline,
           2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase),
           beta protein.
          Length = 508

 Score =  113 bits (272), Expect = 8e-25
 Identities = 51/87 (58%), Positives = 67/87 (77%), Gaps = 3/87 (3%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNG---SPIDYSGGRQADDIISWLKKKTG 426
           S I+LAKVDAT+E DLA+ YGVRGYPT+KFFRNG   SP +Y+ GR+ADDI++WLKK+TG
Sbjct: 75  SEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGREADDIVNWLKKRTG 134

Query: 427 PPAVEVTSAEQAKELIDANTVIVFGFF 507
           P A  +     A+ L++++ V V GFF
Sbjct: 135 PAATTLPDGAAAESLVESSEVAVIGFF 161



 Score = 83.8 bits (198), Expect = 8e-16
 Identities = 37/65 (56%), Positives = 46/65 (70%)
 Frame = +2

Query: 59  IALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAAT 238
           +A+  L   D    E++VLVL K+NF   +   +Y+LVEFYAPWCGHCK+LAPEYAKAA 
Sbjct: 9   LAVAALVRADAPEEEDHVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAG 68

Query: 239 KLAEE 253
           KL  E
Sbjct: 69  KLKAE 73



 Score = 52.0 bits (119), Expect = 3e-06
 Identities = 27/70 (38%), Positives = 38/70 (54%)
 Frame = +3

Query: 495 IWFLLDQSSARAKTFLSTAQVVDDQVFAIVSDEKVIKELEAEDEDVVLFKNFEEKRVKYX 674
           I F  D  S  AK FL  A+ +DD  F I S+  V  + + + + VVLFK F+E R  + 
Sbjct: 158 IGFFKDVESDSAKQFLQAAEAIDDIPFGITSNSDVFSKYQLDKDGVVLFKKFDEGRNNFE 217

Query: 675 DEEITEDLLN 704
            E   E+LL+
Sbjct: 218 GEVTKENLLD 227



 Score = 49.2 bits (112), Expect = 2e-05
 Identities = 23/44 (52%), Positives = 28/44 (63%), Gaps = 1/44 (2%)
 Frame = +2

Query: 101 EENVLVLSKANFETV-ITTTEYILVEFYAPWCGHCKSLAPEYAK 229
           ++ V VL   NFE V     + + VEFYAPWCGHCK LAP + K
Sbjct: 366 KQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDK 409



 Score = 33.1 bits (72), Expect = 1.4
 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 3/54 (5%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF---RNGSPIDYSGGRQADDIISWLK 414
           I +AK+D+T  +   E+  V  +PTLKFF    + + IDY+G R  D    +L+
Sbjct: 420 IVIAKMDSTANE--VEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLE 471


>BC029617-1|AAH29617.1|  508|Homo sapiens procollagen-proline,
           2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase),
           beta protein.
          Length = 508

 Score =  113 bits (272), Expect = 8e-25
 Identities = 51/87 (58%), Positives = 67/87 (77%), Gaps = 3/87 (3%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNG---SPIDYSGGRQADDIISWLKKKTG 426
           S I+LAKVDAT+E DLA+ YGVRGYPT+KFFRNG   SP +Y+ GR+ADDI++WLKK+TG
Sbjct: 75  SEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGREADDIVNWLKKRTG 134

Query: 427 PPAVEVTSAEQAKELIDANTVIVFGFF 507
           P A  +     A+ L++++ V V GFF
Sbjct: 135 PAATTLPDGAAAESLVESSEVAVIGFF 161



 Score = 83.8 bits (198), Expect = 8e-16
 Identities = 37/65 (56%), Positives = 46/65 (70%)
 Frame = +2

Query: 59  IALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAAT 238
           +A+  L   D    E++VLVL K+NF   +   +Y+LVEFYAPWCGHCK+LAPEYAKAA 
Sbjct: 9   LAVAALVRADAPEEEDHVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAG 68

Query: 239 KLAEE 253
           KL  E
Sbjct: 69  KLKAE 73



 Score = 52.0 bits (119), Expect = 3e-06
 Identities = 27/70 (38%), Positives = 38/70 (54%)
 Frame = +3

Query: 495 IWFLLDQSSARAKTFLSTAQVVDDQVFAIVSDEKVIKELEAEDEDVVLFKNFEEKRVKYX 674
           I F  D  S  AK FL  A+ +DD  F I S+  V  + + + + VVLFK F+E R  + 
Sbjct: 158 IGFFKDVESDSAKQFLQAAEAIDDIPFGITSNSDVFSKYQLDKDGVVLFKKFDEGRNNFE 217

Query: 675 DEEITEDLLN 704
            E   E+LL+
Sbjct: 218 GEVTKENLLD 227



 Score = 49.2 bits (112), Expect = 2e-05
 Identities = 23/44 (52%), Positives = 28/44 (63%), Gaps = 1/44 (2%)
 Frame = +2

Query: 101 EENVLVLSKANFETV-ITTTEYILVEFYAPWCGHCKSLAPEYAK 229
           ++ V VL   NFE V     + + VEFYAPWCGHCK LAP + K
Sbjct: 366 KQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDK 409



 Score = 33.1 bits (72), Expect = 1.4
 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 3/54 (5%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF---RNGSPIDYSGGRQADDIISWLK 414
           I +AK+D+T  +   E+  V  +PTLKFF    + + IDY+G R  D    +L+
Sbjct: 420 IVIAKMDSTANE--VEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLE 471


>BC010859-1|AAH10859.1|  508|Homo sapiens procollagen-proline,
           2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase),
           beta protein.
          Length = 508

 Score =  113 bits (272), Expect = 8e-25
 Identities = 51/87 (58%), Positives = 67/87 (77%), Gaps = 3/87 (3%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNG---SPIDYSGGRQADDIISWLKKKTG 426
           S I+LAKVDAT+E DLA+ YGVRGYPT+KFFRNG   SP +Y+ GR+ADDI++WLKK+TG
Sbjct: 75  SEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGREADDIVNWLKKRTG 134

Query: 427 PPAVEVTSAEQAKELIDANTVIVFGFF 507
           P A  +     A+ L++++ V V GFF
Sbjct: 135 PAATTLPDGAAAESLVESSEVAVIGFF 161



 Score = 83.8 bits (198), Expect = 8e-16
 Identities = 37/65 (56%), Positives = 46/65 (70%)
 Frame = +2

Query: 59  IALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAAT 238
           +A+  L   D    E++VLVL K+NF   +   +Y+LVEFYAPWCGHCK+LAPEYAKAA 
Sbjct: 9   LAVAALVRADAPEEEDHVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAG 68

Query: 239 KLAEE 253
           KL  E
Sbjct: 69  KLKAE 73



 Score = 52.0 bits (119), Expect = 3e-06
 Identities = 27/70 (38%), Positives = 38/70 (54%)
 Frame = +3

Query: 495 IWFLLDQSSARAKTFLSTAQVVDDQVFAIVSDEKVIKELEAEDEDVVLFKNFEEKRVKYX 674
           I F  D  S  AK FL  A+ +DD  F I S+  V  + + + + VVLFK F+E R  + 
Sbjct: 158 IGFFKDVESDSAKQFLQAAEAIDDIPFGITSNSDVFSKYQLDKDGVVLFKKFDEGRNNFE 217

Query: 675 DEEITEDLLN 704
            E   E+LL+
Sbjct: 218 GEVTKENLLD 227



 Score = 49.2 bits (112), Expect = 2e-05
 Identities = 23/44 (52%), Positives = 28/44 (63%), Gaps = 1/44 (2%)
 Frame = +2

Query: 101 EENVLVLSKANFETV-ITTTEYILVEFYAPWCGHCKSLAPEYAK 229
           ++ V VL   NFE V     + + VEFYAPWCGHCK LAP + K
Sbjct: 366 KQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDK 409



 Score = 33.1 bits (72), Expect = 1.4
 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 3/54 (5%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF---RNGSPIDYSGGRQADDIISWLK 414
           I +AK+D+T  +   E+  V  +PTLKFF    + + IDY+G R  D    +L+
Sbjct: 420 IVIAKMDSTANE--VEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLE 471


>J05016-1|AAA58460.1|  645|Homo sapiens protein disulfide
           isomerase-related protein protein.
          Length = 645

 Score = 90.2 bits (214), Expect = 9e-18
 Identities = 42/93 (45%), Positives = 61/93 (65%), Gaps = 1/93 (1%)
 Frame = +1

Query: 250 RRSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGP 429
           R  PI LAKVDAT E DLA+ + V GYPTLK FR G P DY+G R+   I+ ++ +++GP
Sbjct: 226 RSPPIPLAKVDATAETDLAKRFDVSGYPTLKIFRKGRPYDYNGPREKYGIVDYMIEQSGP 285

Query: 430 PAVEVTSAEQAKELI-DANTVIVFGFFWTRAQP 525
           P+ E+ + +Q +E + D + VI+ G F   + P
Sbjct: 286 PSKEILTLKQVQEFLKDGDDVIIIGVFKGESDP 318



 Score = 77.0 bits (181), Expect = 9e-14
 Identities = 33/55 (60%), Positives = 40/55 (72%)
 Frame = +2

Query: 86  DEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           D  P  E  LVL+K NF+ V+   + ILVEFYAPWCGHCK LAPEY KAA +L++
Sbjct: 171 DWTPPPEVTLVLTKENFDEVVNDADIILVEFYAPWCGHCKKLAPEYEKAAKELSK 225



 Score = 72.5 bits (170), Expect = 2e-12
 Identities = 30/56 (53%), Positives = 38/56 (67%)
 Frame = +2

Query: 89  EVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           EV  E  VLVL+ ANF+  +   + +L+EFYAPWCGHCK  APEY K A  L ++D
Sbjct: 57  EVKEENGVLVLNDANFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIANILKDKD 112



 Score = 58.8 bits (136), Expect = 2e-08
 Identities = 30/89 (33%), Positives = 51/89 (57%), Gaps = 6/89 (6%)
 Frame = +1

Query: 259 PIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGP--- 429
           PI +AK+DAT    LA  + V GYPT+K  + G  +DY G R  ++I++ +++ + P   
Sbjct: 114 PIPVAKIDATSASVLASRFDVSGYPTIKILKKGQAVDYEGSRTQEEIVAKVREVSQPDWT 173

Query: 430 PAVEVT---SAEQAKELIDANTVIVFGFF 507
           P  EVT   + E   E+++   +I+  F+
Sbjct: 174 PPPEVTLVLTKENFDEVVNDADIILVEFY 202



 Score = 48.8 bits (111), Expect = 3e-05
 Identities = 20/43 (46%), Positives = 26/43 (60%)
 Frame = +2

Query: 113 LVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATK 241
           +V+ K     V+   + +L+EFYAPWCGHCK L P Y   A K
Sbjct: 529 VVVGKTFDSIVMDPKKDVLIEFYAPWCGHCKQLEPVYNSLAKK 571



 Score = 32.7 bits (71), Expect = 1.8
 Identities = 15/41 (36%), Positives = 25/41 (60%), Gaps = 3/41 (7%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNG---SPIDYSGG 381
           +AK+DAT     ++ Y V G+PT+ F  +G   +P+ + GG
Sbjct: 580 IAKMDATANDVPSDRYKVEGFPTIYFAPSGDKKNPVKFEGG 620


>BC011754-1|AAH11754.1|  645|Homo sapiens protein disulfide
           isomerase family A, member 4 protein.
          Length = 645

 Score = 90.2 bits (214), Expect = 9e-18
 Identities = 42/93 (45%), Positives = 61/93 (65%), Gaps = 1/93 (1%)
 Frame = +1

Query: 250 RRSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGP 429
           R  PI LAKVDAT E DLA+ + V GYPTLK FR G P DY+G R+   I+ ++ +++GP
Sbjct: 226 RSPPIPLAKVDATAETDLAKRFDVSGYPTLKIFRKGRPYDYNGPREKYGIVDYMIEQSGP 285

Query: 430 PAVEVTSAEQAKELI-DANTVIVFGFFWTRAQP 525
           P+ E+ + +Q +E + D + VI+ G F   + P
Sbjct: 286 PSKEILTLKQVQEFLKDGDDVIIIGVFKGESDP 318



 Score = 77.0 bits (181), Expect = 9e-14
 Identities = 33/55 (60%), Positives = 40/55 (72%)
 Frame = +2

Query: 86  DEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           D  P  E  LVL+K NF+ V+   + ILVEFYAPWCGHCK LAPEY KAA +L++
Sbjct: 171 DWTPPPEVTLVLTKENFDEVVNDADIILVEFYAPWCGHCKKLAPEYEKAAKELSK 225



 Score = 72.5 bits (170), Expect = 2e-12
 Identities = 30/56 (53%), Positives = 38/56 (67%)
 Frame = +2

Query: 89  EVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           EV  E  VLVL+ ANF+  +   + +L+EFYAPWCGHCK  APEY K A  L ++D
Sbjct: 57  EVKEENGVLVLNDANFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIANILKDKD 112



 Score = 58.8 bits (136), Expect = 2e-08
 Identities = 30/89 (33%), Positives = 51/89 (57%), Gaps = 6/89 (6%)
 Frame = +1

Query: 259 PIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGP--- 429
           PI +AK+DAT    LA  + V GYPT+K  + G  +DY G R  ++I++ +++ + P   
Sbjct: 114 PIPVAKIDATSASVLASRFDVSGYPTIKILKKGQAVDYEGSRTQEEIVAKVREVSQPDWT 173

Query: 430 PAVEVT---SAEQAKELIDANTVIVFGFF 507
           P  EVT   + E   E+++   +I+  F+
Sbjct: 174 PPPEVTLVLTKENFDEVVNDADIILVEFY 202



 Score = 48.8 bits (111), Expect = 3e-05
 Identities = 20/43 (46%), Positives = 26/43 (60%)
 Frame = +2

Query: 113 LVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATK 241
           +V+ K     V+   + +L+EFYAPWCGHCK L P Y   A K
Sbjct: 529 VVVGKTFDSIVMDPKKDVLIEFYAPWCGHCKQLEPVYNSLAKK 571



 Score = 32.7 bits (71), Expect = 1.8
 Identities = 15/41 (36%), Positives = 25/41 (60%), Gaps = 3/41 (7%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNG---SPIDYSGG 381
           +AK+DAT     ++ Y V G+PT+ F  +G   +P+ + GG
Sbjct: 580 IAKMDATANDVPSDRYKVEGFPTIYFAPSGDKKNPVKFEGG 620


>BC006344-1|AAH06344.1|  645|Homo sapiens protein disulfide
           isomerase family A, member 4 protein.
          Length = 645

 Score = 90.2 bits (214), Expect = 9e-18
 Identities = 42/93 (45%), Positives = 61/93 (65%), Gaps = 1/93 (1%)
 Frame = +1

Query: 250 RRSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGP 429
           R  PI LAKVDAT E DLA+ + V GYPTLK FR G P DY+G R+   I+ ++ +++GP
Sbjct: 226 RSPPIPLAKVDATAETDLAKRFDVSGYPTLKIFRKGRPYDYNGPREKYGIVDYMIEQSGP 285

Query: 430 PAVEVTSAEQAKELI-DANTVIVFGFFWTRAQP 525
           P+ E+ + +Q +E + D + VI+ G F   + P
Sbjct: 286 PSKEILTLKQVQEFLKDGDDVIIIGVFKGESDP 318



 Score = 77.0 bits (181), Expect = 9e-14
 Identities = 33/55 (60%), Positives = 40/55 (72%)
 Frame = +2

Query: 86  DEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           D  P  E  LVL+K NF+ V+   + ILVEFYAPWCGHCK LAPEY KAA +L++
Sbjct: 171 DWTPPPEVTLVLTKENFDEVVNDADIILVEFYAPWCGHCKKLAPEYEKAAKELSK 225



 Score = 72.5 bits (170), Expect = 2e-12
 Identities = 30/56 (53%), Positives = 38/56 (67%)
 Frame = +2

Query: 89  EVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           EV  E  VLVL+ ANF+  +   + +L+EFYAPWCGHCK  APEY K A  L ++D
Sbjct: 57  EVKEENGVLVLNDANFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIANILKDKD 112



 Score = 58.8 bits (136), Expect = 2e-08
 Identities = 30/89 (33%), Positives = 51/89 (57%), Gaps = 6/89 (6%)
 Frame = +1

Query: 259 PIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGP--- 429
           PI +AK+DAT    LA  + V GYPT+K  + G  +DY G R  ++I++ +++ + P   
Sbjct: 114 PIPVAKIDATSASVLASRFDVSGYPTIKILKKGQAVDYEGSRTQEEIVAKVREVSQPDWT 173

Query: 430 PAVEVT---SAEQAKELIDANTVIVFGFF 507
           P  EVT   + E   E+++   +I+  F+
Sbjct: 174 PPPEVTLVLTKENFDEVVNDADIILVEFY 202



 Score = 48.8 bits (111), Expect = 3e-05
 Identities = 20/43 (46%), Positives = 26/43 (60%)
 Frame = +2

Query: 113 LVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATK 241
           +V+ K     V+   + +L+EFYAPWCGHCK L P Y   A K
Sbjct: 529 VVVGKTFDSIVMDPKKDVLIEFYAPWCGHCKQLEPVYNSLAKK 571



 Score = 32.7 bits (71), Expect = 1.8
 Identities = 15/41 (36%), Positives = 25/41 (60%), Gaps = 3/41 (7%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNG---SPIDYSGG 381
           +AK+DAT     ++ Y V G+PT+ F  +G   +P+ + GG
Sbjct: 580 IAKMDATANDVPSDRYKVEGFPTIYFAPSGDKKNPVKFEGG 620


>BC001928-1|AAH01928.1|  645|Homo sapiens protein disulfide
           isomerase family A, member 4 protein.
          Length = 645

 Score = 90.2 bits (214), Expect = 9e-18
 Identities = 42/93 (45%), Positives = 61/93 (65%), Gaps = 1/93 (1%)
 Frame = +1

Query: 250 RRSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGP 429
           R  PI LAKVDAT E DLA+ + V GYPTLK FR G P DY+G R+   I+ ++ +++GP
Sbjct: 226 RSPPIPLAKVDATAETDLAKRFDVSGYPTLKIFRKGRPYDYNGPREKYGIVDYMIEQSGP 285

Query: 430 PAVEVTSAEQAKELI-DANTVIVFGFFWTRAQP 525
           P+ E+ + +Q +E + D + VI+ G F   + P
Sbjct: 286 PSKEILTLKQVQEFLKDGDDVIIIGVFKGESDP 318



 Score = 77.0 bits (181), Expect = 9e-14
 Identities = 33/55 (60%), Positives = 40/55 (72%)
 Frame = +2

Query: 86  DEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           D  P  E  LVL+K NF+ V+   + ILVEFYAPWCGHCK LAPEY KAA +L++
Sbjct: 171 DWTPPPEVTLVLTKENFDEVVNDADIILVEFYAPWCGHCKKLAPEYEKAAKELSK 225



 Score = 72.5 bits (170), Expect = 2e-12
 Identities = 30/56 (53%), Positives = 38/56 (67%)
 Frame = +2

Query: 89  EVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           EV  E  VLVL+ ANF+  +   + +L+EFYAPWCGHCK  APEY K A  L ++D
Sbjct: 57  EVKEENGVLVLNDANFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIANILKDKD 112



 Score = 58.8 bits (136), Expect = 2e-08
 Identities = 30/89 (33%), Positives = 51/89 (57%), Gaps = 6/89 (6%)
 Frame = +1

Query: 259 PIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGP--- 429
           PI +AK+DAT    LA  + V GYPT+K  + G  +DY G R  ++I++ +++ + P   
Sbjct: 114 PIPVAKIDATSASVLASRFDVSGYPTIKILKKGQAVDYEGSRTQEEIVAKVREVSQPDWT 173

Query: 430 PAVEVT---SAEQAKELIDANTVIVFGFF 507
           P  EVT   + E   E+++   +I+  F+
Sbjct: 174 PPPEVTLVLTKENFDEVVNDADIILVEFY 202



 Score = 48.8 bits (111), Expect = 3e-05
 Identities = 20/43 (46%), Positives = 26/43 (60%)
 Frame = +2

Query: 113 LVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATK 241
           +V+ K     V+   + +L+EFYAPWCGHCK L P Y   A K
Sbjct: 529 VVVGKTFDSIVMDPKKDVLIEFYAPWCGHCKQLEPVYNSLAKK 571



 Score = 32.7 bits (71), Expect = 1.8
 Identities = 15/41 (36%), Positives = 25/41 (60%), Gaps = 3/41 (7%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNG---SPIDYSGG 381
           +AK+DAT     ++ Y V G+PT+ F  +G   +P+ + GG
Sbjct: 580 IAKMDATANDVPSDRYKVEGFPTIYFAPSGDKKNPVKFEGG 620


>BC000425-1|AAH00425.1|  645|Homo sapiens protein disulfide
           isomerase family A, member 4 protein.
          Length = 645

 Score = 90.2 bits (214), Expect = 9e-18
 Identities = 42/93 (45%), Positives = 61/93 (65%), Gaps = 1/93 (1%)
 Frame = +1

Query: 250 RRSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGP 429
           R  PI LAKVDAT E DLA+ + V GYPTLK FR G P DY+G R+   I+ ++ +++GP
Sbjct: 226 RSPPIPLAKVDATAETDLAKRFDVSGYPTLKIFRKGRPYDYNGPREKYGIVDYMIEQSGP 285

Query: 430 PAVEVTSAEQAKELI-DANTVIVFGFFWTRAQP 525
           P+ E+ + +Q +E + D + VI+ G F   + P
Sbjct: 286 PSKEILTLKQVQEFLKDGDDVIIIGVFKGESDP 318



 Score = 77.0 bits (181), Expect = 9e-14
 Identities = 33/55 (60%), Positives = 40/55 (72%)
 Frame = +2

Query: 86  DEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           D  P  E  LVL+K NF+ V+   + ILVEFYAPWCGHCK LAPEY KAA +L++
Sbjct: 171 DWTPPPEVTLVLTKENFDEVVNDADIILVEFYAPWCGHCKKLAPEYEKAAKELSK 225



 Score = 72.5 bits (170), Expect = 2e-12
 Identities = 30/56 (53%), Positives = 38/56 (67%)
 Frame = +2

Query: 89  EVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           EV  E  VLVL+ ANF+  +   + +L+EFYAPWCGHCK  APEY K A  L ++D
Sbjct: 57  EVKEENGVLVLNDANFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIANILKDKD 112



 Score = 58.8 bits (136), Expect = 2e-08
 Identities = 30/89 (33%), Positives = 51/89 (57%), Gaps = 6/89 (6%)
 Frame = +1

Query: 259 PIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGP--- 429
           PI +AK+DAT    LA  + V GYPT+K  + G  +DY G R  ++I++ +++ + P   
Sbjct: 114 PIPVAKIDATSASVLASRFDVSGYPTIKILKKGQAVDYEGSRTQEEIVAKVREVSQPDWT 173

Query: 430 PAVEVT---SAEQAKELIDANTVIVFGFF 507
           P  EVT   + E   E+++   +I+  F+
Sbjct: 174 PPPEVTLVLTKENFDEVVNDADIILVEFY 202



 Score = 48.8 bits (111), Expect = 3e-05
 Identities = 20/43 (46%), Positives = 26/43 (60%)
 Frame = +2

Query: 113 LVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATK 241
           +V+ K     V+   + +L+EFYAPWCGHCK L P Y   A K
Sbjct: 529 VVVGKTFDSIVMDPKKDVLIEFYAPWCGHCKQLEPVYNSLAKK 571



 Score = 32.7 bits (71), Expect = 1.8
 Identities = 15/41 (36%), Positives = 25/41 (60%), Gaps = 3/41 (7%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNG---SPIDYSGG 381
           +AK+DAT     ++ Y V G+PT+ F  +G   +P+ + GG
Sbjct: 580 IAKMDATANDVPSDRYKVEGFPTIYFAPSGDKKNPVKFEGG 620


>AC093743-1|AAQ96863.1|  645|Homo sapiens unknown protein.
          Length = 645

 Score = 90.2 bits (214), Expect = 9e-18
 Identities = 42/93 (45%), Positives = 61/93 (65%), Gaps = 1/93 (1%)
 Frame = +1

Query: 250 RRSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGP 429
           R  PI LAKVDAT E DLA+ + V GYPTLK FR G P DY+G R+   I+ ++ +++GP
Sbjct: 226 RSPPIPLAKVDATAETDLAKRFDVSGYPTLKIFRKGRPYDYNGPREKYGIVDYMIEQSGP 285

Query: 430 PAVEVTSAEQAKELI-DANTVIVFGFFWTRAQP 525
           P+ E+ + +Q +E + D + VI+ G F   + P
Sbjct: 286 PSKEILTLKQVQEFLKDGDDVIIIGVFKGESDP 318



 Score = 77.0 bits (181), Expect = 9e-14
 Identities = 33/55 (60%), Positives = 40/55 (72%)
 Frame = +2

Query: 86  DEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           D  P  E  LVL+K NF+ V+   + ILVEFYAPWCGHCK LAPEY KAA +L++
Sbjct: 171 DWTPPPEVTLVLTKENFDEVVNDADIILVEFYAPWCGHCKKLAPEYEKAAKELSK 225



 Score = 72.5 bits (170), Expect = 2e-12
 Identities = 30/56 (53%), Positives = 38/56 (67%)
 Frame = +2

Query: 89  EVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           EV  E  VLVL+ ANF+  +   + +L+EFYAPWCGHCK  APEY K A  L ++D
Sbjct: 57  EVKEENGVLVLNDANFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIANILKDKD 112



 Score = 58.8 bits (136), Expect = 2e-08
 Identities = 30/89 (33%), Positives = 51/89 (57%), Gaps = 6/89 (6%)
 Frame = +1

Query: 259 PIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGP--- 429
           PI +AK+DAT    LA  + V GYPT+K  + G  +DY G R  ++I++ +++ + P   
Sbjct: 114 PIPVAKIDATSASVLASRFDVSGYPTIKILKKGQAVDYEGSRTQEEIVAKVREVSQPDWT 173

Query: 430 PAVEVT---SAEQAKELIDANTVIVFGFF 507
           P  EVT   + E   E+++   +I+  F+
Sbjct: 174 PPPEVTLVLTKENFDEVVNDADIILVEFY 202



 Score = 48.8 bits (111), Expect = 3e-05
 Identities = 20/43 (46%), Positives = 26/43 (60%)
 Frame = +2

Query: 113 LVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATK 241
           +V+ K     V+   + +L+EFYAPWCGHCK L P Y   A K
Sbjct: 529 VVVGKTFDSIVMDPKKDVLIEFYAPWCGHCKQLEPVYNSLAKK 571



 Score = 32.7 bits (71), Expect = 1.8
 Identities = 15/41 (36%), Positives = 25/41 (60%), Gaps = 3/41 (7%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNG---SPIDYSGG 381
           +AK+DAT     ++ Y V G+PT+ F  +G   +P+ + GG
Sbjct: 580 IAKMDATANDVPSDRYKVEGFPTIYFAPSGDKKNPVKFEGG 620


>Z69667-12|CAI95587.1|  226|Homo sapiens protein disulfide isomerase
           family A, member 2 protein.
          Length = 226

 Score = 83.0 bits (196), Expect = 1e-15
 Identities = 38/85 (44%), Positives = 55/85 (64%), Gaps = 3/85 (3%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS---PIDYSGGRQADDIISWLKKKTGPP 432
           + LAKVD   +++LAE +GV  YPTLKFFRNG+   P +Y+G R A+ I  WL+++ GP 
Sbjct: 91  VTLAKVDGPAQRELAEEFGVTEYPTLKFFRNGNRTHPEEYTGPRDAEGIAEWLRRRVGPS 150

Query: 433 AVEVTSAEQAKELIDANTVIVFGFF 507
           A+ +     A+ LI    ++V GFF
Sbjct: 151 AMRLEDEAAAQALIGGRDLVVIGFF 175



 Score = 73.3 bits (172), Expect = 1e-12
 Identities = 30/59 (50%), Positives = 42/59 (71%)
 Frame = +2

Query: 86  DEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLL 262
           +E+P E+ +LVLS+      +     +LVEFYAPWCGHC++LAPEY+KAA  LA E ++
Sbjct: 32  EEIPKEDGILVLSRHTLGLALREHPALLVEFYAPWCGHCQALAPEYSKAAAVLAAESMV 90



 Score = 30.3 bits (65), Expect = 9.8
 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 1/46 (2%)
 Frame = +3

Query: 564 DQVFAIVSDEKVIKELEAEDEDVVLFKNFEEKRVKY-XDEEITEDL 698
           D  F +    ++ ++     + VVLFK F+E R  +  DEE+  DL
Sbjct: 180 DMTFGLTDRPRLFQQFGLTKDTVVLFKKFDEGRADFPVDEELGLDL 225


>Z69667-11|CAO78188.1|  522|Homo sapiens protein disulfide isomerase
           family A, member 2 protein.
          Length = 522

 Score = 83.0 bits (196), Expect = 1e-15
 Identities = 38/85 (44%), Positives = 55/85 (64%), Gaps = 3/85 (3%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS---PIDYSGGRQADDIISWLKKKTGPP 432
           + LAKVD   +++LAE +GV  YPTLKFFRNG+   P +Y+G R A+ I  WL+++ GP 
Sbjct: 95  VTLAKVDGPAQRELAEEFGVTEYPTLKFFRNGNRTHPEEYTGPRDAEGIAEWLRRRVGPS 154

Query: 433 AVEVTSAEQAKELIDANTVIVFGFF 507
           A+ +     A+ LI    ++V GFF
Sbjct: 155 AMRLEDEAAAQALIGGRDLVVIGFF 179



 Score = 73.3 bits (172), Expect = 1e-12
 Identities = 30/59 (50%), Positives = 42/59 (71%)
 Frame = +2

Query: 86  DEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLL 262
           +E+P E+ +LVLS+      +     +LVEFYAPWCGHC++LAPEY+KAA  LA E ++
Sbjct: 36  EEIPKEDGILVLSRHTLGLALREHPALLVEFYAPWCGHCQALAPEYSKAAAVLAAESMV 94



 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 26/66 (39%), Positives = 37/66 (56%), Gaps = 5/66 (7%)
 Frame = +2

Query: 80  LGDEVPTEEN---VLVLSKANFETV-ITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 247
           L  E+P + +   V  L   NFE V    T+ + V+FYAPWC HCK +AP +   A K  
Sbjct: 374 LSQEIPPDWDQRPVKTLVGKNFEQVAFDETKNVFVKFYAPWCTHCKEMAPAWEALAEKYQ 433

Query: 248 E-EDLL 262
           + ED++
Sbjct: 434 DHEDII 439



 Score = 37.5 bits (83), Expect = 0.065
 Identities = 24/69 (34%), Positives = 35/69 (50%), Gaps = 1/69 (1%)
 Frame = +3

Query: 495 IWFLLDQSSARAKTFLSTAQVVDDQVFAIVSDEKVIKELEAEDEDVVLFKNFEEKRVKY- 671
           I F  D+  A   TFL+ AQ   D  F +    ++ ++     + VVLFK F+E R  + 
Sbjct: 176 IGFFQDEDVA---TFLALAQDALDMTFGLTDRPRLFQQFGLTKDTVVLFKKFDEGRADFP 232

Query: 672 XDEEITEDL 698
            DEE+  DL
Sbjct: 233 VDEELGLDL 241


>Z69667-10|CAI95586.1|  525|Homo sapiens protein disulfide isomerase
           family A, member 2 protein.
          Length = 525

 Score = 83.0 bits (196), Expect = 1e-15
 Identities = 38/85 (44%), Positives = 55/85 (64%), Gaps = 3/85 (3%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS---PIDYSGGRQADDIISWLKKKTGPP 432
           + LAKVD   +++LAE +GV  YPTLKFFRNG+   P +Y+G R A+ I  WL+++ GP 
Sbjct: 95  VTLAKVDGPAQRELAEEFGVTEYPTLKFFRNGNRTHPEEYTGPRDAEGIAEWLRRRVGPS 154

Query: 433 AVEVTSAEQAKELIDANTVIVFGFF 507
           A+ +     A+ LI    ++V GFF
Sbjct: 155 AMRLEDEAAAQALIGGRDLVVIGFF 179



 Score = 73.3 bits (172), Expect = 1e-12
 Identities = 30/59 (50%), Positives = 42/59 (71%)
 Frame = +2

Query: 86  DEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLL 262
           +E+P E+ +LVLS+      +     +LVEFYAPWCGHC++LAPEY+KAA  LA E ++
Sbjct: 36  EEIPKEDGILVLSRHTLGLALREHPALLVEFYAPWCGHCQALAPEYSKAAAVLAAESMV 94



 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 26/66 (39%), Positives = 37/66 (56%), Gaps = 5/66 (7%)
 Frame = +2

Query: 80  LGDEVPTEEN---VLVLSKANFETV-ITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 247
           L  E+P + +   V  L   NFE V    T+ + V+FYAPWC HCK +AP +   A K  
Sbjct: 377 LSQEIPPDWDQRPVKTLVGKNFEQVAFDETKNVFVKFYAPWCTHCKEMAPAWEALAEKYQ 436

Query: 248 E-EDLL 262
           + ED++
Sbjct: 437 DHEDII 442



 Score = 39.5 bits (88), Expect = 0.016
 Identities = 23/69 (33%), Positives = 33/69 (47%), Gaps = 1/69 (1%)
 Frame = +3

Query: 495 IWFLLDQSSARAKTFLSTAQVVDDQVFAIVSDEKVIKELEAEDEDVVLFKNFEEKRVKY- 671
           I F  D       TFL+ AQ   D  F +    ++ ++     + VVLFK F+E R  + 
Sbjct: 176 IGFFQDLQDEDVATFLALAQDALDMTFGLTDRPRLFQQFGLTKDTVVLFKKFDEGRADFP 235

Query: 672 XDEEITEDL 698
            DEE+  DL
Sbjct: 236 VDEELGLDL 244


>U19948-1|AAC50401.1|  511|Homo sapiens protein disulfide isomerase
           protein.
          Length = 511

 Score = 83.0 bits (196), Expect = 1e-15
 Identities = 38/85 (44%), Positives = 55/85 (64%), Gaps = 3/85 (3%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS---PIDYSGGRQADDIISWLKKKTGPP 432
           + LAKVD   +++LAE +GV  YPTLKFFRNG+   P +Y+G R A+ I  WL+++ GP 
Sbjct: 81  VTLAKVDGPAQRELAEEFGVTEYPTLKFFRNGNRTHPEEYTGPRDAEGIAEWLRRRVGPS 140

Query: 433 AVEVTSAEQAKELIDANTVIVFGFF 507
           A+ +     A+ LI    ++V GFF
Sbjct: 141 AMRLEDEAAAQALIGGRDLVVIGFF 165



 Score = 73.3 bits (172), Expect = 1e-12
 Identities = 30/59 (50%), Positives = 42/59 (71%)
 Frame = +2

Query: 86  DEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLL 262
           +E+P E+ +LVLS+      +     +LVEFYAPWCGHC++LAPEY+KAA  LA E ++
Sbjct: 22  EEIPKEDGILVLSRHTLGLALREHPALLVEFYAPWCGHCQALAPEYSKAAAVLAAESMV 80



 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 26/66 (39%), Positives = 37/66 (56%), Gaps = 5/66 (7%)
 Frame = +2

Query: 80  LGDEVPTEEN---VLVLSKANFETV-ITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 247
           L  E+P + +   V  L   NFE V    T+ + V+FYAPWC HCK +AP +   A K  
Sbjct: 363 LSQEIPPDWDQRPVKTLVGKNFEQVAFDETKNVFVKFYAPWCTHCKEMAPAWEALAEKYQ 422

Query: 248 E-EDLL 262
           + ED++
Sbjct: 423 DHEDII 428



 Score = 39.5 bits (88), Expect = 0.016
 Identities = 23/69 (33%), Positives = 33/69 (47%), Gaps = 1/69 (1%)
 Frame = +3

Query: 495 IWFLLDQSSARAKTFLSTAQVVDDQVFAIVSDEKVIKELEAEDEDVVLFKNFEEKRVKY- 671
           I F  D       TFL+ AQ   D  F +    ++ ++     + VVLFK F+E R  + 
Sbjct: 162 IGFFQDLQDEDVATFLALAQDALDMTFGLTDRPRLFQQFGLTKDTVVLFKKFDEGRADFP 221

Query: 672 XDEEITEDL 698
            DEE+  DL
Sbjct: 222 VDEELGLDL 230


>EF450770-1|ABO43034.1|  555|Homo sapiens protein disulfide
           isomerase family A, member 2 variant protein.
          Length = 555

 Score = 83.0 bits (196), Expect = 1e-15
 Identities = 38/85 (44%), Positives = 55/85 (64%), Gaps = 3/85 (3%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS---PIDYSGGRQADDIISWLKKKTGPP 432
           + LAKVD   +++LAE +GV  YPTLKFFRNG+   P +Y+G R A+ I  WL+++ GP 
Sbjct: 95  VTLAKVDGPAQRELAEEFGVTEYPTLKFFRNGNRTHPEEYTGPRDAEGIAEWLRRRVGPS 154

Query: 433 AVEVTSAEQAKELIDANTVIVFGFF 507
           A+ +     A+ LI    ++V GFF
Sbjct: 155 AMRLEDEAAAQALIGGRDLVVIGFF 179



 Score = 73.3 bits (172), Expect = 1e-12
 Identities = 30/59 (50%), Positives = 42/59 (71%)
 Frame = +2

Query: 86  DEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLL 262
           +E+P E+ +LVLS+      +     +LVEFYAPWCGHC++LAPEY+KAA  LA E ++
Sbjct: 36  EEIPKEDGILVLSRHTLGLALREHPALLVEFYAPWCGHCQALAPEYSKAAAVLAAESMV 94



 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 26/66 (39%), Positives = 37/66 (56%), Gaps = 5/66 (7%)
 Frame = +2

Query: 80  LGDEVPTEEN---VLVLSKANFETV-ITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 247
           L  E+P + +   V  L   NFE V    T+ + V+FYAPWC HCK +AP +   A K  
Sbjct: 377 LSQEIPPDWDQRPVKTLVGKNFEQVAFDETKNVFVKFYAPWCTHCKEMAPAWEALAEKYQ 436

Query: 248 E-EDLL 262
           + ED++
Sbjct: 437 DHEDII 442



 Score = 39.5 bits (88), Expect = 0.016
 Identities = 23/69 (33%), Positives = 33/69 (47%), Gaps = 1/69 (1%)
 Frame = +3

Query: 495 IWFLLDQSSARAKTFLSTAQVVDDQVFAIVSDEKVIKELEAEDEDVVLFKNFEEKRVKY- 671
           I F  D       TFL+ AQ   D  F +    ++ ++     + VVLFK F+E R  + 
Sbjct: 176 IGFFQDLQDEDVATFLALAQDALDMTFGLTDRPRLFQQFGLTKDTVVLFKKFDEGRADFP 235

Query: 672 XDEEITEDL 698
            DEE+  DL
Sbjct: 236 VDEELGLDL 244



 Score = 32.3 bits (70), Expect = 2.4
 Identities = 18/56 (32%), Positives = 31/56 (55%), Gaps = 3/56 (5%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNG---SPIDYSGGRQADDIISWLKKK 420
           I +A++DAT  +   +++ V G+PTLK+F  G     I+Y   R  +    +L K+
Sbjct: 441 IIIAELDATANE--LDAFAVHGFPTLKYFPAGPGRKVIEYKSTRDLETFSKFLDKR 494


>BC075029-1|AAH75029.1|  519|Homo sapiens PDIA2 protein protein.
          Length = 519

 Score = 83.0 bits (196), Expect = 1e-15
 Identities = 38/85 (44%), Positives = 55/85 (64%), Gaps = 3/85 (3%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS---PIDYSGGRQADDIISWLKKKTGPP 432
           + LAKVD   +++LAE +GV  YPTLKFFRNG+   P +Y+G R A+ I  WL+++ GP 
Sbjct: 89  VTLAKVDGPAQRELAEEFGVTEYPTLKFFRNGNRTHPEEYTGPRDAEGIAEWLRRRVGPS 148

Query: 433 AVEVTSAEQAKELIDANTVIVFGFF 507
           A+ +     A+ LI    ++V GFF
Sbjct: 149 AMRLEDEAAAQALIGGRDLVVIGFF 173



 Score = 73.3 bits (172), Expect = 1e-12
 Identities = 30/59 (50%), Positives = 42/59 (71%)
 Frame = +2

Query: 86  DEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLL 262
           +E+P E+ +LVLS+      +     +LVEFYAPWCGHC++LAPEY+KAA  LA E ++
Sbjct: 30  EEIPKEDGILVLSRHTLGLALREHPALLVEFYAPWCGHCQALAPEYSKAAAVLAAESMV 88



 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 26/66 (39%), Positives = 37/66 (56%), Gaps = 5/66 (7%)
 Frame = +2

Query: 80  LGDEVPTEEN---VLVLSKANFETV-ITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 247
           L  E+P + +   V  L   NFE V    T+ + V+FYAPWC HCK +AP +   A K  
Sbjct: 371 LSQEIPPDWDQRPVKTLVGKNFEQVAFDETKNVFVKFYAPWCTHCKEMAPAWEALAEKYQ 430

Query: 248 E-EDLL 262
           + ED++
Sbjct: 431 DHEDII 436



 Score = 39.5 bits (88), Expect = 0.016
 Identities = 23/69 (33%), Positives = 33/69 (47%), Gaps = 1/69 (1%)
 Frame = +3

Query: 495 IWFLLDQSSARAKTFLSTAQVVDDQVFAIVSDEKVIKELEAEDEDVVLFKNFEEKRVKY- 671
           I F  D       TFL+ AQ   D  F +    ++ ++     + VVLFK F+E R  + 
Sbjct: 170 IGFFQDLQDEDVATFLALAQDALDMTFGLTDRPRLFQQFGLTKDTVVLFKKFDEGRADFP 229

Query: 672 XDEEITEDL 698
            DEE+  DL
Sbjct: 230 VDEELGLDL 238


>BC000537-1|AAH00537.2|  520|Homo sapiens PDIA2 protein protein.
          Length = 520

 Score = 83.0 bits (196), Expect = 1e-15
 Identities = 38/85 (44%), Positives = 55/85 (64%), Gaps = 3/85 (3%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS---PIDYSGGRQADDIISWLKKKTGPP 432
           + LAKVD   +++LAE +GV  YPTLKFFRNG+   P +Y+G R A+ I  WL+++ GP 
Sbjct: 90  VTLAKVDGPAQRELAEEFGVTEYPTLKFFRNGNRTHPEEYTGPRDAEGIAEWLRRRVGPS 149

Query: 433 AVEVTSAEQAKELIDANTVIVFGFF 507
           A+ +     A+ LI    ++V GFF
Sbjct: 150 AMRLEDEAAAQALIGGRDLVVIGFF 174



 Score = 73.3 bits (172), Expect = 1e-12
 Identities = 30/59 (50%), Positives = 42/59 (71%)
 Frame = +2

Query: 86  DEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLL 262
           +E+P E+ +LVLS+      +     +LVEFYAPWCGHC++LAPEY+KAA  LA E ++
Sbjct: 31  EEIPKEDGILVLSRHTLGLALREHPALLVEFYAPWCGHCQALAPEYSKAAAVLAAESMV 89



 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 26/66 (39%), Positives = 37/66 (56%), Gaps = 5/66 (7%)
 Frame = +2

Query: 80  LGDEVPTEEN---VLVLSKANFETV-ITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 247
           L  E+P + +   V  L   NFE V    T+ + V+FYAPWC HCK +AP +   A K  
Sbjct: 372 LSQEIPPDWDQRPVKTLVGKNFEQVAFDETKNVFVKFYAPWCTHCKEMAPAWEALAEKYQ 431

Query: 248 E-EDLL 262
           + ED++
Sbjct: 432 DHEDII 437



 Score = 39.5 bits (88), Expect = 0.016
 Identities = 23/69 (33%), Positives = 33/69 (47%), Gaps = 1/69 (1%)
 Frame = +3

Query: 495 IWFLLDQSSARAKTFLSTAQVVDDQVFAIVSDEKVIKELEAEDEDVVLFKNFEEKRVKY- 671
           I F  D       TFL+ AQ   D  F +    ++ ++     + VVLFK F+E R  + 
Sbjct: 171 IGFFQDLQDEDVATFLALAQDALDMTFGLTDRPRLFQQFGLTKDTVVLFKKFDEGRADFP 230

Query: 672 XDEEITEDL 698
            DEE+  DL
Sbjct: 231 VDEELGLDL 239


>AE006463-3|AAK61223.1|  525|Homo sapiens protein disulfide
           isomerase PDIP precursor protein.
          Length = 525

 Score = 83.0 bits (196), Expect = 1e-15
 Identities = 38/85 (44%), Positives = 55/85 (64%), Gaps = 3/85 (3%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS---PIDYSGGRQADDIISWLKKKTGPP 432
           + LAKVD   +++LAE +GV  YPTLKFFRNG+   P +Y+G R A+ I  WL+++ GP 
Sbjct: 95  VTLAKVDGPAQRELAEEFGVTEYPTLKFFRNGNRTHPEEYTGPRDAEGIAEWLRRRVGPS 154

Query: 433 AVEVTSAEQAKELIDANTVIVFGFF 507
           A+ +     A+ LI    ++V GFF
Sbjct: 155 AMRLEDEAAAQALIGGRDLVVIGFF 179



 Score = 73.3 bits (172), Expect = 1e-12
 Identities = 30/59 (50%), Positives = 42/59 (71%)
 Frame = +2

Query: 86  DEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLL 262
           +E+P E+ +LVLS+      +     +LVEFYAPWCGHC++LAPEY+KAA  LA E ++
Sbjct: 36  EEIPKEDGILVLSRHTLGLALREHPALLVEFYAPWCGHCQALAPEYSKAAAVLAAESMV 94



 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 26/66 (39%), Positives = 37/66 (56%), Gaps = 5/66 (7%)
 Frame = +2

Query: 80  LGDEVPTEEN---VLVLSKANFETV-ITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 247
           L  E+P + +   V  L   NFE V    T+ + V+FYAPWC HCK +AP +   A K  
Sbjct: 377 LSQEIPPDWDQRPVKTLVGKNFEQVAFDETKNVFVKFYAPWCTHCKEMAPAWEALAEKYQ 436

Query: 248 E-EDLL 262
           + ED++
Sbjct: 437 DHEDII 442



 Score = 39.5 bits (88), Expect = 0.016
 Identities = 23/69 (33%), Positives = 33/69 (47%), Gaps = 1/69 (1%)
 Frame = +3

Query: 495 IWFLLDQSSARAKTFLSTAQVVDDQVFAIVSDEKVIKELEAEDEDVVLFKNFEEKRVKY- 671
           I F  D       TFL+ AQ   D  F +    ++ ++     + VVLFK F+E R  + 
Sbjct: 176 IGFFQDLQDEDVATFLALAQDALDMTFGLTDRPRLFQQFGLTKDTVVLFKKFDEGRADFP 235

Query: 672 XDEEITEDL 698
            DEE+  DL
Sbjct: 236 VDEELGLDL 244


>AB127078-2|BAE48734.1|  525|Homo sapiens pancreatic protein
           disulfide isomerase protein.
          Length = 525

 Score = 83.0 bits (196), Expect = 1e-15
 Identities = 38/85 (44%), Positives = 55/85 (64%), Gaps = 3/85 (3%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS---PIDYSGGRQADDIISWLKKKTGPP 432
           + LAKVD   +++LAE +GV  YPTLKFFRNG+   P +Y+G R A+ I  WL+++ GP 
Sbjct: 95  VTLAKVDGPAQRELAEEFGVTEYPTLKFFRNGNRTHPEEYTGPRDAEGIAEWLRRRVGPS 154

Query: 433 AVEVTSAEQAKELIDANTVIVFGFF 507
           A+ +     A+ LI    ++V GFF
Sbjct: 155 AMRLEDEAAAQALIGGRDLVVIGFF 179



 Score = 73.3 bits (172), Expect = 1e-12
 Identities = 30/59 (50%), Positives = 42/59 (71%)
 Frame = +2

Query: 86  DEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLL 262
           +E+P E+ +LVLS+      +     +LVEFYAPWCGHC++LAPEY+KAA  LA E ++
Sbjct: 36  EEIPKEDGILVLSRHTLGLALREHPALLVEFYAPWCGHCQALAPEYSKAAAVLAAESMV 94



 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 26/66 (39%), Positives = 37/66 (56%), Gaps = 5/66 (7%)
 Frame = +2

Query: 80  LGDEVPTEEN---VLVLSKANFETV-ITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 247
           L  E+P + +   V  L   NFE V    T+ + V+FYAPWC HCK +AP +   A K  
Sbjct: 377 LSQEIPPDWDQRPVKTLVGKNFEQVAFDETKNVFVKFYAPWCTHCKEMAPAWEALAEKYQ 436

Query: 248 E-EDLL 262
           + ED++
Sbjct: 437 DHEDII 442



 Score = 39.5 bits (88), Expect = 0.016
 Identities = 23/69 (33%), Positives = 33/69 (47%), Gaps = 1/69 (1%)
 Frame = +3

Query: 495 IWFLLDQSSARAKTFLSTAQVVDDQVFAIVSDEKVIKELEAEDEDVVLFKNFEEKRVKY- 671
           I F  D       TFL+ AQ   D  F +    ++ ++     + VVLFK F+E R  + 
Sbjct: 176 IGFFQDLQDEDVATFLALAQDALDMTFGLTDRPRLFQQFGLTKDTVVLFKKFDEGRADFP 235

Query: 672 XDEEITEDL 698
            DEE+  DL
Sbjct: 236 VDEELGLDL 244


>Z49835-1|CAA89996.1|  505|Homo sapiens protein disulfide isomerase
           protein.
          Length = 505

 Score = 74.9 bits (176), Expect = 3e-13
 Identities = 37/83 (44%), Positives = 48/83 (57%), Gaps = 1/83 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGPPAV 438
           + LAKVD T   +    YGV GYPTLK FR+G     Y G R AD I+S LKK+ GP +V
Sbjct: 78  VPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASV 137

Query: 439 EVTSAEQAKELIDANTVIVFGFF 507
            + + E+ K+ I      + GFF
Sbjct: 138 PLRTEEEFKKFISDKDASIVGFF 160



 Score = 64.9 bits (151), Expect = 4e-10
 Identities = 35/72 (48%), Positives = 46/72 (63%), Gaps = 3/72 (4%)
 Frame = +2

Query: 38  RVLIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTE---YILVEFYAPWCGHCKS 208
           R+ +F  +ALL  A    +    +VL L+  NFE+ I+ T     +LVEF+APWCGHCK 
Sbjct: 5   RLALFPGVALLLAAA--RLAAASDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHCKR 62

Query: 209 LAPEYAKAATKL 244
           LAPEY  AAT+L
Sbjct: 63  LAPEYEAAATRL 74



 Score = 54.8 bits (126), Expect = 4e-07
 Identities = 21/49 (42%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = +2

Query: 110 VLVLSKANFETVITT-TEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           V V+   NF+ ++    + +L+EFYAPWCGHCK+L P+Y +   KL+++
Sbjct: 378 VKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKD 426



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 27/73 (36%), Positives = 44/73 (60%), Gaps = 4/73 (5%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF---RNGSPIDYSGGRQADDIISWLKKK-TGP 429
           I +AK+DAT   D+   Y VRG+PT+ F    +  +P  Y GGR+  D IS+L+++ T P
Sbjct: 429 IVIAKMDATAN-DVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQREATNP 487

Query: 430 PAVEVTSAEQAKE 468
           P ++    ++ K+
Sbjct: 488 PVIQEEKPKKKKK 500


>U75885-1|AAC51518.1|  505|Homo sapiens ER-60 protein protein.
          Length = 505

 Score = 74.9 bits (176), Expect = 3e-13
 Identities = 37/83 (44%), Positives = 48/83 (57%), Gaps = 1/83 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGPPAV 438
           + LAKVD T   +    YGV GYPTLK FR+G     Y G R AD I+S LKK+ GP +V
Sbjct: 78  VPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASV 137

Query: 439 EVTSAEQAKELIDANTVIVFGFF 507
            + + E+ K+ I      + GFF
Sbjct: 138 PLRTEEEFKKFISDKDASIVGFF 160



 Score = 64.9 bits (151), Expect = 4e-10
 Identities = 35/72 (48%), Positives = 46/72 (63%), Gaps = 3/72 (4%)
 Frame = +2

Query: 38  RVLIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTE---YILVEFYAPWCGHCKS 208
           R+ +F  +ALL  A    +    +VL L+  NFE+ I+ T     +LVEF+APWCGHCK 
Sbjct: 5   RLALFPGVALLLAAA--RLAAASDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHCKR 62

Query: 209 LAPEYAKAATKL 244
           LAPEY  AAT+L
Sbjct: 63  LAPEYEAAATRL 74



 Score = 54.8 bits (126), Expect = 4e-07
 Identities = 21/49 (42%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = +2

Query: 110 VLVLSKANFETVITT-TEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           V V+   NF+ ++    + +L+EFYAPWCGHCK+L P+Y +   KL+++
Sbjct: 378 VKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKD 426



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 27/73 (36%), Positives = 44/73 (60%), Gaps = 4/73 (5%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF---RNGSPIDYSGGRQADDIISWLKKK-TGP 429
           I +AK+DAT   D+   Y VRG+PT+ F    +  +P  Y GGR+  D IS+L+++ T P
Sbjct: 429 IVIAKMDATAN-DVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQREATNP 487

Query: 430 PAVEVTSAEQAKE 468
           P ++    ++ K+
Sbjct: 488 PVIQEEKPKKKKK 500


>U42068-1|AAC50331.1|  505|Homo sapiens P58 protein.
          Length = 505

 Score = 74.9 bits (176), Expect = 3e-13
 Identities = 37/83 (44%), Positives = 48/83 (57%), Gaps = 1/83 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGPPAV 438
           + LAKVD T   +    YGV GYPTLK FR+G     Y G R AD I+S LKK+ GP +V
Sbjct: 78  VPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASV 137

Query: 439 EVTSAEQAKELIDANTVIVFGFF 507
            + + E+ K+ I      + GFF
Sbjct: 138 PLRTEEEFKKFISDKDASIVGFF 160



 Score = 64.9 bits (151), Expect = 4e-10
 Identities = 35/72 (48%), Positives = 46/72 (63%), Gaps = 3/72 (4%)
 Frame = +2

Query: 38  RVLIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTE---YILVEFYAPWCGHCKS 208
           R+ +F  +ALL  A    +    +VL L+  NFE+ I+ T     +LVEF+APWCGHCK 
Sbjct: 5   RLALFPGVALLLAAA--RLAAASDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHCKR 62

Query: 209 LAPEYAKAATKL 244
           LAPEY  AAT+L
Sbjct: 63  LAPEYEAAATRL 74



 Score = 54.8 bits (126), Expect = 4e-07
 Identities = 21/49 (42%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = +2

Query: 110 VLVLSKANFETVITT-TEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           V V+   NF+ ++    + +L+EFYAPWCGHCK+L P+Y +   KL+++
Sbjct: 378 VKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKD 426



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 27/73 (36%), Positives = 44/73 (60%), Gaps = 4/73 (5%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF---RNGSPIDYSGGRQADDIISWLKKK-TGP 429
           I +AK+DAT   D+   Y VRG+PT+ F    +  +P  Y GGR+  D IS+L+++ T P
Sbjct: 429 IVIAKMDATAN-DVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQREATNP 487

Query: 430 PAVEVTSAEQAKE 468
           P ++    ++ K+
Sbjct: 488 PVIQEEKPKKKKK 500


>D83485-1|BAA11928.1|  505|Homo sapiens ER-60 protease protein.
          Length = 505

 Score = 74.9 bits (176), Expect = 3e-13
 Identities = 37/83 (44%), Positives = 48/83 (57%), Gaps = 1/83 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGPPAV 438
           + LAKVD T   +    YGV GYPTLK FR+G     Y G R AD I+S LKK+ GP +V
Sbjct: 78  VPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASV 137

Query: 439 EVTSAEQAKELIDANTVIVFGFF 507
            + + E+ K+ I      + GFF
Sbjct: 138 PLRTEEEFKKFISDKDASIVGFF 160



 Score = 67.3 bits (157), Expect = 7e-11
 Identities = 38/72 (52%), Positives = 48/72 (66%), Gaps = 3/72 (4%)
 Frame = +2

Query: 38  RVLIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTE---YILVEFYAPWCGHCKS 208
           R+ +F  +ALL LA G  V   + VL L+  NFE+ I+ T     +LVEF+APWCGHCK 
Sbjct: 5   RLALFPGVALL-LAAGRLVAASD-VLELTDDNFESRISDTGSAGLMLVEFFAPWCGHCKR 62

Query: 209 LAPEYAKAATKL 244
           LAPEY  AAT+L
Sbjct: 63  LAPEYEAAATRL 74



 Score = 54.8 bits (126), Expect = 4e-07
 Identities = 21/49 (42%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = +2

Query: 110 VLVLSKANFETVITT-TEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           V V+   NF+ ++    + +L+EFYAPWCGHCK+L P+Y +   KL+++
Sbjct: 378 VKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKD 426



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 27/73 (36%), Positives = 44/73 (60%), Gaps = 4/73 (5%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF---RNGSPIDYSGGRQADDIISWLKKK-TGP 429
           I +AK+DAT   D+   Y VRG+PT+ F    +  +P  Y GGR+  D IS+L+++ T P
Sbjct: 429 IVIAKMDATAN-DVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQREATNP 487

Query: 430 PAVEVTSAEQAKE 468
           P ++    ++ K+
Sbjct: 488 PVIQEEKPKKKKK 500


>D16234-1|BAA03759.1|  505|Homo sapiens phospholipase C-alpha
           protein.
          Length = 505

 Score = 74.9 bits (176), Expect = 3e-13
 Identities = 37/83 (44%), Positives = 48/83 (57%), Gaps = 1/83 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGPPAV 438
           + LAKVD T   +    YGV GYPTLK FR+G     Y G R AD I+S LKK+ GP +V
Sbjct: 78  VPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASV 137

Query: 439 EVTSAEQAKELIDANTVIVFGFF 507
            + + E+ K+ I      + GFF
Sbjct: 138 PLRTEEEFKKFISDKDASIVGFF 160



 Score = 64.9 bits (151), Expect = 4e-10
 Identities = 35/72 (48%), Positives = 46/72 (63%), Gaps = 3/72 (4%)
 Frame = +2

Query: 38  RVLIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTE---YILVEFYAPWCGHCKS 208
           R+ +F  +ALL  A    +    +VL L+  NFE+ I+ T     +LVEF+APWCGHCK 
Sbjct: 5   RLALFPGVALLLAAA--RLAAASDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHCKR 62

Query: 209 LAPEYAKAATKL 244
           LAPEY  AAT+L
Sbjct: 63  LAPEYEAAATRL 74



 Score = 55.6 bits (128), Expect = 2e-07
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 3/59 (5%)
 Frame = +2

Query: 86  DEVPTEEN--VLVLSKANFETVITT-TEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           D +P   +  V V+   NF+ ++    + +L+EFYAPWCGHCK+L P+Y +   KL+++
Sbjct: 368 DPIPESNDGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKD 426



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 27/73 (36%), Positives = 44/73 (60%), Gaps = 4/73 (5%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF---RNGSPIDYSGGRQADDIISWLKKK-TGP 429
           I +AK+DAT   D+   Y VRG+PT+ F    +  +P  Y GGR+  D IS+L+++ T P
Sbjct: 429 IVIAKMDATAN-DVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQREATNP 487

Query: 430 PAVEVTSAEQAKE 468
           P ++    ++ K+
Sbjct: 488 PVIQEEKPKKKKK 500


>BC071878-1|AAH71878.1|  505|Homo sapiens protein disulfide
           isomerase family A, member 3 protein.
          Length = 505

 Score = 74.9 bits (176), Expect = 3e-13
 Identities = 37/83 (44%), Positives = 48/83 (57%), Gaps = 1/83 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGPPAV 438
           + LAKVD T   +    YGV GYPTLK FR+G     Y G R AD I+S LKK+ GP +V
Sbjct: 78  VPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASV 137

Query: 439 EVTSAEQAKELIDANTVIVFGFF 507
            + + E+ K+ I      + GFF
Sbjct: 138 PLRTEEEFKKFISDKDASIVGFF 160



 Score = 64.9 bits (151), Expect = 4e-10
 Identities = 35/72 (48%), Positives = 46/72 (63%), Gaps = 3/72 (4%)
 Frame = +2

Query: 38  RVLIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTE---YILVEFYAPWCGHCKS 208
           R+ +F  +ALL  A    +    +VL L+  NFE+ I+ T     +LVEF+APWCGHCK 
Sbjct: 5   RLALFPGVALLLAAA--RLAAASDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHCKR 62

Query: 209 LAPEYAKAATKL 244
           LAPEY  AAT+L
Sbjct: 63  LAPEYEAAATRL 74



 Score = 54.8 bits (126), Expect = 4e-07
 Identities = 21/49 (42%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = +2

Query: 110 VLVLSKANFETVITT-TEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           V V+   NF+ ++    + +L+EFYAPWCGHCK+L P+Y +   KL+++
Sbjct: 378 VKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKD 426



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 27/73 (36%), Positives = 44/73 (60%), Gaps = 4/73 (5%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF---RNGSPIDYSGGRQADDIISWLKKK-TGP 429
           I +AK+DAT   D+   Y VRG+PT+ F    +  +P  Y GGR+  D IS+L+++ T P
Sbjct: 429 IVIAKMDATAN-DVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQREATNP 487

Query: 430 PAVEVTSAEQAKE 468
           P ++    ++ K+
Sbjct: 488 PVIQEEKPKKKKK 500


>BC036000-1|AAH36000.4|  505|Homo sapiens protein disulfide
           isomerase family A, member 3 protein.
          Length = 505

 Score = 74.9 bits (176), Expect = 3e-13
 Identities = 37/83 (44%), Positives = 48/83 (57%), Gaps = 1/83 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGPPAV 438
           + LAKVD T   +    YGV GYPTLK FR+G     Y G R AD I+S LKK+ GP +V
Sbjct: 78  VPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASV 137

Query: 439 EVTSAEQAKELIDANTVIVFGFF 507
            + + E+ K+ I      + GFF
Sbjct: 138 PLRTEEEFKKFISDKDASIVGFF 160



 Score = 64.9 bits (151), Expect = 4e-10
 Identities = 35/72 (48%), Positives = 46/72 (63%), Gaps = 3/72 (4%)
 Frame = +2

Query: 38  RVLIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTE---YILVEFYAPWCGHCKS 208
           R+ +F  +ALL  A    +    +VL L+  NFE+ I+ T     +LVEF+APWCGHCK 
Sbjct: 5   RLALFPGVALLLAAA--RLAAASDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHCKR 62

Query: 209 LAPEYAKAATKL 244
           LAPEY  AAT+L
Sbjct: 63  LAPEYEAAATRL 74



 Score = 54.8 bits (126), Expect = 4e-07
 Identities = 21/49 (42%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = +2

Query: 110 VLVLSKANFETVITT-TEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           V V+   NF+ ++    + +L+EFYAPWCGHCK+L P+Y +   KL+++
Sbjct: 378 VKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKD 426



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 27/73 (36%), Positives = 44/73 (60%), Gaps = 4/73 (5%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF---RNGSPIDYSGGRQADDIISWLKKK-TGP 429
           I +AK+DAT   D+   Y VRG+PT+ F    +  +P  Y GGR+  D IS+L+++ T P
Sbjct: 429 IVIAKMDATAN-DVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQREATNP 487

Query: 430 PAVEVTSAEQAKE 468
           P ++    ++ K+
Sbjct: 488 PVIQEEKPKKKKK 500


>BC014433-1|AAH14433.1|  505|Homo sapiens protein disulfide
           isomerase family A, member 3 protein.
          Length = 505

 Score = 74.9 bits (176), Expect = 3e-13
 Identities = 37/83 (44%), Positives = 48/83 (57%), Gaps = 1/83 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGPPAV 438
           + LAKVD T   +    YGV GYPTLK FR+G     Y G R AD I+S LKK+ GP +V
Sbjct: 78  VPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASV 137

Query: 439 EVTSAEQAKELIDANTVIVFGFF 507
            + + E+ K+ I      + GFF
Sbjct: 138 PLRTEEEFKKFISDKDASIVGFF 160



 Score = 64.9 bits (151), Expect = 4e-10
 Identities = 35/72 (48%), Positives = 46/72 (63%), Gaps = 3/72 (4%)
 Frame = +2

Query: 38  RVLIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTE---YILVEFYAPWCGHCKS 208
           R+ +F  +ALL  A    +    +VL L+  NFE+ I+ T     +LVEF+APWCGHCK 
Sbjct: 5   RLALFPGVALLLAAA--RLAAASDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHCKR 62

Query: 209 LAPEYAKAATKL 244
           LAPEY  AAT+L
Sbjct: 63  LAPEYEAAATRL 74



 Score = 54.8 bits (126), Expect = 4e-07
 Identities = 21/49 (42%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = +2

Query: 110 VLVLSKANFETVITT-TEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           V V+   NF+ ++    + +L+EFYAPWCGHCK+L P+Y +   KL+++
Sbjct: 378 VKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKD 426



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 27/73 (36%), Positives = 44/73 (60%), Gaps = 4/73 (5%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF---RNGSPIDYSGGRQADDIISWLKKK-TGP 429
           I +AK+DAT   D+   Y VRG+PT+ F    +  +P  Y GGR+  D IS+L+++ T P
Sbjct: 429 IVIAKMDATAN-DVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQREATNP 487

Query: 430 PAVEVTSAEQAKE 468
           P ++    ++ K+
Sbjct: 488 PVIQEEKPKKKKK 500


>D49489-1|BAA08450.1|  440|Homo sapiens human P5 protein.
          Length = 440

 Score = 65.7 bits (153), Expect = 2e-10
 Identities = 36/87 (41%), Positives = 51/87 (58%), Gaps = 6/87 (6%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNG-SPIDYSGGRQADDIISW---LKKK 420
           +  +KLA VDAT  Q LA  YG+RG+PT+K F+ G SP+DY GGR   DI+S    L   
Sbjct: 212 KGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSD 271

Query: 421 TGPP--AVEVTSAEQAKELIDANTVIV 495
             PP   +E+ + + AK   + + + V
Sbjct: 272 NAPPPELLEIINEDIAKRTCEEHQLCV 298



 Score = 59.7 bits (138), Expect = 1e-08
 Identities = 28/60 (46%), Positives = 39/60 (65%), Gaps = 1/60 (1%)
 Frame = +2

Query: 74  LALGDEVPTEENVLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           LA+     + ++V+ L+ +NF   VI +    LVEFYAPWCGHC+ L PE+ KAAT L +
Sbjct: 15  LAVNGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKD 74



 Score = 57.2 bits (132), Expect = 7e-08
 Identities = 23/53 (43%), Positives = 41/53 (77%), Gaps = 1/53 (1%)
 Frame = +2

Query: 98  TEENVLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           ++++V+ L+  +F+  +  +E + +VEFYAPWCGHCK+L PE+A AA+++ E+
Sbjct: 158 SKKDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQ 210



 Score = 45.2 bits (102), Expect = 3e-04
 Identities = 20/49 (40%), Positives = 28/49 (57%), Gaps = 2/49 (4%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDII 402
           +K+  VDA +   L   YGV+G+PT+K F      P DY GGR  + I+
Sbjct: 76  VKVGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIV 124


>BC001312-1|AAH01312.1|  440|Homo sapiens protein disulfide
           isomerase family A, member 6 protein.
          Length = 440

 Score = 65.7 bits (153), Expect = 2e-10
 Identities = 36/87 (41%), Positives = 51/87 (58%), Gaps = 6/87 (6%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNG-SPIDYSGGRQADDIISW---LKKK 420
           +  +KLA VDAT  Q LA  YG+RG+PT+K F+ G SP+DY GGR   DI+S    L   
Sbjct: 212 KGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSD 271

Query: 421 TGPP--AVEVTSAEQAKELIDANTVIV 495
             PP   +E+ + + AK   + + + V
Sbjct: 272 NAPPPELLEIINEDIAKRTCEEHQLCV 298



 Score = 59.7 bits (138), Expect = 1e-08
 Identities = 28/60 (46%), Positives = 39/60 (65%), Gaps = 1/60 (1%)
 Frame = +2

Query: 74  LALGDEVPTEENVLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           LA+     + ++V+ L+ +NF   VI +    LVEFYAPWCGHC+ L PE+ KAAT L +
Sbjct: 15  LAVNGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKD 74



 Score = 57.2 bits (132), Expect = 7e-08
 Identities = 23/53 (43%), Positives = 41/53 (77%), Gaps = 1/53 (1%)
 Frame = +2

Query: 98  TEENVLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           ++++V+ L+  +F+  +  +E + +VEFYAPWCGHCK+L PE+A AA+++ E+
Sbjct: 158 SKKDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQ 210



 Score = 45.2 bits (102), Expect = 3e-04
 Identities = 20/49 (40%), Positives = 28/49 (57%), Gaps = 2/49 (4%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDII 402
           +K+  VDA +   L   YGV+G+PT+K F      P DY GGR  + I+
Sbjct: 76  VKVGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIV 124


>AC092687-3|AAY24070.1|  440|Homo sapiens unknown protein.
          Length = 440

 Score = 65.7 bits (153), Expect = 2e-10
 Identities = 36/87 (41%), Positives = 51/87 (58%), Gaps = 6/87 (6%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNG-SPIDYSGGRQADDIISW---LKKK 420
           +  +KLA VDAT  Q LA  YG+RG+PT+K F+ G SP+DY GGR   DI+S    L   
Sbjct: 212 KGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSD 271

Query: 421 TGPP--AVEVTSAEQAKELIDANTVIV 495
             PP   +E+ + + AK   + + + V
Sbjct: 272 NAPPPELLEIINEDIAKRTCEEHQLCV 298



 Score = 59.7 bits (138), Expect = 1e-08
 Identities = 28/60 (46%), Positives = 39/60 (65%), Gaps = 1/60 (1%)
 Frame = +2

Query: 74  LALGDEVPTEENVLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           LA+     + ++V+ L+ +NF   VI +    LVEFYAPWCGHC+ L PE+ KAAT L +
Sbjct: 15  LAVNGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKD 74



 Score = 57.2 bits (132), Expect = 7e-08
 Identities = 23/53 (43%), Positives = 41/53 (77%), Gaps = 1/53 (1%)
 Frame = +2

Query: 98  TEENVLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           ++++V+ L+  +F+  +  +E + +VEFYAPWCGHCK+L PE+A AA+++ E+
Sbjct: 158 SKKDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQ 210



 Score = 45.2 bits (102), Expect = 3e-04
 Identities = 20/49 (40%), Positives = 28/49 (57%), Gaps = 2/49 (4%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDII 402
           +K+  VDA +   L   YGV+G+PT+K F      P DY GGR  + I+
Sbjct: 76  VKVGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIV 124


>U79278-1|AAB50217.1|  421|Homo sapiens protein disulfide
           isomerase-related protein 5 protein.
          Length = 421

 Score = 65.3 bits (152), Expect = 3e-10
 Identities = 36/84 (42%), Positives = 50/84 (59%), Gaps = 6/84 (7%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNG-SPIDYSGGRQADDIISW---LKKKTGP 429
           +KLA VDAT  Q LA  YG+RG+PT+K F+ G SP+DY GGR   DI+S    L     P
Sbjct: 196 VKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAP 255

Query: 430 P--AVEVTSAEQAKELIDANTVIV 495
           P   +E+ + + AK   + + + V
Sbjct: 256 PPELLEIINEDIAKRTCEEHQLCV 279



 Score = 58.4 bits (135), Expect = 3e-08
 Identities = 26/52 (50%), Positives = 36/52 (69%), Gaps = 1/52 (1%)
 Frame = +2

Query: 98  TEENVLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           + ++V+ L+ +NF   VI +    LVEFYAPWCGHC+ L PE+ KAAT L +
Sbjct: 4   SSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKD 55



 Score = 57.2 bits (132), Expect = 7e-08
 Identities = 23/53 (43%), Positives = 41/53 (77%), Gaps = 1/53 (1%)
 Frame = +2

Query: 98  TEENVLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           ++++V+ L+  +F+  +  +E + +VEFYAPWCGHCK+L PE+A AA+++ E+
Sbjct: 139 SKKDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQ 191



 Score = 45.2 bits (102), Expect = 3e-04
 Identities = 20/49 (40%), Positives = 28/49 (57%), Gaps = 2/49 (4%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDII 402
           +K+  VDA +   L   YGV+G+PT+K F      P DY GGR  + I+
Sbjct: 57  VKVGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIV 105


>AK127433-1|BAC86977.1|  492|Homo sapiens protein ( Homo sapiens
           cDNA FLJ45525 fis, clone BRTHA2026311, highly  similar
           to Protein disulfide isomerase A6 precursor (EC
           5.3.4.1). ).
          Length = 492

 Score = 65.3 bits (152), Expect = 3e-10
 Identities = 36/84 (42%), Positives = 50/84 (59%), Gaps = 6/84 (7%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNG-SPIDYSGGRQADDIISW---LKKKTGP 429
           +KLA VDAT  Q LA  YG+RG+PT+K F+ G SP+DY GGR   DI+S    L     P
Sbjct: 267 VKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAP 326

Query: 430 P--AVEVTSAEQAKELIDANTVIV 495
           P   +E+ + + AK   + + + V
Sbjct: 327 PPELLEIINEDIAKRTCEEHQLCV 350



 Score = 59.7 bits (138), Expect = 1e-08
 Identities = 28/60 (46%), Positives = 39/60 (65%), Gaps = 1/60 (1%)
 Frame = +2

Query: 74  LALGDEVPTEENVLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           LA+     + ++V+ L+ +NF   VI +    LVEFYAPWCGHC+ L PE+ KAAT L +
Sbjct: 67  LAVNGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKD 126



 Score = 57.2 bits (132), Expect = 7e-08
 Identities = 23/53 (43%), Positives = 41/53 (77%), Gaps = 1/53 (1%)
 Frame = +2

Query: 98  TEENVLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           ++++V+ L+  +F+  +  +E + +VEFYAPWCGHCK+L PE+A AA+++ E+
Sbjct: 210 SKKDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQ 262



 Score = 45.2 bits (102), Expect = 3e-04
 Identities = 20/49 (40%), Positives = 28/49 (57%), Gaps = 2/49 (4%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDII 402
           +K+  VDA +   L   YGV+G+PT+K F      P DY GGR  + I+
Sbjct: 128 VKVGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIV 176


>BC107422-1|AAI07423.1|  423|Homo sapiens TXNDC10 protein protein.
          Length = 423

 Score = 57.2 bits (132), Expect = 7e-08
 Identities = 24/57 (42%), Positives = 35/57 (61%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG 426
           SP+K+ K+DAT    +A  +GVRGYPT+K  +     +Y G R  DDII +  + +G
Sbjct: 75  SPVKVGKMDATSYSSIASEFGVRGYPTIKLLKGDLAYNYRGPRTKDDIIEFAHRVSG 131



 Score = 41.1 bits (92), Expect = 0.005
 Identities = 14/17 (82%), Positives = 15/17 (88%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAP 217
           LV+FYAPWCGHCK L P
Sbjct: 45  LVDFYAPWCGHCKKLEP 61


>BC093794-1|AAH93794.1|  454|Homo sapiens thioredoxin domain
           containing 10 protein.
          Length = 454

 Score = 57.2 bits (132), Expect = 7e-08
 Identities = 24/57 (42%), Positives = 35/57 (61%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG 426
           SP+K+ K+DAT    +A  +GVRGYPT+K  +     +Y G R  DDII +  + +G
Sbjct: 75  SPVKVGKMDATSYSSIASEFGVRGYPTIKLLKGDLAYNYRGPRTKDDIIEFAHRVSG 131



 Score = 41.1 bits (92), Expect = 0.005
 Identities = 14/17 (82%), Positives = 15/17 (88%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAP 217
           LV+FYAPWCGHCK L P
Sbjct: 45  LVDFYAPWCGHCKKLEP 61


>BC093792-1|AAH93792.1|  454|Homo sapiens thioredoxin domain
           containing 10 protein.
          Length = 454

 Score = 57.2 bits (132), Expect = 7e-08
 Identities = 24/57 (42%), Positives = 35/57 (61%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG 426
           SP+K+ K+DAT    +A  +GVRGYPT+K  +     +Y G R  DDII +  + +G
Sbjct: 75  SPVKVGKMDATSYSSIASEFGVRGYPTIKLLKGDLAYNYRGPRTKDDIIEFAHRVSG 131



 Score = 41.1 bits (92), Expect = 0.005
 Identities = 14/17 (82%), Positives = 15/17 (88%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAP 217
           LV+FYAPWCGHCK L P
Sbjct: 45  LVDFYAPWCGHCKKLEP 61


>BC032325-1|AAH32325.1|  195|Homo sapiens TXNDC10 protein protein.
          Length = 195

 Score = 57.2 bits (132), Expect = 7e-08
 Identities = 24/57 (42%), Positives = 35/57 (61%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG 426
           SP+K+ K+DAT    +A  +GVRGYPT+K  +     +Y G R  DDII +  + +G
Sbjct: 75  SPVKVGKMDATSYSSIASEFGVRGYPTIKLLKGDLAYNYRGPRTKDDIIEFAHRVSG 131



 Score = 38.7 bits (86), Expect = 0.028
 Identities = 13/15 (86%), Positives = 14/15 (93%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSL 211
           LV+FYAPWCGHCK L
Sbjct: 45  LVDFYAPWCGHCKKL 59


>AB058733-1|BAB47459.1|  486|Homo sapiens KIAA1830 protein protein.
          Length = 486

 Score = 57.2 bits (132), Expect = 7e-08
 Identities = 24/57 (42%), Positives = 35/57 (61%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG 426
           SP+K+ K+DAT    +A  +GVRGYPT+K  +     +Y G R  DDII +  + +G
Sbjct: 107 SPVKVGKMDATSYSSIASEFGVRGYPTIKLLKGDLAYNYRGPRTKDDIIEFAHRVSG 163



 Score = 41.1 bits (92), Expect = 0.005
 Identities = 14/17 (82%), Positives = 15/17 (88%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAP 217
           LV+FYAPWCGHCK L P
Sbjct: 77  LVDFYAPWCGHCKKLEP 93


>BC052310-1|AAH52310.1|  360|Homo sapiens TXNDC5 protein protein.
          Length = 360

 Score = 52.8 bits (121), Expect = 2e-06
 Identities = 22/47 (46%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI-DYSGGRQADDI 399
           +K+A+VD T E+++   Y VRGYPTL  FR G  + ++SGGR  D +
Sbjct: 302 VKIAEVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSGGRDLDSL 348



 Score = 50.4 bits (115), Expect = 9e-06
 Identities = 28/76 (36%), Positives = 40/76 (52%), Gaps = 7/76 (9%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNG-SPIDYSGGRQADDIISWL------KKK 420
           + +AKVD T   D+  + GVRGYPTLK F+ G   + Y G R    + +W+      +  
Sbjct: 42  VYVAKVDCTAHSDVCSAQGVRGYPTLKLFKPGQEAVKYQGPRDFQTLENWMLQTLNEEPV 101

Query: 421 TGPPAVEVTSAEQAKE 468
           T  P VE  SA + K+
Sbjct: 102 TPEPEVEPPSAPELKQ 117



 Score = 49.2 bits (112), Expect = 2e-05
 Identities = 26/74 (35%), Positives = 41/74 (55%), Gaps = 4/74 (5%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLK---KKTGP 429
           +K+ KVD TQ  +L     VRGYPTL +FR+G  +D Y G R  + +  +++   ++T  
Sbjct: 168 VKIGKVDCTQHYELCSGNQVRGYPTLLWFRDGKKVDQYKGKRDLESLREYVESQLQRTET 227

Query: 430 PAVEVTSAEQAKEL 471
            A E  +  +A  L
Sbjct: 228 GATETVTPSEAPVL 241



 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 20/44 (45%), Positives = 29/44 (65%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATK 241
           VL L++ NF+  I       ++FYAPWCGHCK+LAP + + + K
Sbjct: 252 VLALTENNFDDTIAEG-ITFIKFYAPWCGHCKTLAPTWEELSKK 294



 Score = 48.0 bits (109), Expect = 5e-05
 Identities = 19/52 (36%), Positives = 33/52 (63%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           ++ +  LS +NFE  +   ++  ++F+APWCGHCK+LAP + + A  L   +
Sbjct: 116 KQGLYELSASNFELHVAQGDHF-IKFFAPWCGHCKALAPTWEQLALGLEHSE 166


>BC001199-1|AAH01199.1|  324|Homo sapiens TXNDC5 protein protein.
          Length = 324

 Score = 52.8 bits (121), Expect = 2e-06
 Identities = 22/47 (46%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI-DYSGGRQADDI 399
           +K+A+VD T E+++   Y VRGYPTL  FR G  + ++SGGR  D +
Sbjct: 266 VKIAEVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSGGRDLDSL 312



 Score = 50.4 bits (115), Expect = 9e-06
 Identities = 28/76 (36%), Positives = 40/76 (52%), Gaps = 7/76 (9%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNG-SPIDYSGGRQADDIISWL------KKK 420
           + +AKVD T   D+  + GVRGYPTLK F+ G   + Y G R    + +W+      +  
Sbjct: 6   VYVAKVDCTAHSDVCSAQGVRGYPTLKLFKPGQEAVKYQGPRDFQTLENWMLQTLNEEPV 65

Query: 421 TGPPAVEVTSAEQAKE 468
           T  P VE  SA + K+
Sbjct: 66  TPEPEVEPPSAPELKQ 81



 Score = 49.2 bits (112), Expect = 2e-05
 Identities = 26/74 (35%), Positives = 41/74 (55%), Gaps = 4/74 (5%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLK---KKTGP 429
           +K+ KVD TQ  +L     VRGYPTL +FR+G  +D Y G R  + +  +++   ++T  
Sbjct: 132 VKIGKVDCTQHYELCSGNQVRGYPTLLWFRDGKKVDQYKGKRDLESLREYVESQLQRTET 191

Query: 430 PAVEVTSAEQAKEL 471
            A E  +  +A  L
Sbjct: 192 GATETVTPSEAPVL 205



 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 20/44 (45%), Positives = 29/44 (65%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATK 241
           VL L++ NF+  I       ++FYAPWCGHCK+LAP + + + K
Sbjct: 216 VLALTENNFDDTIAEG-ITFIKFYAPWCGHCKTLAPTWEELSKK 258



 Score = 48.0 bits (109), Expect = 5e-05
 Identities = 19/52 (36%), Positives = 33/52 (63%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           ++ +  LS +NFE  +   ++  ++F+APWCGHCK+LAP + + A  L   +
Sbjct: 80  KQGLYELSASNFELHVAQGDHF-IKFFAPWCGHCKALAPTWEQLALGLEHSE 130


>AY358646-1|AAQ89009.1|  432|Homo sapiens disulfide isomerase
           protein.
          Length = 432

 Score = 52.8 bits (121), Expect = 2e-06
 Identities = 22/47 (46%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI-DYSGGRQADDI 399
           +K+A+VD T E+++   Y VRGYPTL  FR G  + ++SGGR  D +
Sbjct: 374 VKIAEVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSGGRDLDSL 420



 Score = 50.4 bits (115), Expect = 9e-06
 Identities = 28/76 (36%), Positives = 40/76 (52%), Gaps = 7/76 (9%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNG-SPIDYSGGRQADDIISWL------KKK 420
           + +AKVD T   D+  + GVRGYPTLK F+ G   + Y G R    + +W+      +  
Sbjct: 114 VYVAKVDCTAHSDVCSAQGVRGYPTLKLFKPGQEAVKYQGPRDFQTLENWMLQTLNEEPV 173

Query: 421 TGPPAVEVTSAEQAKE 468
           T  P VE  SA + K+
Sbjct: 174 TPEPEVEPPSAPELKQ 189



 Score = 49.2 bits (112), Expect = 2e-05
 Identities = 26/74 (35%), Positives = 41/74 (55%), Gaps = 4/74 (5%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLK---KKTGP 429
           +K+ KVD TQ  +L     VRGYPTL +FR+G  +D Y G R  + +  +++   ++T  
Sbjct: 240 VKIGKVDCTQHYELCSGNQVRGYPTLLWFRDGKKVDQYKGKRDLESLREYVESQLQRTET 299

Query: 430 PAVEVTSAEQAKEL 471
            A E  +  +A  L
Sbjct: 300 GATETVTPSEAPVL 313



 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 20/44 (45%), Positives = 29/44 (65%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATK 241
           VL L++ NF+  I       ++FYAPWCGHCK+LAP + + + K
Sbjct: 324 VLALTENNFDDTIAEG-ITFIKFYAPWCGHCKTLAPTWEELSKK 366



 Score = 48.0 bits (109), Expect = 5e-05
 Identities = 19/52 (36%), Positives = 33/52 (63%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           ++ +  LS +NFE  +   ++  ++F+APWCGHCK+LAP + + A  L   +
Sbjct: 188 KQGLYELSASNFELHVAQGDHF-IKFFAPWCGHCKALAPTWEQLALGLEHSE 238



 Score = 34.7 bits (76), Expect = 0.46
 Identities = 11/18 (61%), Positives = 14/18 (77%)
 Frame = +2

Query: 170 VEFYAPWCGHCKSLAPEY 223
           V F+APWCGHC+ L P +
Sbjct: 82  VMFFAPWCGHCQRLQPTW 99


>AY326464-1|AAR99514.1|  363|Homo sapiens putative protein STRF8
           protein.
          Length = 363

 Score = 52.8 bits (121), Expect = 2e-06
 Identities = 22/47 (46%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI-DYSGGRQADDI 399
           +K+A+VD T E+++   Y VRGYPTL  FR G  + ++SGGR  D +
Sbjct: 305 VKIAEVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSGGRDLDSL 351



 Score = 50.4 bits (115), Expect = 9e-06
 Identities = 28/76 (36%), Positives = 40/76 (52%), Gaps = 7/76 (9%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNG-SPIDYSGGRQADDIISWL------KKK 420
           + +AKVD T   D+  + GVRGYPTLK F+ G   + Y G R    + +W+      +  
Sbjct: 45  VYVAKVDCTAHSDVCSAQGVRGYPTLKLFKPGQEAVKYQGPRDFQTLENWMLQTLNEEPV 104

Query: 421 TGPPAVEVTSAEQAKE 468
           T  P VE  SA + K+
Sbjct: 105 TPEPEVEPPSAPELKQ 120



 Score = 49.2 bits (112), Expect = 2e-05
 Identities = 26/74 (35%), Positives = 41/74 (55%), Gaps = 4/74 (5%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLK---KKTGP 429
           +K+ KVD TQ  +L     VRGYPTL +FR+G  +D Y G R  + +  +++   ++T  
Sbjct: 171 VKIGKVDCTQHYELCSGNQVRGYPTLLWFRDGKKVDQYKGKRDLESLREYVESQLQRTET 230

Query: 430 PAVEVTSAEQAKEL 471
            A E  +  +A  L
Sbjct: 231 GATETVTPSEAPVL 244



 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 20/44 (45%), Positives = 29/44 (65%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATK 241
           VL L++ NF+  I       ++FYAPWCGHCK+LAP + + + K
Sbjct: 255 VLALTENNFDDTIAEG-ITFIKFYAPWCGHCKTLAPTWEELSKK 297



 Score = 48.0 bits (109), Expect = 5e-05
 Identities = 19/52 (36%), Positives = 33/52 (63%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           ++ +  LS +NFE  +   ++  ++F+APWCGHCK+LAP + + A  L   +
Sbjct: 119 KQGLYELSASNFELHVAQGDHF-IKFFAPWCGHCKALAPTWEQLALGLEHSE 169



 Score = 34.7 bits (76), Expect = 0.46
 Identities = 11/18 (61%), Positives = 14/18 (77%)
 Frame = +2

Query: 170 VEFYAPWCGHCKSLAPEY 223
           V F+APWCGHC+ L P +
Sbjct: 13  VMFFAPWCGHCQRLQPTW 30


>AL834423-1|CAD39084.1|  244|Homo sapiens hypothetical protein
           protein.
          Length = 244

 Score = 52.8 bits (121), Expect = 2e-06
 Identities = 22/47 (46%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI-DYSGGRQADDI 399
           +K+A+VD T E+++   Y VRGYPTL  FR G  + ++SGGR  D +
Sbjct: 186 VKIAEVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSGGRDLDSL 232



 Score = 49.2 bits (112), Expect = 2e-05
 Identities = 26/74 (35%), Positives = 41/74 (55%), Gaps = 4/74 (5%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLK---KKTGP 429
           +K+ KVD TQ  +L     VRGYPTL +FR+G  +D Y G R  + +  +++   ++T  
Sbjct: 52  VKIGKVDCTQHYELCSGNQVRGYPTLLWFRDGKKVDQYKGKRDLESLREYVESQLQRTET 111

Query: 430 PAVEVTSAEQAKEL 471
            A E  +  +A  L
Sbjct: 112 GATETVTPSEAPVL 125



 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 20/44 (45%), Positives = 29/44 (65%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATK 241
           VL L++ NF+  I       ++FYAPWCGHCK+LAP + + + K
Sbjct: 136 VLALTENNFDDTIAEG-ITFIKFYAPWCGHCKTLAPTWEELSKK 178



 Score = 47.6 bits (108), Expect = 6e-05
 Identities = 19/46 (41%), Positives = 30/46 (65%)
 Frame = +2

Query: 119 LSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           LS +NFE  +   ++  ++F+APWCGHCK+LAP + + A  L   +
Sbjct: 6   LSASNFELHVAQGDHF-IKFFAPWCGHCKALAPTWEQLALGLEHSE 50


>AL133541-2|CAI19473.1|  432|Homo sapiens thioredoxin domain
           containing 5 protein.
          Length = 432

 Score = 52.8 bits (121), Expect = 2e-06
 Identities = 22/47 (46%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI-DYSGGRQADDI 399
           +K+A+VD T E+++   Y VRGYPTL  FR G  + ++SGGR  D +
Sbjct: 374 VKIAEVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSGGRDLDSL 420



 Score = 50.4 bits (115), Expect = 9e-06
 Identities = 28/76 (36%), Positives = 40/76 (52%), Gaps = 7/76 (9%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNG-SPIDYSGGRQADDIISWL------KKK 420
           + +AKVD T   D+  + GVRGYPTLK F+ G   + Y G R    + +W+      +  
Sbjct: 114 VYVAKVDCTAHSDVCSAQGVRGYPTLKLFKPGQEAVKYQGPRDFQTLENWMLQTLNEEPV 173

Query: 421 TGPPAVEVTSAEQAKE 468
           T  P VE  SA + K+
Sbjct: 174 TPEPEVEPPSAPELKQ 189



 Score = 49.2 bits (112), Expect = 2e-05
 Identities = 26/74 (35%), Positives = 41/74 (55%), Gaps = 4/74 (5%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLK---KKTGP 429
           +K+ KVD TQ  +L     VRGYPTL +FR+G  +D Y G R  + +  +++   ++T  
Sbjct: 240 VKIGKVDCTQHYELCSGNQVRGYPTLLWFRDGKKVDQYKGKRDLESLREYVESQLQRTET 299

Query: 430 PAVEVTSAEQAKEL 471
            A E  +  +A  L
Sbjct: 300 GATETVTPSEAPVL 313



 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 20/44 (45%), Positives = 29/44 (65%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATK 241
           VL L++ NF+  I       ++FYAPWCGHCK+LAP + + + K
Sbjct: 324 VLALTENNFDDTIAEG-ITFIKFYAPWCGHCKTLAPTWEELSKK 366



 Score = 48.0 bits (109), Expect = 5e-05
 Identities = 19/52 (36%), Positives = 33/52 (63%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           ++ +  LS +NFE  +   ++  ++F+APWCGHCK+LAP + + A  L   +
Sbjct: 188 KQGLYELSASNFELHVAQGDHF-IKFFAPWCGHCKALAPTWEQLALGLEHSE 238



 Score = 34.7 bits (76), Expect = 0.46
 Identities = 11/18 (61%), Positives = 14/18 (77%)
 Frame = +2

Query: 170 VEFYAPWCGHCKSLAPEY 223
           V F+APWCGHC+ L P +
Sbjct: 82  VMFFAPWCGHCQRLQPTW 99


>AK075291-1|BAC11526.1|  432|Homo sapiens protein ( Homo sapiens
           cDNA FLJ90810 fis, clone Y79AA1000876, weakly similar to
           PROTEIN DISULFIDE ISOMERASE-RELATED PROTEIN PRECURSOR.
           ).
          Length = 432

 Score = 52.8 bits (121), Expect = 2e-06
 Identities = 22/47 (46%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI-DYSGGRQADDI 399
           +K+A+VD T E+++   Y VRGYPTL  FR G  + ++SGGR  D +
Sbjct: 374 VKIAEVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSGGRDLDSL 420



 Score = 50.4 bits (115), Expect = 9e-06
 Identities = 28/76 (36%), Positives = 40/76 (52%), Gaps = 7/76 (9%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNG-SPIDYSGGRQADDIISWL------KKK 420
           + +AKVD T   D+  + GVRGYPTLK F+ G   + Y G R    + +W+      +  
Sbjct: 114 VYVAKVDCTAHSDVCSAQGVRGYPTLKLFKPGQEAVKYQGPRDFQTLENWMLQTLNEEPV 173

Query: 421 TGPPAVEVTSAEQAKE 468
           T  P VE  SA + K+
Sbjct: 174 TPEPEVEPPSAPELKQ 189



 Score = 49.2 bits (112), Expect = 2e-05
 Identities = 26/74 (35%), Positives = 41/74 (55%), Gaps = 4/74 (5%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLK---KKTGP 429
           +K+ KVD TQ  +L     VRGYPTL +FR+G  +D Y G R  + +  +++   ++T  
Sbjct: 240 VKIGKVDCTQHYELCSGNQVRGYPTLLWFRDGKKVDQYKGKRDLESLREYVESQLQRTET 299

Query: 430 PAVEVTSAEQAKEL 471
            A E  +  +A  L
Sbjct: 300 GATETVTPSEAPVL 313



 Score = 48.0 bits (109), Expect = 5e-05
 Identities = 19/52 (36%), Positives = 33/52 (63%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           ++ +  LS +NFE  +   ++  ++F+APWCGHCK+LAP + + A  L   +
Sbjct: 188 KQGLYELSASNFELHVAQGDHF-IKFFAPWCGHCKALAPTWEQLALGLEHSE 238



 Score = 47.2 bits (107), Expect = 8e-05
 Identities = 19/44 (43%), Positives = 29/44 (65%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATK 241
           VL L++ NF+  I       ++FYAPWCGHC++LAP + + + K
Sbjct: 324 VLALTENNFDDTIAEG-ITFIKFYAPWCGHCRTLAPTWEELSKK 366



 Score = 34.7 bits (76), Expect = 0.46
 Identities = 11/18 (61%), Positives = 14/18 (77%)
 Frame = +2

Query: 170 VEFYAPWCGHCKSLAPEY 223
           V F+APWCGHC+ L P +
Sbjct: 82  VMFFAPWCGHCQRLQPTW 99


>AJ440721-1|CAD29430.1|  363|Homo sapiens thioredoxin related
           protein protein.
          Length = 363

 Score = 52.8 bits (121), Expect = 2e-06
 Identities = 22/47 (46%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI-DYSGGRQADDI 399
           +K+A+VD T E+++   Y VRGYPTL  FR G  + ++SGGR  D +
Sbjct: 305 VKIAEVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSGGRDLDSL 351



 Score = 50.4 bits (115), Expect = 9e-06
 Identities = 28/76 (36%), Positives = 40/76 (52%), Gaps = 7/76 (9%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNG-SPIDYSGGRQADDIISWL------KKK 420
           + +AKVD T   D+  + GVRGYPTLK F+ G   + Y G R    + +W+      +  
Sbjct: 45  VYVAKVDCTAHSDVCSAQGVRGYPTLKLFKPGQEAVKYQGPRDFQTLENWMLQTLNEEPV 104

Query: 421 TGPPAVEVTSAEQAKE 468
           T  P VE  SA + K+
Sbjct: 105 TPEPEVEPPSAPELKQ 120



 Score = 49.2 bits (112), Expect = 2e-05
 Identities = 26/74 (35%), Positives = 41/74 (55%), Gaps = 4/74 (5%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLK---KKTGP 429
           +K+ KVD TQ  +L     VRGYPTL +FR+G  +D Y G R  + +  +++   ++T  
Sbjct: 171 VKIGKVDCTQHYELCSGNQVRGYPTLLWFRDGKKVDQYKGKRDLESLREYVESQLQRTET 230

Query: 430 PAVEVTSAEQAKEL 471
            A E  +  +A  L
Sbjct: 231 GATETVTPSEAPVL 244



 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 20/44 (45%), Positives = 29/44 (65%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATK 241
           VL L++ NF+  I       ++FYAPWCGHCK+LAP + + + K
Sbjct: 255 VLALTENNFDDTIAEG-ITFIKFYAPWCGHCKTLAPTWEELSKK 297



 Score = 48.0 bits (109), Expect = 5e-05
 Identities = 19/52 (36%), Positives = 33/52 (63%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           ++ +  LS +NFE  +   ++  ++F+APWCGHCK+LAP + + A  L   +
Sbjct: 119 KQGLYELSASNFELHVAQGDHF-IKFFAPWCGHCKALAPTWEQLALGLEHSE 169



 Score = 34.7 bits (76), Expect = 0.46
 Identities = 11/18 (61%), Positives = 14/18 (77%)
 Frame = +2

Query: 170 VEFYAPWCGHCKSLAPEY 223
           V F+APWCGHC+ L P +
Sbjct: 13  VMFFAPWCGHCQRLQPTW 30


>BC044936-1|AAH44936.1|  584|Homo sapiens protein disulfide
           isomerase-like protein of the testis protein.
          Length = 584

 Score = 52.0 bits (119), Expect = 3e-06
 Identities = 26/88 (29%), Positives = 47/88 (53%), Gaps = 3/88 (3%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS---PIDYSGGRQADDIISWLKKKT 423
           ++ I   KVD T E++L + +G+   P LK F  G+   PI   G  ++  ++ WL+++ 
Sbjct: 93  KNGIGFGKVDITIEKELQQEFGITKAPELKLFFEGNRSEPISCKGVVESAALVVWLRRQI 152

Query: 424 GPPAVEVTSAEQAKELIDANTVIVFGFF 507
              A    S+EQ  E + +  +++ GFF
Sbjct: 153 SQKAFLFNSSEQVAEFVISRPLVIVGFF 180



 Score = 30.3 bits (65), Expect = 9.8
 Identities = 14/30 (46%), Positives = 16/30 (53%), Gaps = 1/30 (3%)
 Frame = +2

Query: 131 NFETVITTTEY-ILVEFYAPWCGHCKSLAP 217
           NF  V+   E  + V FYAPW   CK L P
Sbjct: 396 NFNVVVFDKEKDVFVMFYAPWSKKCKMLFP 425


>BC042607-1|AAH42607.1|  584|Homo sapiens protein disulfide
           isomerase-like protein of the testis protein.
          Length = 584

 Score = 52.0 bits (119), Expect = 3e-06
 Identities = 26/88 (29%), Positives = 47/88 (53%), Gaps = 3/88 (3%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS---PIDYSGGRQADDIISWLKKKT 423
           ++ I   KVD T E++L + +G+   P LK F  G+   PI   G  ++  ++ WL+++ 
Sbjct: 93  KNGIGFGKVDITIEKELQQEFGITKAPELKLFFEGNRSEPISCKGVVESAALVVWLRRQI 152

Query: 424 GPPAVEVTSAEQAKELIDANTVIVFGFF 507
              A    S+EQ  E + +  +++ GFF
Sbjct: 153 SQKAFLFNSSEQVAEFVISRPLVIVGFF 180



 Score = 30.3 bits (65), Expect = 9.8
 Identities = 14/30 (46%), Positives = 16/30 (53%), Gaps = 1/30 (3%)
 Frame = +2

Query: 131 NFETVITTTEY-ILVEFYAPWCGHCKSLAP 217
           NF  V+   E  + V FYAPW   CK L P
Sbjct: 396 NFNVVVFDKEKDVFVMFYAPWSKKCKMLFP 425


>AK097476-1|BAC05068.1|  584|Homo sapiens protein ( Homo sapiens
           cDNA FLJ40157 fis, clone TESTI2014800, weakly similar to
           PROTEIN DISULFIDE ISOMERASE (EC 5.3.4.1). ).
          Length = 584

 Score = 52.0 bits (119), Expect = 3e-06
 Identities = 26/88 (29%), Positives = 47/88 (53%), Gaps = 3/88 (3%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS---PIDYSGGRQADDIISWLKKKT 423
           ++ I   KVD T E++L + +G+   P LK F  G+   PI   G  ++  ++ WL+++ 
Sbjct: 93  KNGIGFGKVDITIEKELQQEFGITKAPELKLFFEGNRSEPISCKGVVESAALVVWLRRQI 152

Query: 424 GPPAVEVTSAEQAKELIDANTVIVFGFF 507
              A    S+EQ  E + +  +++ GFF
Sbjct: 153 SQKAFLFNSSEQVAEFVISRPLVIVGFF 180



 Score = 30.3 bits (65), Expect = 9.8
 Identities = 14/30 (46%), Positives = 16/30 (53%), Gaps = 1/30 (3%)
 Frame = +2

Query: 131 NFETVITTTEY-ILVEFYAPWCGHCKSLAP 217
           NF  V+   E  + V FYAPW   CK L P
Sbjct: 396 NFNVVVFDKEKDVFVMFYAPWSKKCKMLFP 425


>D49490-1|BAA08451.1|  519|Homo sapiens protein disulfide
           isomerase-related protein (PDIR) protein.
          Length = 519

 Score = 50.4 bits (115), Expect = 9e-06
 Identities = 21/49 (42%), Positives = 30/49 (61%)
 Frame = +2

Query: 107 NVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           +V  L+  +F+  +     +LV F+APWCGHCK + PE+ KAA  L  E
Sbjct: 277 SVYHLTDEDFDQFVKEHSSVLVMFHAPWCGHCKKMKPEFEKAAEALHGE 325



 Score = 48.8 bits (111), Expect = 3e-05
 Identities = 24/69 (34%), Positives = 35/69 (50%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVT 447
           LA VDAT  + LAE + +  +PTLK+F+NG        R     + W++    PP  E T
Sbjct: 332 LAAVDATVNKALAERFHISEFPTLKYFKNGEKYAVPVLRTKKKFLEWMQNPEAPPPPEPT 391

Query: 448 SAEQAKELI 474
             EQ   ++
Sbjct: 392 WEEQQTSVL 400



 Score = 47.2 bits (107), Expect = 8e-05
 Identities = 25/67 (37%), Positives = 40/67 (59%), Gaps = 2/67 (2%)
 Frame = +2

Query: 71  GLALGDEVPTEENVLVL-SKANFETVITTTEY-ILVEFYAPWCGHCKSLAPEYAKAATKL 244
           G  L +E P  ++V+ L S+ +F  ++   E  +L+ FYAPWC  CK + P + KAAT+L
Sbjct: 140 GPPLWEEDPGAKDVVHLDSEKDFRRLLKKEEKPLLIMFYAPWCSMCKRMMPHFQKAATQL 199

Query: 245 AEEDLLS 265
               +L+
Sbjct: 200 RGHAVLA 206



 Score = 44.8 bits (101), Expect = 4e-04
 Identities = 18/51 (35%), Positives = 27/51 (52%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           + +VL L   NF   +   ++ LV FYAPWC HCK + P +   A    ++
Sbjct: 396 QTSVLHLVGDNFRETLKKKKHTLVMFYAPWCPHCKKVIPHFTATADAFKDD 446



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 23/66 (34%), Positives = 36/66 (54%), Gaps = 2/66 (3%)
 Frame = +1

Query: 277 VDATQEQDLAESYGVRGYPTLKFFRNGSPI-DYSG-GRQADDIISWLKKKTGPPAVEVTS 450
           V +++ +++ E Y VRG+PT+ +F  G  +  Y   G  A+DI+ WLK    PP  +V  
Sbjct: 210 VYSSEFENIKEEYSVRGFPTICYFEKGRFLFQYDNYGSTAEDIVEWLKNPQ-PPQPQVPE 268

Query: 451 AEQAKE 468
              A E
Sbjct: 269 TPWADE 274


>BC005374-1|AAH05374.1|  406|Homo sapiens thioredoxin domain
           containing 4 (endoplasmic reticulum) protein.
          Length = 406

 Score = 50.0 bits (114), Expect = 1e-05
 Identities = 25/84 (29%), Positives = 43/84 (51%), Gaps = 2/84 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI--DYSGGRQADDIISWLKKKTGPPA 435
           +  A+VD  Q  D+A+ Y +  YPTLK FRNG  +  +Y G R    +  +++++   P 
Sbjct: 85  VVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPI 144

Query: 436 VEVTSAEQAKELIDANTVIVFGFF 507
            E+    +   L D +   + G+F
Sbjct: 145 QEIRDLAEITTL-DRSKRNIIGYF 167



 Score = 36.7 bits (81), Expect = 0.11
 Identities = 15/53 (28%), Positives = 25/53 (47%)
 Frame = +2

Query: 95  PTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           P    +  L   N + ++   +  LV FYA WC   + L P + +A+  + EE
Sbjct: 26  PVTTEITSLDTENIDEILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEE 78


>AY359048-1|AAQ89407.1|  406|Homo sapiens TXNDC4 protein.
          Length = 406

 Score = 50.0 bits (114), Expect = 1e-05
 Identities = 25/84 (29%), Positives = 43/84 (51%), Gaps = 2/84 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI--DYSGGRQADDIISWLKKKTGPPA 435
           +  A+VD  Q  D+A+ Y +  YPTLK FRNG  +  +Y G R    +  +++++   P 
Sbjct: 85  VVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPI 144

Query: 436 VEVTSAEQAKELIDANTVIVFGFF 507
            E+    +   L D +   + G+F
Sbjct: 145 QEIRDLAEITTL-DRSKRNIIGYF 167



 Score = 37.1 bits (82), Expect = 0.085
 Identities = 15/53 (28%), Positives = 26/53 (49%)
 Frame = +2

Query: 95  PTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           P    +  L+  N + ++   +  LV FYA WC   + L P + +A+  + EE
Sbjct: 26  PVTTEITSLATENIDEILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEE 78


>AL360084-2|CAH70308.1|  406|Homo sapiens thioredoxin domain
           containing 4 (endoplasmic reticulum) protein.
          Length = 406

 Score = 50.0 bits (114), Expect = 1e-05
 Identities = 25/84 (29%), Positives = 43/84 (51%), Gaps = 2/84 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI--DYSGGRQADDIISWLKKKTGPPA 435
           +  A+VD  Q  D+A+ Y +  YPTLK FRNG  +  +Y G R    +  +++++   P 
Sbjct: 85  VVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPI 144

Query: 436 VEVTSAEQAKELIDANTVIVFGFF 507
            E+    +   L D +   + G+F
Sbjct: 145 QEIRDLAEITTL-DRSKRNIIGYF 167



 Score = 36.7 bits (81), Expect = 0.11
 Identities = 15/53 (28%), Positives = 25/53 (47%)
 Frame = +2

Query: 95  PTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           P    +  L   N + ++   +  LV FYA WC   + L P + +A+  + EE
Sbjct: 26  PVTTEITSLDTENIDEILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEE 78


>AL358937-2|CAI95319.1|  406|Homo sapiens thioredoxin domain
           containing 4 (endoplasmic reticulum) protein.
          Length = 406

 Score = 50.0 bits (114), Expect = 1e-05
 Identities = 25/84 (29%), Positives = 43/84 (51%), Gaps = 2/84 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI--DYSGGRQADDIISWLKKKTGPPA 435
           +  A+VD  Q  D+A+ Y +  YPTLK FRNG  +  +Y G R    +  +++++   P 
Sbjct: 85  VVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPI 144

Query: 436 VEVTSAEQAKELIDANTVIVFGFF 507
            E+    +   L D +   + G+F
Sbjct: 145 QEIRDLAEITTL-DRSKRNIIGYF 167



 Score = 36.7 bits (81), Expect = 0.11
 Identities = 15/53 (28%), Positives = 25/53 (47%)
 Frame = +2

Query: 95  PTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           P    +  L   N + ++   +  LV FYA WC   + L P + +A+  + EE
Sbjct: 26  PVTTEITSLDTENIDEILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEE 78


>AL137072-1|CAH72172.1|  406|Homo sapiens thioredoxin domain
           containing 4 (endoplasmic reticulum) protein.
          Length = 406

 Score = 50.0 bits (114), Expect = 1e-05
 Identities = 25/84 (29%), Positives = 43/84 (51%), Gaps = 2/84 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI--DYSGGRQADDIISWLKKKTGPPA 435
           +  A+VD  Q  D+A+ Y +  YPTLK FRNG  +  +Y G R    +  +++++   P 
Sbjct: 85  VVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPI 144

Query: 436 VEVTSAEQAKELIDANTVIVFGFF 507
            E+    +   L D +   + G+F
Sbjct: 145 QEIRDLAEITTL-DRSKRNIIGYF 167



 Score = 36.7 bits (81), Expect = 0.11
 Identities = 15/53 (28%), Positives = 25/53 (47%)
 Frame = +2

Query: 95  PTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           P    +  L   N + ++   +  LV FYA WC   + L P + +A+  + EE
Sbjct: 26  PVTTEITSLDTENIDEILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEE 78


>AJ344330-1|CAC87611.1|  406|Homo sapiens ERp44 protein protein.
          Length = 406

 Score = 50.0 bits (114), Expect = 1e-05
 Identities = 25/84 (29%), Positives = 43/84 (51%), Gaps = 2/84 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI--DYSGGRQADDIISWLKKKTGPPA 435
           +  A+VD  Q  D+A+ Y +  YPTLK FRNG  +  +Y G R    +  +++++   P 
Sbjct: 85  VVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPI 144

Query: 436 VEVTSAEQAKELIDANTVIVFGFF 507
            E+    +   L D +   + G+F
Sbjct: 145 QEIRDLAEITTL-DRSKRNIIGYF 167



 Score = 36.7 bits (81), Expect = 0.11
 Identities = 15/53 (28%), Positives = 25/53 (47%)
 Frame = +2

Query: 95  PTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           P    +  L   N + ++   +  LV FYA WC   + L P + +A+  + EE
Sbjct: 26  PVTTEITSLDTENIDEILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEE 78


>AB011145-1|BAA25499.1|  451|Homo sapiens KIAA0573 protein protein.
          Length = 451

 Score = 50.0 bits (114), Expect = 1e-05
 Identities = 25/84 (29%), Positives = 43/84 (51%), Gaps = 2/84 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI--DYSGGRQADDIISWLKKKTGPPA 435
           +  A+VD  Q  D+A+ Y +  YPTLK FRNG  +  +Y G R    +  +++++   P 
Sbjct: 130 VVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPI 189

Query: 436 VEVTSAEQAKELIDANTVIVFGFF 507
            E+    +   L D +   + G+F
Sbjct: 190 QEIRDLAEITTL-DRSKRNIIGYF 212



 Score = 36.7 bits (81), Expect = 0.11
 Identities = 15/53 (28%), Positives = 25/53 (47%)
 Frame = +2

Query: 95  PTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           P    +  L   N + ++   +  LV FYA WC   + L P + +A+  + EE
Sbjct: 71  PVTTEITSLDTENIDEILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEE 123


>X07077-1|CAA30112.1|  216|Homo sapiens glutathione-insulin
           transhydrogenase (216 AA) protein.
          Length = 216

 Score = 49.2 bits (112), Expect = 2e-05
 Identities = 23/44 (52%), Positives = 28/44 (63%), Gaps = 1/44 (2%)
 Frame = +2

Query: 101 EENVLVLSKANFETV-ITTTEYILVEFYAPWCGHCKSLAPEYAK 229
           ++ V VL   NFE V     + + VEFYAPWCGHCK LAP + K
Sbjct: 74  KQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDK 117



 Score = 33.1 bits (72), Expect = 1.4
 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 3/54 (5%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF---RNGSPIDYSGGRQADDIISWLK 414
           I +AK+D+T  +   E+  V  +PTLKFF    + + IDY+G R  D    +L+
Sbjct: 128 IVIAKMDSTANE--VEAVKVHSFPTLKFFPASADRTVIDYNGQRTLDGFKKFLE 179


>BC014504-1|AAH14504.1|  185|Homo sapiens P4HB protein protein.
          Length = 185

 Score = 49.2 bits (112), Expect = 2e-05
 Identities = 23/44 (52%), Positives = 28/44 (63%), Gaps = 1/44 (2%)
 Frame = +2

Query: 101 EENVLVLSKANFETV-ITTTEYILVEFYAPWCGHCKSLAPEYAK 229
           ++ V VL   NFE V     + + VEFYAPWCGHCK LAP + K
Sbjct: 43  KQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDK 86



 Score = 33.1 bits (72), Expect = 1.4
 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 3/54 (5%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF---RNGSPIDYSGGRQADDIISWLK 414
           I +AK+D+T  +   E+  V  +PTLKFF    + + IDY+G R  D    +L+
Sbjct: 97  IVIAKMDSTANE--VEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLE 148


>Z69667-13|CAI95588.1|  154|Homo sapiens protein disulfide isomerase
           family A, member 2 protein.
          Length = 154

 Score = 47.2 bits (107), Expect = 8e-05
 Identities = 23/53 (43%), Positives = 31/53 (58%), Gaps = 2/53 (3%)
 Frame = +2

Query: 110 VLVLSKANFETV-ITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE-EDLL 262
           V  L   NFE V    T+ + V+FYAPWC HCK +AP +   A K  + ED++
Sbjct: 19  VKTLVGKNFEQVAFDETKNVFVKFYAPWCTHCKEMAPAWEALAEKYQDHEDII 71


>BC001625-1|AAH01625.1|  262|Homo sapiens PDIA5 protein protein.
          Length = 262

 Score = 47.2 bits (107), Expect = 8e-05
 Identities = 25/67 (37%), Positives = 40/67 (59%), Gaps = 2/67 (2%)
 Frame = +2

Query: 71  GLALGDEVPTEENVLVL-SKANFETVITTTEY-ILVEFYAPWCGHCKSLAPEYAKAATKL 244
           G  L +E P  ++V+ L S+ +F  ++   E  +L+ FYAPWC  CK + P + KAAT+L
Sbjct: 140 GPPLWEEDPGAKDVVHLDSEKDFRRLLKKEEKPLLIMFYAPWCSMCKRMMPHFQKAATQL 199

Query: 245 AEEDLLS 265
               +L+
Sbjct: 200 RGHAVLA 206



 Score = 41.1 bits (92), Expect = 0.005
 Identities = 19/49 (38%), Positives = 31/49 (63%), Gaps = 2/49 (4%)
 Frame = +1

Query: 277 VDATQEQDLAESYGVRGYPTLKFFRNGSPI-DYSG-GRQADDIISWLKK 417
           V +++ +++ E Y VRG+PT+ +F  G  +  Y   G  A+DI+ WLKK
Sbjct: 210 VYSSEFENIKEEYSVRGFPTICYFEKGRFLFQYDNYGSTAEDIVEWLKK 258


>BC126168-1|AAI26169.1|  793|Homo sapiens DnaJ (Hsp40) homolog,
           subfamily C, member 10 protein.
          Length = 793

 Score = 39.9 bits (89), Expect = 0.012
 Identities = 13/29 (44%), Positives = 21/29 (72%)
 Frame = +2

Query: 137 ETVITTTEYILVEFYAPWCGHCKSLAPEY 223
           E V+    + +++FYAPWCG C++ APE+
Sbjct: 682 EKVLQGKNHWVIDFYAPWCGPCQNFAPEF 710



 Score = 39.5 bits (88), Expect = 0.016
 Identities = 16/62 (25%), Positives = 29/62 (46%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 441
           +K   +D T  + L   Y ++ YPT   F   +  +Y G   A+ I+ +++    P  V 
Sbjct: 501 LKFGTLDCTVHEGLCNMYNIQAYPTTVVFNQSNIHEYEGHHSAEQILEFIEDLMNPSVVS 560

Query: 442 VT 447
           +T
Sbjct: 561 LT 562



 Score = 39.1 bits (87), Expect = 0.021
 Identities = 14/48 (29%), Positives = 25/48 (52%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +  ++ L +  F+  + + E   V FY+P C HC  LAP +   A ++
Sbjct: 128 DPEIITLERREFDAAVNSGELWFVNFYSPGCSHCHDLAPTWRDFAKEV 175



 Score = 37.5 bits (83), Expect = 0.065
 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 3/49 (6%)
 Frame = +2

Query: 107 NVLVLSKANFETVITT---TEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +V+ L+   F  ++T     E  +V+FY+PWC  C+ L PE+ + A  L
Sbjct: 557 SVVSLTPTTFNELVTQRKHNEVWMVDFYSPWCHPCQVLMPEWKRMARTL 605



 Score = 36.7 bits (81), Expect = 0.11
 Identities = 18/46 (39%), Positives = 25/46 (54%)
 Frame = +2

Query: 107 NVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +V  L   NF       E  LV+F+APWC  C++L PE  +A+  L
Sbjct: 454 HVTTLGPQNFPA--NDKEPWLVDFFAPWCPPCRALLPELRRASNLL 497



 Score = 35.9 bits (79), Expect = 0.20
 Identities = 15/50 (30%), Positives = 29/50 (58%), Gaps = 1/50 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNG-SPIDYSGGRQADDIISW 408
           +++  V+   ++ L    GV  YP+L  FR+G +P+ Y G R  + ++S+
Sbjct: 179 LRIGAVNCGDDRMLCRMKGVNSYPSLFIFRSGMAPVKYHGDRSKESLVSF 228



 Score = 30.3 bits (65), Expect = 9.8
 Identities = 11/32 (34%), Positives = 17/32 (53%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFF 348
           +  +K  KVD        +  G+R YPT+KF+
Sbjct: 718 KGKVKAGKVDCQAYAQTCQKAGIRAYPTVKFY 749


>BC117299-1|AAI17300.1|  793|Homo sapiens DnaJ (Hsp40) homolog,
           subfamily C, member 10 protein.
          Length = 793

 Score = 39.9 bits (89), Expect = 0.012
 Identities = 13/29 (44%), Positives = 21/29 (72%)
 Frame = +2

Query: 137 ETVITTTEYILVEFYAPWCGHCKSLAPEY 223
           E V+    + +++FYAPWCG C++ APE+
Sbjct: 682 EKVLQGKNHWVIDFYAPWCGPCQNFAPEF 710



 Score = 39.5 bits (88), Expect = 0.016
 Identities = 16/62 (25%), Positives = 29/62 (46%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 441
           +K   +D T  + L   Y ++ YPT   F   +  +Y G   A+ I+ +++    P  V 
Sbjct: 501 LKFGTLDCTVHEGLCNMYNIQAYPTTVVFNQSNIHEYEGHHSAEQILEFIEDLMNPSVVS 560

Query: 442 VT 447
           +T
Sbjct: 561 LT 562



 Score = 39.1 bits (87), Expect = 0.021
 Identities = 14/48 (29%), Positives = 25/48 (52%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +  ++ L +  F+  + + E   V FY+P C HC  LAP +   A ++
Sbjct: 128 DPEIITLERREFDAAVNSGELWFVNFYSPGCSHCHDLAPTWRDFAKEV 175



 Score = 37.5 bits (83), Expect = 0.065
 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 3/49 (6%)
 Frame = +2

Query: 107 NVLVLSKANFETVITT---TEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +V+ L+   F  ++T     E  +V+FY+PWC  C+ L PE+ + A  L
Sbjct: 557 SVVSLTPTTFNELVTQRKHNEVWMVDFYSPWCHPCQVLMPEWKRMARTL 605



 Score = 36.7 bits (81), Expect = 0.11
 Identities = 18/46 (39%), Positives = 25/46 (54%)
 Frame = +2

Query: 107 NVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +V  L   NF       E  LV+F+APWC  C++L PE  +A+  L
Sbjct: 454 HVTTLGPQNFPA--NDKEPWLVDFFAPWCPPCRALLPELRRASNLL 497



 Score = 35.9 bits (79), Expect = 0.20
 Identities = 15/50 (30%), Positives = 29/50 (58%), Gaps = 1/50 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNG-SPIDYSGGRQADDIISW 408
           +++  V+   ++ L    GV  YP+L  FR+G +P+ Y G R  + ++S+
Sbjct: 179 LRIGAVNCGDDRMLCRMKGVNSYPSLFIFRSGMAPVKYHGDRSKESLVSF 228



 Score = 30.3 bits (65), Expect = 9.8
 Identities = 11/32 (34%), Positives = 17/32 (53%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFF 348
           +  +K  KVD        +  G+R YPT+KF+
Sbjct: 718 KGKVKAGKVDCQAYAQTCQKAGIRAYPTVKFY 749


>AY358577-1|AAQ88940.1|  747|Homo sapiens disulfide isomerase
           protein.
          Length = 747

 Score = 39.9 bits (89), Expect = 0.012
 Identities = 13/29 (44%), Positives = 21/29 (72%)
 Frame = +2

Query: 137 ETVITTTEYILVEFYAPWCGHCKSLAPEY 223
           E V+    + +++FYAPWCG C++ APE+
Sbjct: 636 EKVLQGKNHWVIDFYAPWCGPCQNFAPEF 664



 Score = 39.5 bits (88), Expect = 0.016
 Identities = 16/62 (25%), Positives = 29/62 (46%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 441
           +K   +D T  + L   Y ++ YPT   F   +  +Y G   A+ I+ +++    P  V 
Sbjct: 455 LKFGTLDCTVHEGLCNMYNIQAYPTTVVFNQSNIHEYEGHHSAEQILEFIEDLMNPSVVS 514

Query: 442 VT 447
           +T
Sbjct: 515 LT 516



 Score = 39.1 bits (87), Expect = 0.021
 Identities = 14/48 (29%), Positives = 25/48 (52%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +  ++ L +  F+  + + E   V FY+P C HC  LAP +   A ++
Sbjct: 128 DPEIITLERREFDAAVNSGELWFVNFYSPGCSHCHDLAPTWRDFAKEV 175



 Score = 37.5 bits (83), Expect = 0.065
 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 3/49 (6%)
 Frame = +2

Query: 107 NVLVLSKANFETVITT---TEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +V+ L+   F  ++T     E  +V+FY+PWC  C+ L PE+ + A  L
Sbjct: 511 SVVSLTPTTFNELVTQRKHNEVWMVDFYSPWCHPCQVLMPEWKRMARTL 559



 Score = 36.7 bits (81), Expect = 0.11
 Identities = 18/46 (39%), Positives = 25/46 (54%)
 Frame = +2

Query: 107 NVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +V  L   NF       E  LV+F+APWC  C++L PE  +A+  L
Sbjct: 408 HVTTLGPQNFPA--NDKEPWLVDFFAPWCPPCRALLPELRRASNLL 451



 Score = 35.9 bits (79), Expect = 0.20
 Identities = 15/50 (30%), Positives = 29/50 (58%), Gaps = 1/50 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNG-SPIDYSGGRQADDIISW 408
           +++  V+   ++ L    GV  YP+L  FR+G +P+ Y G R  + ++S+
Sbjct: 179 LRIGAVNCGDDRMLCRMKGVNSYPSLFIFRSGMAPVKYHGDRSKESLVSF 228



 Score = 30.3 bits (65), Expect = 9.8
 Identities = 11/32 (34%), Positives = 17/32 (53%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFF 348
           +  +K  KVD        +  G+R YPT+KF+
Sbjct: 672 KGKVKAGKVDCQAYAQTCQKAGIRAYPTVKFY 703


>AL832646-1|CAD89982.1|  792|Homo sapiens hypothetical protein
           protein.
          Length = 792

 Score = 39.9 bits (89), Expect = 0.012
 Identities = 13/29 (44%), Positives = 21/29 (72%)
 Frame = +2

Query: 137 ETVITTTEYILVEFYAPWCGHCKSLAPEY 223
           E V+    + +++FYAPWCG C++ APE+
Sbjct: 681 EKVLQGKNHWVIDFYAPWCGPCQNFAPEF 709



 Score = 39.5 bits (88), Expect = 0.016
 Identities = 16/62 (25%), Positives = 29/62 (46%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 441
           +K   +D T  + L   Y ++ YPT   F   +  +Y G   A+ I+ +++    P  V 
Sbjct: 500 LKFGTLDCTVHEGLCNMYNIQAYPTTVVFNQSNIHEYEGHHSAEQILEFIEDLMNPSVVS 559

Query: 442 VT 447
           +T
Sbjct: 560 LT 561



 Score = 39.1 bits (87), Expect = 0.021
 Identities = 14/48 (29%), Positives = 25/48 (52%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +  ++ L +  F+  + + E   V FY+P C HC  LAP +   A ++
Sbjct: 127 DPEIITLERREFDAAVNSGELWFVNFYSPGCSHCHDLAPTWRDFAKEV 174



 Score = 36.7 bits (81), Expect = 0.11
 Identities = 18/46 (39%), Positives = 25/46 (54%)
 Frame = +2

Query: 107 NVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +V  L   NF       E  LV+F+APWC  C++L PE  +A+  L
Sbjct: 453 HVTTLGPQNFPA--NDKEPWLVDFFAPWCPPCRALLPELRRASNLL 496



 Score = 36.7 bits (81), Expect = 0.11
 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 3/49 (6%)
 Frame = +2

Query: 107 NVLVLSKANFETVITT---TEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +V+ L+   F  ++T     E  +V+FY+PWC  C+ L PE+ + A  L
Sbjct: 556 SVVSLTPTAFNELVTQRKHNEVWMVDFYSPWCHPCQVLMPEWKRMARTL 604



 Score = 35.9 bits (79), Expect = 0.20
 Identities = 15/50 (30%), Positives = 29/50 (58%), Gaps = 1/50 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNG-SPIDYSGGRQADDIISW 408
           +++  V+   ++ L    GV  YP+L  FR+G +P+ Y G R  + ++S+
Sbjct: 178 LRIGAVNCGDDRMLCRMKGVNSYPSLFIFRSGMAPVKYHGDRSKESLVSF 227



 Score = 30.3 bits (65), Expect = 9.8
 Identities = 11/32 (34%), Positives = 17/32 (53%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFF 348
           +  +K  KVD        +  G+R YPT+KF+
Sbjct: 717 KGKVKAGKVDCQAYAQTCQKAGIRAYPTVKFY 748


>AL137648-1|CAB70858.1|  464|Homo sapiens hypothetical protein
           protein.
          Length = 464

 Score = 39.9 bits (89), Expect = 0.012
 Identities = 13/29 (44%), Positives = 21/29 (72%)
 Frame = +2

Query: 137 ETVITTTEYILVEFYAPWCGHCKSLAPEY 223
           E V+    + +++FYAPWCG C++ APE+
Sbjct: 353 EKVLQGKNHWVIDFYAPWCGPCQNFAPEF 381



 Score = 39.5 bits (88), Expect = 0.016
 Identities = 16/62 (25%), Positives = 29/62 (46%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 441
           +K   +D T  + L   Y ++ YPT   F   +  +Y G   A+ I+ +++    P  V 
Sbjct: 172 LKFGTLDCTVHEGLCNMYNIQAYPTTVVFNQSNIHEYEGHHSAEQILEFIEDLMNPSVVS 231

Query: 442 VT 447
           +T
Sbjct: 232 LT 233



 Score = 37.5 bits (83), Expect = 0.065
 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 3/49 (6%)
 Frame = +2

Query: 107 NVLVLSKANFETVITT---TEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +V+ L+   F  ++T     E  +V+FY+PWC  C+ L PE+ + A  L
Sbjct: 228 SVVSLTPTTFNELVTQRKHNEVWMVDFYSPWCHPCQVLMPEWKRMARTL 276



 Score = 36.7 bits (81), Expect = 0.11
 Identities = 18/46 (39%), Positives = 25/46 (54%)
 Frame = +2

Query: 107 NVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +V  L   NF       E  LV+F+APWC  C++L PE  +A+  L
Sbjct: 125 HVTTLGPQNFPA--NDKEPWLVDFFAPWCPPCRALLPELRRASNLL 168



 Score = 30.3 bits (65), Expect = 9.8
 Identities = 11/32 (34%), Positives = 17/32 (53%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFF 348
           +  +K  KVD        +  G+R YPT+KF+
Sbjct: 389 KGKVKAGKVDCQAYAQTCQKAGIRAYPTVKFY 420


>AK074905-1|BAC11281.1|  277|Homo sapiens protein ( Homo sapiens
           cDNA FLJ90424 fis, clone NT2RP3000436, highly similar to
           ER-resident protein ERdj5. ).
          Length = 277

 Score = 39.9 bits (89), Expect = 0.012
 Identities = 13/29 (44%), Positives = 21/29 (72%)
 Frame = +2

Query: 137 ETVITTTEYILVEFYAPWCGHCKSLAPEY 223
           E V+    + +++FYAPWCG C++ APE+
Sbjct: 166 EKVLQGKNHWVIDFYAPWCGPCQNFAPEF 194



 Score = 37.5 bits (83), Expect = 0.065
 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 3/49 (6%)
 Frame = +2

Query: 107 NVLVLSKANFETVITT---TEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +V+ L+   F  ++T     E  +V+FY+PWC  C+ L PE+ + A  L
Sbjct: 41  SVVSLTPTTFNELVTQRKHNEVWMVDFYSPWCHPCQVLMPEWKRMARTL 89



 Score = 31.5 bits (68), Expect = 4.2
 Identities = 12/45 (26%), Positives = 22/45 (48%)
 Frame = +1

Query: 313 YGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVT 447
           Y ++ YPT   F   +  +Y G   A+ I+ +++    P  V +T
Sbjct: 2   YNIQAYPTTVVFNQSNIHEYEGHHSAEQILEFIEDLMNPSVVSLT 46



 Score = 30.3 bits (65), Expect = 9.8
 Identities = 11/32 (34%), Positives = 17/32 (53%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFF 348
           +  +K  KVD        +  G+R YPT+KF+
Sbjct: 202 KGKVKAGKVDCQAYAQTCQKAGIRAYPTVKFY 233


>AK027696-1|BAB55304.1|  793|Homo sapiens protein ( Homo sapiens
           cDNA FLJ14790 fis, clone NT2RP4000973, weakly similar to
           PROBABLE PROTEIN DISULFIDE ISOMERASE P5 PRECURSOR (EC
           5.3.4.1). ).
          Length = 793

 Score = 39.9 bits (89), Expect = 0.012
 Identities = 13/29 (44%), Positives = 21/29 (72%)
 Frame = +2

Query: 137 ETVITTTEYILVEFYAPWCGHCKSLAPEY 223
           E V+    + +++FYAPWCG C++ APE+
Sbjct: 682 EKVLQGKNHWVIDFYAPWCGPCQNFAPEF 710



 Score = 39.5 bits (88), Expect = 0.016
 Identities = 16/62 (25%), Positives = 29/62 (46%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 441
           +K   +D T  + L   Y ++ YPT   F   +  +Y G   A+ I+ +++    P  V 
Sbjct: 501 LKFGTLDCTVHEGLCNMYNIQAYPTTVVFNQSNIHEYEGHHSAEQILEFIEDLMNPSVVS 560

Query: 442 VT 447
           +T
Sbjct: 561 LT 562



 Score = 39.1 bits (87), Expect = 0.021
 Identities = 14/48 (29%), Positives = 25/48 (52%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +  ++ L +  F+  + + E   V FY+P C HC  LAP +   A ++
Sbjct: 128 DPEIITLERREFDAAVNSGELWFVNFYSPGCSHCHDLAPTWRDFAKEV 175



 Score = 37.5 bits (83), Expect = 0.065
 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 3/49 (6%)
 Frame = +2

Query: 107 NVLVLSKANFETVITT---TEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +V+ L+   F  ++T     E  +V+FY+PWC  C+ L PE+ + A  L
Sbjct: 557 SVVSLTPTTFNELVTQRKHNEVWMVDFYSPWCHPCQVLMPEWKRMARTL 605



 Score = 36.7 bits (81), Expect = 0.11
 Identities = 18/46 (39%), Positives = 25/46 (54%)
 Frame = +2

Query: 107 NVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +V  L   NF       E  LV+F+APWC  C++L PE  +A+  L
Sbjct: 454 HVTTLGPQNFPA--NDKEPWLVDFFAPWCPPCRALLPELRRASNLL 497



 Score = 35.9 bits (79), Expect = 0.20
 Identities = 15/50 (30%), Positives = 29/50 (58%), Gaps = 1/50 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNG-SPIDYSGGRQADDIISW 408
           +++  V+   ++ L    GV  YP+L  FR+G +P+ Y G R  + ++S+
Sbjct: 179 LRIGAVNCGDDRMLCRMKGVNSYPSLFIFRSGMAPVKYHGDRSKESLVSF 228



 Score = 30.3 bits (65), Expect = 9.8
 Identities = 11/32 (34%), Positives = 17/32 (53%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFF 348
           +  +K  KVD        +  G+R YPT+KF+
Sbjct: 718 KGKVKAGKVDCQAYAQTCQKAGIRAYPTVKFY 749


>AK027647-1|BAB55263.1|  793|Homo sapiens protein ( Homo sapiens
           cDNA FLJ14741 fis, clone NT2RP3002628, weakly similar to
           PROBABLE PROTEIN DISULFIDE ISOMERASE P5 PRECURSOR (EC
           5.3.4.1). ).
          Length = 793

 Score = 39.9 bits (89), Expect = 0.012
 Identities = 13/29 (44%), Positives = 21/29 (72%)
 Frame = +2

Query: 137 ETVITTTEYILVEFYAPWCGHCKSLAPEY 223
           E V+    + +++FYAPWCG C++ APE+
Sbjct: 682 EKVLQGKNHWVIDFYAPWCGPCQNFAPEF 710



 Score = 39.5 bits (88), Expect = 0.016
 Identities = 16/62 (25%), Positives = 29/62 (46%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 441
           +K   +D T  + L   Y ++ YPT   F   +  +Y G   A+ I+ +++    P  V 
Sbjct: 501 LKFGTLDCTVHEGLCNMYNIQAYPTTVVFNQSNIHEYEGHHSAEQILEFIEDLMNPSVVS 560

Query: 442 VT 447
           +T
Sbjct: 561 LT 562



 Score = 39.1 bits (87), Expect = 0.021
 Identities = 14/48 (29%), Positives = 25/48 (52%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +  ++ L +  F+  + + E   V FY+P C HC  LAP +   A ++
Sbjct: 128 DPEIITLERREFDAAVNSGELWFVNFYSPGCSHCHDLAPTWRDFAKEV 175



 Score = 37.5 bits (83), Expect = 0.065
 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 3/49 (6%)
 Frame = +2

Query: 107 NVLVLSKANFETVITT---TEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +V+ L+   F  ++T     E  +V+FY+PWC  C+ L PE+ + A  L
Sbjct: 557 SVVSLTPTTFNELVTQRKHNEVWMVDFYSPWCHPCQVLMPEWKRMARTL 605



 Score = 36.7 bits (81), Expect = 0.11
 Identities = 18/46 (39%), Positives = 25/46 (54%)
 Frame = +2

Query: 107 NVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +V  L   NF       E  LV+F+APWC  C++L PE  +A+  L
Sbjct: 454 HVTTLGPQNFPA--NDKEPWLVDFFAPWCPPCRALLPELRRASNLL 497



 Score = 35.9 bits (79), Expect = 0.20
 Identities = 15/50 (30%), Positives = 29/50 (58%), Gaps = 1/50 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNG-SPIDYSGGRQADDIISW 408
           +++  V+   ++ L    GV  YP+L  FR+G +P+ Y G R  + ++S+
Sbjct: 179 LRIGAVNCGDDRMLCRMKGVNSYPSLFIFRSGMAPVKYHGDRSKESLVSF 228



 Score = 30.3 bits (65), Expect = 9.8
 Identities = 11/32 (34%), Positives = 17/32 (53%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFF 348
           +  +K  KVD        +  G+R YPT+KF+
Sbjct: 718 KGKVKAGKVDCQAYAQTCQKAGIRAYPTVKFY 749


>AK027450-1|BAB55121.1|  768|Homo sapiens protein ( Homo sapiens
           cDNA FLJ14544 fis, clone NT2RM2001547, weakly similar to
           PROBABLE PROTEIN DISULFIDE ISOMERASE P5 PRECURSOR (EC
           5.3.4.1). ).
          Length = 768

 Score = 39.9 bits (89), Expect = 0.012
 Identities = 13/29 (44%), Positives = 21/29 (72%)
 Frame = +2

Query: 137 ETVITTTEYILVEFYAPWCGHCKSLAPEY 223
           E V+    + +++FYAPWCG C++ APE+
Sbjct: 657 EKVLQGKNHWVIDFYAPWCGPCQNFAPEF 685



 Score = 39.5 bits (88), Expect = 0.016
 Identities = 16/62 (25%), Positives = 29/62 (46%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 441
           +K   +D T  + L   Y ++ YPT   F   +  +Y G   A+ I+ +++    P  V 
Sbjct: 476 LKFGTLDCTVHEGLCNMYNIQAYPTTVVFNQSNIHEYEGHHSAEQILEFIEDLMNPSVVS 535

Query: 442 VT 447
           +T
Sbjct: 536 LT 537



 Score = 39.1 bits (87), Expect = 0.021
 Identities = 14/48 (29%), Positives = 25/48 (52%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +  ++ L +  F+  + + E   V FY+P C HC  LAP +   A ++
Sbjct: 103 DPEIITLERREFDAAVNSGELWFVNFYSPGCSHCHDLAPTWRDFAKEV 150



 Score = 37.5 bits (83), Expect = 0.065
 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 3/49 (6%)
 Frame = +2

Query: 107 NVLVLSKANFETVITT---TEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +V+ L+   F  ++T     E  +V+FY+PWC  C+ L PE+ + A  L
Sbjct: 532 SVVSLTPTTFNELVTQRKHNEVWMVDFYSPWCHPCQVLMPEWKRMARTL 580



 Score = 36.7 bits (81), Expect = 0.11
 Identities = 18/46 (39%), Positives = 25/46 (54%)
 Frame = +2

Query: 107 NVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +V  L   NF       E  LV+F+APWC  C++L PE  +A+  L
Sbjct: 429 HVTTLGPQNFPA--NDKEPWLVDFFAPWCPPCRALLPELRRASNLL 472



 Score = 35.9 bits (79), Expect = 0.20
 Identities = 15/50 (30%), Positives = 29/50 (58%), Gaps = 1/50 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNG-SPIDYSGGRQADDIISW 408
           +++  V+   ++ L    GV  YP+L  FR+G +P+ Y G R  + ++S+
Sbjct: 154 LRIGAVNCGDDRMLCRMKGVNSYPSLFIFRSGMAPVKYHGDRSKESLVSF 203



 Score = 30.3 bits (65), Expect = 9.8
 Identities = 11/32 (34%), Positives = 17/32 (53%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFF 348
           +  +K  KVD        +  G+R YPT+KF+
Sbjct: 693 KGKVKAGKVDCQAYAQTCQKAGIRAYPTVKFY 724


>AF490904-1|AAM09527.1|  747|Homo sapiens macrothioredoxin protein.
          Length = 747

 Score = 39.9 bits (89), Expect = 0.012
 Identities = 13/29 (44%), Positives = 21/29 (72%)
 Frame = +2

Query: 137 ETVITTTEYILVEFYAPWCGHCKSLAPEY 223
           E V+    + +++FYAPWCG C++ APE+
Sbjct: 636 EKVLQGKNHWVIDFYAPWCGPCQNFAPEF 664



 Score = 39.5 bits (88), Expect = 0.016
 Identities = 16/62 (25%), Positives = 29/62 (46%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 441
           +K   +D T  + L   Y ++ YPT   F   +  +Y G   A+ I+ +++    P  V 
Sbjct: 455 LKFGTLDCTVHEGLCNMYNIQAYPTTVVFNQSNIHEYEGHHSAEQILEFIEDLMNPSVVS 514

Query: 442 VT 447
           +T
Sbjct: 515 LT 516



 Score = 39.1 bits (87), Expect = 0.021
 Identities = 14/48 (29%), Positives = 25/48 (52%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +  ++ L +  F+  + + E   V FY+P C HC  LAP +   A ++
Sbjct: 128 DPEIITLERREFDAAVNSGELWFVNFYSPGCSHCHDLAPTWRDFAKEV 175



 Score = 37.5 bits (83), Expect = 0.065
 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 3/49 (6%)
 Frame = +2

Query: 107 NVLVLSKANFETVITT---TEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +V+ L+   F  ++T     E  +V+FY+PWC  C+ L PE+ + A  L
Sbjct: 511 SVVSLTPTTFNELVTQRKHNEVWMVDFYSPWCHPCQVLMPEWKRMARTL 559



 Score = 36.7 bits (81), Expect = 0.11
 Identities = 18/46 (39%), Positives = 25/46 (54%)
 Frame = +2

Query: 107 NVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +V  L   NF       E  LV+F+APWC  C++L PE  +A+  L
Sbjct: 408 HVTTLGPQNFPA--NDKEPWLVDFFAPWCPPCRALLPELRRASNLL 451



 Score = 35.9 bits (79), Expect = 0.20
 Identities = 15/50 (30%), Positives = 29/50 (58%), Gaps = 1/50 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNG-SPIDYSGGRQADDIISW 408
           +++  V+   ++ L    GV  YP+L  FR+G +P+ Y G R  + ++S+
Sbjct: 179 LRIGAVNCGDDRMLCRMKGVNSYPSLFIFRSGMAPVKYHGDRSKESLVSF 228



 Score = 30.3 bits (65), Expect = 9.8
 Identities = 11/32 (34%), Positives = 17/32 (53%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFF 348
           +  +K  KVD        +  G+R YPT+KF+
Sbjct: 672 KGKVKAGKVDCQAYAQTCQKAGIRAYPTVKFY 703


>AF038503-1|AAN73271.1|  793|Homo sapiens ER-resident protein ERdj5
           protein.
          Length = 793

 Score = 39.9 bits (89), Expect = 0.012
 Identities = 13/29 (44%), Positives = 21/29 (72%)
 Frame = +2

Query: 137 ETVITTTEYILVEFYAPWCGHCKSLAPEY 223
           E V+    + +++FYAPWCG C++ APE+
Sbjct: 682 EKVLQGKNHWVIDFYAPWCGPCQNFAPEF 710



 Score = 39.5 bits (88), Expect = 0.016
 Identities = 16/62 (25%), Positives = 29/62 (46%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 441
           +K   +D T  + L   Y ++ YPT   F   +  +Y G   A+ I+ +++    P  V 
Sbjct: 501 LKFGTLDCTVHEGLCNMYNIQAYPTTVVFNQSNIHEYEGHHSAEQILEFIEDLMNPSVVS 560

Query: 442 VT 447
           +T
Sbjct: 561 LT 562



 Score = 39.1 bits (87), Expect = 0.021
 Identities = 14/48 (29%), Positives = 25/48 (52%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +  ++ L +  F+  + + E   V FY+P C HC  LAP +   A ++
Sbjct: 128 DPEIITLERREFDAAVNSGELWFVNFYSPGCSHCHDLAPTWRDFAKEV 175



 Score = 37.5 bits (83), Expect = 0.065
 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 3/49 (6%)
 Frame = +2

Query: 107 NVLVLSKANFETVITT---TEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +V+ L+   F  ++T     E  +V+FY+PWC  C+ L PE+ + A  L
Sbjct: 557 SVVSLTPTTFNELVTQRKHNEVWMVDFYSPWCHPCQVLMPEWKRMARTL 605



 Score = 36.7 bits (81), Expect = 0.11
 Identities = 18/46 (39%), Positives = 25/46 (54%)
 Frame = +2

Query: 107 NVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +V  L   NF       E  LV+F+APWC  C++L PE  +A+  L
Sbjct: 454 HVTTLGPQNFPA--NDKEPWLVDFFAPWCPPCRALLPELRRASNLL 497



 Score = 32.7 bits (71), Expect = 1.8
 Identities = 14/50 (28%), Positives = 28/50 (56%), Gaps = 1/50 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNG-SPIDYSGGRQADDIISW 408
           +++  V+   ++ L    GV  YP+L  FR+G + + Y G R  + ++S+
Sbjct: 179 LRIGAVNCGDDRMLCRMKGVNSYPSLFIFRSGMAAVKYHGDRSKESLVSF 228



 Score = 30.3 bits (65), Expect = 9.8
 Identities = 11/32 (34%), Positives = 17/32 (53%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFF 348
           +  +K  KVD        +  G+R YPT+KF+
Sbjct: 718 KGKVKAGKVDCQAYAQTCQKAGIRAYPTVKFY 749


>AC105396-1|AAY24240.1|  464|Homo sapiens unknown protein.
          Length = 464

 Score = 39.9 bits (89), Expect = 0.012
 Identities = 13/29 (44%), Positives = 21/29 (72%)
 Frame = +2

Query: 137 ETVITTTEYILVEFYAPWCGHCKSLAPEY 223
           E V+    + +++FYAPWCG C++ APE+
Sbjct: 353 EKVLQGKNHWVIDFYAPWCGPCQNFAPEF 381



 Score = 39.5 bits (88), Expect = 0.016
 Identities = 16/62 (25%), Positives = 29/62 (46%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 441
           +K   +D T  + L   Y ++ YPT   F   +  +Y G   A+ I+ +++    P  V 
Sbjct: 172 LKFGTLDCTVHEGLCNMYNIQAYPTTVVFNQSNIHEYEGHHSAEQILEFIEDLMNPSVVS 231

Query: 442 VT 447
           +T
Sbjct: 232 LT 233



 Score = 37.5 bits (83), Expect = 0.065
 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 3/49 (6%)
 Frame = +2

Query: 107 NVLVLSKANFETVITT---TEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +V+ L+   F  ++T     E  +V+FY+PWC  C+ L PE+ + A  L
Sbjct: 228 SVVSLTPTTFNELVTQRKHNEVWMVDFYSPWCHPCQVLMPEWKRMARTL 276



 Score = 36.7 bits (81), Expect = 0.11
 Identities = 18/46 (39%), Positives = 25/46 (54%)
 Frame = +2

Query: 107 NVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +V  L   NF       E  LV+F+APWC  C++L PE  +A+  L
Sbjct: 125 HVTTLGPQNFPA--NDKEPWLVDFFAPWCPPCRALLPELRRASNLL 168



 Score = 30.3 bits (65), Expect = 9.8
 Identities = 11/32 (34%), Positives = 17/32 (53%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFF 348
           +  +K  KVD        +  G+R YPT+KF+
Sbjct: 389 KGKVKAGKVDCQAYAQTCQKAGIRAYPTVKFY 420


>BC107425-1|AAI07426.1|  332|Homo sapiens DNAJC10 protein protein.
          Length = 332

 Score = 39.1 bits (87), Expect = 0.021
 Identities = 14/48 (29%), Positives = 25/48 (52%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +  ++ L +  F+  + + E   V FY+P C HC  LAP +   A ++
Sbjct: 128 DPEIITLERREFDAAVNSGELWFVNFYSPGCSHCHDLAPTWRDFAKEV 175



 Score = 35.9 bits (79), Expect = 0.20
 Identities = 15/50 (30%), Positives = 29/50 (58%), Gaps = 1/50 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNG-SPIDYSGGRQADDIISW 408
           +++  V+   ++ L    GV  YP+L  FR+G +P+ Y G R  + ++S+
Sbjct: 179 LRIGAVNCGDDRMLCRMKGVNSYPSLFIFRSGMAPVKYHGDRSKESLVSF 228


>AY089971-1|AAM09954.1|  275|Homo sapiens macrothioredoxin isoform 1
           protein.
          Length = 275

 Score = 39.1 bits (87), Expect = 0.021
 Identities = 14/48 (29%), Positives = 25/48 (52%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +  ++ L +  F+  + + E   V FY+P C HC  LAP +   A ++
Sbjct: 128 DPEIITLERREFDAAVNSGELWFVNFYSPGCSHCHDLAPTWRDFAKEV 175



 Score = 35.9 bits (79), Expect = 0.20
 Identities = 15/50 (30%), Positives = 29/50 (58%), Gaps = 1/50 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNG-SPIDYSGGRQADDIISW 408
           +++  V+   ++ L    GV  YP+L  FR+G +P+ Y G R  + ++S+
Sbjct: 179 LRIGAVNCGDDRMLCRMKGVNSYPSLFIFRSGMAPVKYHGDRSKESLVSF 228


>AY010234-1|AAG32626.1|  332|Homo sapiens endoplasmic reticulum
           DnaJ/PDI fusion protein 3 precursor protein.
          Length = 332

 Score = 39.1 bits (87), Expect = 0.021
 Identities = 14/48 (29%), Positives = 25/48 (52%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +  ++ L +  F+  + + E   V FY+P C HC  LAP +   A ++
Sbjct: 128 DPEIITLERREFDAAVNSGELWFVNFYSPGCSHCHDLAPTWRDFAKEV 175



 Score = 35.9 bits (79), Expect = 0.20
 Identities = 15/50 (30%), Positives = 29/50 (58%), Gaps = 1/50 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNG-SPIDYSGGRQADDIISW 408
           +++  V+   ++ L    GV  YP+L  FR+G +P+ Y G R  + ++S+
Sbjct: 179 LRIGAVNCGDDRMLCRMKGVNSYPSLFIFRSGMAPVKYHGDRSKESLVSF 228


>AC073951-1|AAX88931.1|  329|Homo sapiens unknown protein.
          Length = 329

 Score = 39.1 bits (87), Expect = 0.021
 Identities = 14/48 (29%), Positives = 25/48 (52%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +  ++ L +  F+  + + E   V FY+P C HC  LAP +   A ++
Sbjct: 128 DPEIITLERREFDAAVNSGELWFVNFYSPGCSHCHDLAPTWRDFAKEV 175



 Score = 35.9 bits (79), Expect = 0.20
 Identities = 15/50 (30%), Positives = 29/50 (58%), Gaps = 1/50 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNG-SPIDYSGGRQADDIISW 408
           +++  V+   ++ L    GV  YP+L  FR+G +P+ Y G R  + ++S+
Sbjct: 179 LRIGAVNCGDDRMLCRMKGVNSYPSLFIFRSGMAPVKYHGDRSKESLVSF 228


>AF314529-1|AAQ14565.1|  177|Homo sapiens endoplasmic reticulum
           DnaJ-PDI fusion protein 2 precursor protein.
          Length = 177

 Score = 38.7 bits (86), Expect = 0.028
 Identities = 13/41 (31%), Positives = 22/41 (53%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEY 223
           +  ++ L +  F+  + + E   V FY+P C HC  LAP +
Sbjct: 128 DPEIITLERREFDAAVNSGELWFVNFYSPGCSHCHDLAPTW 168


>U78678-1|AAB41631.1|  166|Homo sapiens thioredoxin protein.
          Length = 166

 Score = 37.9 bits (84), Expect = 0.049
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 1/56 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTG 426
           + +AKVD     DLA  Y V   PT+   +NG  +D + G +  D + ++LKK  G
Sbjct: 111 VVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG 166



 Score = 35.9 bits (79), Expect = 0.20
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = +2

Query: 137 ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATK 241
           + V+ +   ++V+F+A WCG CK L P   K   K
Sbjct: 72  DRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAK 106


>CR541917-1|CAG46715.1|  166|Homo sapiens TXN2 protein.
          Length = 166

 Score = 37.9 bits (84), Expect = 0.049
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 1/56 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTG 426
           + +AKVD     DLA  Y V   PT+   +NG  +D + G +  D + ++LKK  G
Sbjct: 111 VVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG 166



 Score = 35.9 bits (79), Expect = 0.20
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = +2

Query: 137 ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATK 241
           + V+ +   ++V+F+A WCG CK L P   K   K
Sbjct: 72  DRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAK 106


>CR541896-1|CAG46694.1|  166|Homo sapiens TXN2 protein.
          Length = 166

 Score = 37.9 bits (84), Expect = 0.049
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 1/56 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTG 426
           + +AKVD     DLA  Y V   PT+   +NG  +D + G +  D + ++LKK  G
Sbjct: 111 VVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG 166



 Score = 35.9 bits (79), Expect = 0.20
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = +2

Query: 137 ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATK 241
           + V+ +   ++V+F+A WCG CK L P   K   K
Sbjct: 72  DRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAK 106


>CR456601-1|CAG30487.1|  166|Homo sapiens TXN2 protein.
          Length = 166

 Score = 37.9 bits (84), Expect = 0.049
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 1/56 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTG 426
           + +AKVD     DLA  Y V   PT+   +NG  +D + G +  D + ++LKK  G
Sbjct: 111 VVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG 166



 Score = 35.9 bits (79), Expect = 0.20
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = +2

Query: 137 ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATK 241
           + V+ +   ++V+F+A WCG CK L P   K   K
Sbjct: 72  DRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAK 106


>BC050610-1|AAH50610.1|  166|Homo sapiens thioredoxin 2 protein.
          Length = 166

 Score = 37.9 bits (84), Expect = 0.049
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 1/56 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTG 426
           + +AKVD     DLA  Y V   PT+   +NG  +D + G +  D + ++LKK  G
Sbjct: 111 VVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG 166



 Score = 35.9 bits (79), Expect = 0.20
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = +2

Query: 137 ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATK 241
           + V+ +   ++V+F+A WCG CK L P   K   K
Sbjct: 72  DRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAK 106


>BC013726-1|AAH13726.1|  166|Homo sapiens thioredoxin 2 protein.
          Length = 166

 Score = 37.9 bits (84), Expect = 0.049
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 1/56 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTG 426
           + +AKVD     DLA  Y V   PT+   +NG  +D + G +  D + ++LKK  G
Sbjct: 111 VVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG 166



 Score = 35.9 bits (79), Expect = 0.20
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = +2

Query: 137 ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATK 241
           + V+ +   ++V+F+A WCG CK L P   K   K
Sbjct: 72  DRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAK 106


>AL022313-1|CAI19226.1|  197|Homo sapiens thioredoxin 2 protein.
          Length = 197

 Score = 37.9 bits (84), Expect = 0.049
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 1/56 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTG 426
           + +AKVD     DLA  Y V   PT+   +NG  +D + G +  D + ++LKK  G
Sbjct: 142 VVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG 197



 Score = 35.9 bits (79), Expect = 0.20
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = +2

Query: 137 ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATK 241
           + V+ +   ++V+F+A WCG CK L P   K   K
Sbjct: 103 DRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAK 137


>AF480262-1|AAN05576.1|  166|Homo sapiens mitochondrial thioredoxin
           protein.
          Length = 166

 Score = 37.9 bits (84), Expect = 0.049
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 1/56 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTG 426
           + +AKVD     DLA  Y V   PT+   +NG  +D + G +  D + ++LKK  G
Sbjct: 111 VVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG 166



 Score = 35.9 bits (79), Expect = 0.20
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = +2

Query: 137 ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATK 241
           + V+ +   ++V+F+A WCG CK L P   K   K
Sbjct: 72  DRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAK 106


>AF276920-1|AAF86467.1|  166|Homo sapiens thioredoxin 2 protein.
          Length = 166

 Score = 37.9 bits (84), Expect = 0.049
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 1/56 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTG 426
           + +AKVD     DLA  Y V   PT+   +NG  +D + G +  D + ++LKK  G
Sbjct: 111 VVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG 166



 Score = 35.9 bits (79), Expect = 0.20
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = +2

Query: 137 ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATK 241
           + V+ +   ++V+F+A WCG CK L P   K   K
Sbjct: 72  DRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAK 106


>BC142650-1|AAI42651.1|  825|Homo sapiens KIAA1344 protein.
          Length = 825

 Score = 37.5 bits (83), Expect = 0.065
 Identities = 16/74 (21%), Positives = 39/74 (52%), Gaps = 1/74 (1%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNG-SPIDYSGGRQADDIISWLKKKTGPP 432
           S + L +++     D+     V  +P +K ++ G +P+ Y+G    +D++ +++      
Sbjct: 440 STMLLTRINCADWSDVCTKQNVTEFPIIKMYKKGENPVSYAGMLGTEDLLKFIQLNRISY 499

Query: 433 AVEVTSAEQAKELI 474
            V +TS ++A+E +
Sbjct: 500 PVNITSIQEAEEYL 513


>CR457152-1|CAG33433.1|  330|Homo sapiens LOC51061 protein.
          Length = 330

 Score = 36.7 bits (81), Expect = 0.11
 Identities = 15/52 (28%), Positives = 28/52 (53%)
 Frame = +2

Query: 89  EVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           + P++  +  ++   F  V+   + +L+ +YAPWCG C SL   + + A  L
Sbjct: 30  QFPSQHLITEVTTDTFWEVVLQKQDVLLLYYAPWCGFCPSLNHIFIQLARNL 81


>BC056874-1|AAH56874.2|  280|Homo sapiens thioredoxin domain
           containing 1 protein.
          Length = 280

 Score = 36.7 bits (81), Expect = 0.11
 Identities = 16/43 (37%), Positives = 26/43 (60%)
 Frame = +2

Query: 107 NVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 235
           NV V++  N+  ++      ++EFYAPWC  C++L PE+   A
Sbjct: 30  NVRVITDENWRELLEGDW--MIEFYAPWCPACQNLQPEWESFA 70



 Score = 33.5 bits (73), Expect = 1.1
 Identities = 15/53 (28%), Positives = 28/53 (52%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKK 420
           + +AKVD T++  L+  + +   PT+   ++G    Y G R   D I+++  K
Sbjct: 78  VNIAKVDVTEQPGLSGRFIITALPTIYHCKDGEFRRYQGPRTKKDFINFISDK 130


>BC036460-1|AAH36460.1|  280|Homo sapiens thioredoxin domain
           containing 1 protein.
          Length = 280

 Score = 36.7 bits (81), Expect = 0.11
 Identities = 16/43 (37%), Positives = 26/43 (60%)
 Frame = +2

Query: 107 NVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 235
           NV V++  N+  ++      ++EFYAPWC  C++L PE+   A
Sbjct: 30  NVRVITDENWRELLEGDW--MIEFYAPWCPACQNLQPEWESFA 70



 Score = 33.9 bits (74), Expect = 0.80
 Identities = 15/53 (28%), Positives = 28/53 (52%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKK 420
           + +AKVD T++  L+  + +   PT+   ++G    Y G R   D I+++  K
Sbjct: 78  VNIAKVDVTEQPGLSGRFIINALPTIYHCKDGEFRRYQGPRTKKDFINFISDK 130


>BC018635-1|AAH18635.1|  278|Homo sapiens TXNDC11 protein protein.
          Length = 278

 Score = 36.7 bits (81), Expect = 0.11
 Identities = 16/41 (39%), Positives = 26/41 (63%)
 Frame = +2

Query: 137 ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDL 259
           E V   +E +L+ FYAPWCG   +   E  +AA++L+++ L
Sbjct: 119 EYVRRDSEVVLLFFYAPWCGQSIAARAEIEQAASRLSDQVL 159


>BC013727-1|AAH13727.1|  330|Homo sapiens TXNDC11 protein protein.
          Length = 330

 Score = 36.7 bits (81), Expect = 0.11
 Identities = 15/52 (28%), Positives = 28/52 (53%)
 Frame = +2

Query: 89  EVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           + P++  +  ++   F  V+   + +L+ +YAPWCG C SL   + + A  L
Sbjct: 30  QFPSQHLITEVTTDTFWEVVLQKQDVLLLYYAPWCGFCPSLNHIFIQLARNL 81


>BC002856-1|AAH02856.1|  985|Homo sapiens TXNDC11 protein protein.
          Length = 985

 Score = 36.7 bits (81), Expect = 0.11
 Identities = 16/41 (39%), Positives = 26/41 (63%)
 Frame = +2

Query: 137 ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDL 259
           E V   +E +L+ FYAPWCG   +   E  +AA++L+++ L
Sbjct: 119 EYVRRDSEVVLLFFYAPWCGQSIAARAEIEQAASRLSDQVL 159



 Score = 36.7 bits (81), Expect = 0.11
 Identities = 15/52 (28%), Positives = 28/52 (53%)
 Frame = +2

Query: 89  EVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           + P++  +  ++   F  V+   + +L+ +YAPWCG C SL   + + A  L
Sbjct: 685 QFPSQHLITEVTTDTFWEVVLQKQDVLLLYYAPWCGFCPSLNHIFIQLARNL 736


>AY358640-1|AAQ89003.1|  280|Homo sapiens TXNDC protein.
          Length = 280

 Score = 36.7 bits (81), Expect = 0.11
 Identities = 16/43 (37%), Positives = 26/43 (60%)
 Frame = +2

Query: 107 NVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 235
           NV V++  N+  ++      ++EFYAPWC  C++L PE+   A
Sbjct: 30  NVRVITDENWRELLEGDW--MIEFYAPWCPACQNLQPEWESFA 70



 Score = 33.5 bits (73), Expect = 1.1
 Identities = 15/53 (28%), Positives = 28/53 (52%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKK 420
           + +AKVD T++  L+  + +   PT+   ++G    Y G R   D I+++  K
Sbjct: 78  VNIAKVDVTEQPGLSGRFIITALPTIYHCKDGEFRRYQGPRTKKDFINFISDK 130


>AK075395-1|BAC11593.1|  280|Homo sapiens protein ( Homo sapiens
           cDNA PSEC0085 fis, clone NT2RP2006476, highly similar to
           Thioredoxin domain containing protein. ).
          Length = 280

 Score = 36.7 bits (81), Expect = 0.11
 Identities = 16/43 (37%), Positives = 26/43 (60%)
 Frame = +2

Query: 107 NVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 235
           NV V++  N+  ++      ++EFYAPWC  C++L PE+   A
Sbjct: 30  NVRVITDENWRELLEGDW--MIEFYAPWCPACQNLQPEWESFA 70



 Score = 33.5 bits (73), Expect = 1.1
 Identities = 15/53 (28%), Positives = 28/53 (52%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKK 420
           + +AKVD T++  L+  + +   PT+   ++G    Y G R   D I+++  K
Sbjct: 78  VNIAKVDVTEQPGLSGRFIITALPTIYHCKDGEFRRYQGPRTKKDFINFISDK 130


>AK027646-1|BAB55262.1|  958|Homo sapiens protein ( Homo sapiens
           cDNA FLJ14740 fis, clone NT2RP3002602, weakly similar to
           PROBABLE PROTEIN DISULFIDE ISOMERASE ER-60 PRECURSOR (EC
           5.3.4.1). ).
          Length = 958

 Score = 36.7 bits (81), Expect = 0.11
 Identities = 16/41 (39%), Positives = 26/41 (63%)
 Frame = +2

Query: 137 ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDL 259
           E V   +E +L+ FYAPWCG   +   E  +AA++L+++ L
Sbjct: 119 EYVRRDSEVVLLFFYAPWCGQSIAARAEIEQAASRLSDQVL 159



 Score = 36.7 bits (81), Expect = 0.11
 Identities = 15/52 (28%), Positives = 28/52 (53%)
 Frame = +2

Query: 89  EVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           + P++  +  ++   F  V+   + +L+ +YAPWCG C SL   + + A  L
Sbjct: 658 QFPSQHLITEVTTDTFWEVVLQKQDVLLLYYAPWCGFCPSLNHIFIQLARNL 709


>AK027464-1|BAB55129.1|  506|Homo sapiens protein ( Homo sapiens
           cDNA FLJ14558 fis, clone NT2RM2001997, weakly similar to
           PROTEIN DISULFIDE ISOMERASE PRECURSOR (EC 5.3.4.1). ).
          Length = 506

 Score = 36.7 bits (81), Expect = 0.11
 Identities = 15/52 (28%), Positives = 28/52 (53%)
 Frame = +2

Query: 89  EVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           + P++  +  ++   F  V+   + +L+ +YAPWCG C SL   + + A  L
Sbjct: 206 QFPSQHLITEVTTDTFWEVVLQKQDVLLLYYAPWCGFCPSLNHIFIQLARNL 257


>AF131780-1|AAD20043.1|  330|Homo sapiens Unknown protein.
          Length = 330

 Score = 36.7 bits (81), Expect = 0.11
 Identities = 15/52 (28%), Positives = 28/52 (53%)
 Frame = +2

Query: 89  EVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           + P++  +  ++   F  V+   + +L+ +YAPWCG C SL   + + A  L
Sbjct: 30  QFPSQHLITEVTTDTFWEVVLQKQDVLLLYYAPWCGFCPSLNHIFIQLARNL 81


>AB048246-1|BAB20629.1|  280|Homo sapiens thioredoxin-related
           transmembrane protein protein.
          Length = 280

 Score = 36.7 bits (81), Expect = 0.11
 Identities = 16/43 (37%), Positives = 26/43 (60%)
 Frame = +2

Query: 107 NVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 235
           NV V++  N+  ++      ++EFYAPWC  C++L PE+   A
Sbjct: 30  NVRVITDENWRELLEGDW--MIEFYAPWCPACQNLQPEWESFA 70



 Score = 33.5 bits (73), Expect = 1.1
 Identities = 15/53 (28%), Positives = 28/53 (52%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKK 420
           + +AKVD T++  L+  + +   PT+   ++G    Y G R   D I+++  K
Sbjct: 78  VNIAKVDVTEQPGLSGRFIITALPTIYHCKDGEFRRYQGPRTKKDFINFISDK 130


>BC150205-1|AAI50206.1|  825|Homo sapiens KIAA1344 protein.
          Length = 825

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 16/74 (21%), Positives = 38/74 (51%), Gaps = 1/74 (1%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNG-SPIDYSGGRQADDIISWLKKKTGPP 432
           S + L +++     D+     V  +P +K ++ G +P+ Y+G     D++ +++      
Sbjct: 440 STMLLTRINCADWSDVCTKQNVTEFPIIKMYKKGENPVSYAGMLGTKDLLKFIQLNRISY 499

Query: 433 AVEVTSAEQAKELI 474
            V +TS ++A+E +
Sbjct: 500 PVNITSIQEAEEYL 513


>AJ318051-1|CAC85331.1|  698|Homo sapiens putative sulfhydryl
           oxidase precursor protein.
          Length = 698

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 22/71 (30%), Positives = 32/71 (45%), Gaps = 5/71 (7%)
 Frame = +2

Query: 38  RVLIFTAIALLGLALGDEVPT----EENVLVLSKANFETVITTTEYI-LVEFYAPWCGHC 202
           R+L+  A A +G   G         E+ V VL   +       +    LV+FY+ WCGHC
Sbjct: 35  RLLVLLAAAAVGPGAGGAARLYRAGEDAVWVLDSGSVRGATANSSAAWLVQFYSSWCGHC 94

Query: 203 KSLAPEYAKAA 235
            + AP +   A
Sbjct: 95  IAYAPTWRALA 105


>AB037765-1|BAA92582.2|  858|Homo sapiens KIAA1344 protein protein.
          Length = 858

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 16/74 (21%), Positives = 38/74 (51%), Gaps = 1/74 (1%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNG-SPIDYSGGRQADDIISWLKKKTGPP 432
           S + L +++     D+     V  +P +K ++ G +P+ Y+G     D++ +++      
Sbjct: 473 STMLLTRINCADWSDVCTKQNVTEFPIIKMYKKGENPVSYAGMLGTKDLLKFIQLNRISY 532

Query: 433 AVEVTSAEQAKELI 474
            V +TS ++A+E +
Sbjct: 533 PVNITSIQEAEEYL 546


>CR392000-1|CAM28352.1|  698|Homo sapiens quiescin Q6 sulfhydryl
           oxidase 2 protein.
          Length = 698

 Score = 35.9 bits (79), Expect = 0.20
 Identities = 22/71 (30%), Positives = 31/71 (43%), Gaps = 5/71 (7%)
 Frame = +2

Query: 38  RVLIFTAIALLGLALGDEVPT----EENVLVLSKANFETVITTTEYI-LVEFYAPWCGHC 202
           R+L+  A A +G   G         E+ V VL   +       +    LV+FY+ WCGHC
Sbjct: 35  RLLVLLAAAAVGPGAGGAARLYRAGEDAVWVLDSGSVRGATANSSAAWLVQFYSSWCGHC 94

Query: 203 KSLAPEYAKAA 235
              AP +   A
Sbjct: 95  IGYAPTWRALA 105


>AL138781-1|CAI16881.2|  698|Homo sapiens quiescin Q6 sulfhydryl
           oxidase 2 protein.
          Length = 698

 Score = 35.9 bits (79), Expect = 0.20
 Identities = 22/71 (30%), Positives = 31/71 (43%), Gaps = 5/71 (7%)
 Frame = +2

Query: 38  RVLIFTAIALLGLALGDEVPT----EENVLVLSKANFETVITTTEYI-LVEFYAPWCGHC 202
           R+L+  A A +G   G         E+ V VL   +       +    LV+FY+ WCGHC
Sbjct: 35  RLLVLLAAAAVGPGAGGAARLYRAGEDAVWVLDSGSVRGATANSSAAWLVQFYSSWCGHC 94

Query: 203 KSLAPEYAKAA 235
              AP +   A
Sbjct: 95  IGYAPTWRALA 105


>AK097656-1|BAC05133.1|  553|Homo sapiens protein ( Homo sapiens
           cDNA FLJ40337 fis, clone TESTI2032044, moderately
           similar to THIOREDOXIN. ).
          Length = 553

 Score = 35.1 bits (77), Expect = 0.34
 Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 3/54 (5%)
 Frame = +2

Query: 89  EVPTEENV-LVLSKANFETVITTT--EYILVEFYAPWCGHCKSLAPEYAKAATK 241
           E P  + V ++LSK +FE  +       + V+F A WCG C+++ P +   + K
Sbjct: 443 EFPEGDKVKVILSKEDFEASLKEAGERLVAVDFSATWCGPCRTITPFFHALSVK 496


>EF560747-1|ABQ59057.1|  538|Homo sapiens TXNDC2 protein protein.
          Length = 538

 Score = 34.7 bits (76), Expect = 0.46
 Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 3/54 (5%)
 Frame = +2

Query: 89  EVPTEENV-LVLSKANFETVITTT--EYILVEFYAPWCGHCKSLAPEYAKAATK 241
           E P  + V ++LSK +FE  +       + V+F A WCG C+++ P +   + K
Sbjct: 428 EFPEGDKVKVILSKEDFEASLKEAGERLVAVDFSATWCGPCRTIRPFFHALSVK 481


>BC050132-1|AAH50132.1|  486|Homo sapiens thioredoxin domain
           containing 2 (spermatozoa) protein.
          Length = 486

 Score = 34.7 bits (76), Expect = 0.46
 Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 3/54 (5%)
 Frame = +2

Query: 89  EVPTEENV-LVLSKANFETVITTT--EYILVEFYAPWCGHCKSLAPEYAKAATK 241
           E P  + V ++LSK +FE  +       + V+F A WCG C+++ P +   + K
Sbjct: 376 EFPEGDKVKVILSKEDFEASLKEAGERLVAVDFSATWCGPCRTIRPFFHALSVK 429


>AF080095-1|AAK94950.1|  486|Homo sapiens sperm-specific thioredoxin
           protein.
          Length = 486

 Score = 34.7 bits (76), Expect = 0.46
 Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 3/54 (5%)
 Frame = +2

Query: 89  EVPTEENV-LVLSKANFETVITTT--EYILVEFYAPWCGHCKSLAPEYAKAATK 241
           E P  + V ++LSK +FE  +       + V+F A WCG C+++ P +   + K
Sbjct: 376 EFPEGDKVKVILSKEDFEASLKEAGERLVAVDFSATWCGPCRTIRPFFHALSVK 429


>U97276-1|AAC09010.2|  747|Homo sapiens quiescin protein.
          Length = 747

 Score = 34.3 bits (75), Expect = 0.60
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +2

Query: 170 VEFYAPWCGHCKSLAPEYAKAA 235
           VEF+A WCGHC + AP +   A
Sbjct: 63  VEFFASWCGHCIAFAPTWKALA 84


>BC100023-1|AAI00024.1|  747|Homo sapiens quiescin Q6 sulfhydryl
           oxidase 1 protein.
          Length = 747

 Score = 34.3 bits (75), Expect = 0.60
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +2

Query: 170 VEFYAPWCGHCKSLAPEYAKAA 235
           VEF+A WCGHC + AP +   A
Sbjct: 63  VEFFASWCGHCIAFAPTWKALA 84


>BC017692-1|AAH17692.1|  604|Homo sapiens quiescin Q6 protein.
          Length = 604

 Score = 34.3 bits (75), Expect = 0.60
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +2

Query: 170 VEFYAPWCGHCKSLAPEYAKAA 235
           VEF+A WCGHC + AP +   A
Sbjct: 63  VEFFASWCGHCIAFAPTWKALA 84


>BC014372-1|AAH14372.2|  289|Homo sapiens TXNL2 protein protein.
          Length = 289

 Score = 34.3 bits (75), Expect = 0.60
 Identities = 16/69 (23%), Positives = 32/69 (46%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 441
           +   K++A    +++E Y +   PT  FF+N   ID   G  A ++   +++     +  
Sbjct: 17  VSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFL 76

Query: 442 VTSAEQAKE 468
            ++ E  KE
Sbjct: 77  SSANEHLKE 85


>BC005289-1|AAH05289.1|  335|Homo sapiens thioredoxin-like 2
           protein.
          Length = 335

 Score = 34.3 bits (75), Expect = 0.60
 Identities = 16/69 (23%), Positives = 32/69 (46%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 441
           +   K++A    +++E Y +   PT  FF+N   ID   G  A ++   +++     +  
Sbjct: 63  VSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFL 122

Query: 442 VTSAEQAKE 468
            ++ E  KE
Sbjct: 123 PSANEHLKE 131


>AY358941-1|AAQ89300.1|  747|Homo sapiens QSCN6 protein.
          Length = 747

 Score = 34.3 bits (75), Expect = 0.60
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +2

Query: 170 VEFYAPWCGHCKSLAPEYAKAA 235
           VEF+A WCGHC + AP +   A
Sbjct: 63  VEFFASWCGHCIAFAPTWKALA 84


>AL390718-7|CAI14839.1|  604|Homo sapiens quiescin Q6 sulfhydryl
           oxidase 1 protein.
          Length = 604

 Score = 34.3 bits (75), Expect = 0.60
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +2

Query: 170 VEFYAPWCGHCKSLAPEYAKAA 235
           VEF+A WCGHC + AP +   A
Sbjct: 63  VEFFASWCGHCIAFAPTWKALA 84


>AL390718-6|CAI14838.1|  747|Homo sapiens quiescin Q6 sulfhydryl
           oxidase 1 protein.
          Length = 747

 Score = 34.3 bits (75), Expect = 0.60
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +2

Query: 170 VEFYAPWCGHCKSLAPEYAKAA 235
           VEF+A WCGHC + AP +   A
Sbjct: 63  VEFFASWCGHCIAFAPTWKALA 84


>AL139123-3|CAC40691.1|  335|Homo sapiens thioredoxin-like 3
           protein.
          Length = 335

 Score = 34.3 bits (75), Expect = 0.60
 Identities = 16/69 (23%), Positives = 32/69 (46%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 441
           +   K++A    +++E Y +   PT  FF+N   ID   G  A ++   +++     +  
Sbjct: 63  VSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFL 122

Query: 442 VTSAEQAKE 468
            ++ E  KE
Sbjct: 123 PSANEHLKE 131


>AJ010841-1|CAA09375.1|  335|Homo sapiens thioredoxin-like protein
           protein.
          Length = 335

 Score = 34.3 bits (75), Expect = 0.60
 Identities = 16/69 (23%), Positives = 32/69 (46%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 441
           +   K++A    +++E Y +   PT  FF+N   ID   G  A ++   +++     +  
Sbjct: 63  VSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFL 122

Query: 442 VTSAEQAKE 468
            ++ E  KE
Sbjct: 123 PSANEHLKE 131


>AF361868-1|AAM00263.1|  604|Homo sapiens sulfhydryl oxidase
           protein.
          Length = 604

 Score = 34.3 bits (75), Expect = 0.60
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +2

Query: 170 VEFYAPWCGHCKSLAPEYAKAA 235
           VEF+A WCGHC + AP +   A
Sbjct: 63  VEFFASWCGHCIAFAPTWKALA 84


>AF118652-1|AAF28844.1|  335|Homo sapiens PKCq-interacting protein
           PICOT protein.
          Length = 335

 Score = 34.3 bits (75), Expect = 0.60
 Identities = 16/69 (23%), Positives = 32/69 (46%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 441
           +   K++A    +++E Y +   PT  FF+N   ID   G  A ++   +++     +  
Sbjct: 63  VSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFL 122

Query: 442 VTSAEQAKE 468
            ++ E  KE
Sbjct: 123 PSANEHLKE 131


>AF118649-1|AAF28841.1|  335|Homo sapiens PKCq-interacting protein
           PICOT protein.
          Length = 335

 Score = 34.3 bits (75), Expect = 0.60
 Identities = 16/69 (23%), Positives = 32/69 (46%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 441
           +   K++A    +++E Y +   PT  FF+N   ID   G  A ++   +++     +  
Sbjct: 63  VSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFL 122

Query: 442 VTSAEQAKE 468
            ++ E  KE
Sbjct: 123 SSANEHLKE 131


>AB209280-1|BAD92517.1|  753|Homo sapiens quiescin Q6 isoform a
           variant protein.
          Length = 753

 Score = 34.3 bits (75), Expect = 0.60
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +2

Query: 170 VEFYAPWCGHCKSLAPEYAKAA 235
           VEF+A WCGHC + AP +   A
Sbjct: 69  VEFFASWCGHCIAFAPTWKALA 90


>BC036816-1|AAH36816.1|  588|Homo sapiens thioredoxin domain
           containing 3 (spermatozoa) protein.
          Length = 588

 Score = 33.9 bits (74), Expect = 0.80
 Identities = 10/32 (31%), Positives = 21/32 (65%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAKAATKLAEEDLL 262
           +++ Y  WCG C+++ P + K   +L E+++L
Sbjct: 31  VIDVYQAWCGPCRAMQPLFRKLKNELNEDEIL 62


>AF305596-1|AAN04258.1|  588|Homo sapiens sperm-specific thioredoxin
           2 protein.
          Length = 588

 Score = 33.9 bits (74), Expect = 0.80
 Identities = 10/32 (31%), Positives = 21/32 (65%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAKAATKLAEEDLL 262
           +++ Y  WCG C+++ P + K   +L E+++L
Sbjct: 31  VIDVYQAWCGPCRAMQPLFRKLKNELNEDEIL 62


>AF202051-1|AAF20909.2|  588|Homo sapiens NM23-H8 protein.
          Length = 588

 Score = 33.9 bits (74), Expect = 0.80
 Identities = 10/32 (31%), Positives = 21/32 (65%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAKAATKLAEEDLL 262
           +++ Y  WCG C+++ P + K   +L E+++L
Sbjct: 31  VIDVYQAWCGPCRAMQPLFRKLKNELNEDEIL 62


>BC033787-1|AAH33787.1|  349|Homo sapiens thioredoxin domain
           containing 13 protein.
          Length = 349

 Score = 32.7 bits (71), Expect = 1.8
 Identities = 19/67 (28%), Positives = 35/67 (52%), Gaps = 3/67 (4%)
 Frame = +2

Query: 32  EMRVLIFTAIALLGLALGDE---VPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHC 202
           ++  L+   IA +    G E   +P E++ +    A+  T++   E++L +FYAPWC  C
Sbjct: 9   QLTALLAAWIAAVAATAGPEEAALPPEQSRVQPMTASNWTLVMEGEWML-KFYAPWCPSC 67

Query: 203 KSLAPEY 223
           +    E+
Sbjct: 68  QQTDSEW 74


>AY359004-1|AAQ89363.1|  349|Homo sapiens DJ971N18.2 protein.
          Length = 349

 Score = 32.7 bits (71), Expect = 1.8
 Identities = 19/67 (28%), Positives = 35/67 (52%), Gaps = 3/67 (4%)
 Frame = +2

Query: 32  EMRVLIFTAIALLGLALGDE---VPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHC 202
           ++  L+   IA +    G E   +P E++ +    A+  T++   E++L +FYAPWC  C
Sbjct: 9   QLTALLAAWIAAVAATAGPEEAALPPEQSRVQPMTASNWTLVMEGEWML-KFYAPWCPSC 67

Query: 203 KSLAPEY 223
           +    E+
Sbjct: 68  QQTDSEW 74


>AL021396-2|CAC17521.1|  349|Homo sapiens thioredoxin domain
           containing 13 protein.
          Length = 349

 Score = 32.7 bits (71), Expect = 1.8
 Identities = 19/67 (28%), Positives = 35/67 (52%), Gaps = 3/67 (4%)
 Frame = +2

Query: 32  EMRVLIFTAIALLGLALGDE---VPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHC 202
           ++  L+   IA +    G E   +P E++ +    A+  T++   E++L +FYAPWC  C
Sbjct: 9   QLTALLAAWIAAVAATAGPEEAALPPEQSRVQPMTASNWTLVMEGEWML-KFYAPWCPSC 67

Query: 203 KSLAPEY 223
           +    E+
Sbjct: 68  QQTDSEW 74


>AK075404-1|BAC11599.1|  349|Homo sapiens protein ( Homo sapiens
           cDNA PSEC0095 fis, clone NT2RP2001768, moderately
           similar to Thioredoxin-like protein KIAA1162 precursor.
           ).
          Length = 349

 Score = 32.7 bits (71), Expect = 1.8
 Identities = 19/67 (28%), Positives = 35/67 (52%), Gaps = 3/67 (4%)
 Frame = +2

Query: 32  EMRVLIFTAIALLGLALGDE---VPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHC 202
           ++  L+   IA +    G E   +P E++ +    A+  T++   E++L +FYAPWC  C
Sbjct: 9   QLTALLAAWIAAVAATAGPEEAALPPEQSRVQPMTASNWTLVMEGEWML-KFYAPWCPSC 67

Query: 203 KSLAPEY 223
           +    E+
Sbjct: 68  QQTDSEW 74


>AK074838-1|BAC11237.1|  349|Homo sapiens protein ( Homo sapiens
           cDNA FLJ90357 fis, clone NT2RP2003593, moderately
           similar to Thioredoxin-like protein KIAA1162 precursor.
           ).
          Length = 349

 Score = 32.7 bits (71), Expect = 1.8
 Identities = 19/67 (28%), Positives = 35/67 (52%), Gaps = 3/67 (4%)
 Frame = +2

Query: 32  EMRVLIFTAIALLGLALGDE---VPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHC 202
           ++  L+   IA +    G E   +P E++ +    A+  T++   E++L +FYAPWC  C
Sbjct: 9   QLTALLAAWIAAVAATAGPEEAALPPEQSRVQPMTASNWTLVMEGEWML-KFYAPWCPSC 67

Query: 203 KSLAPEY 223
           +    E+
Sbjct: 68  QQTDSEW 74


>BC109100-1|AAI09101.1|  510|Homo sapiens zinc finger protein 75
           (D8C6) protein.
          Length = 510

 Score = 32.3 bits (70), Expect = 2.4
 Identities = 18/56 (32%), Positives = 31/56 (55%), Gaps = 1/56 (1%)
 Frame = +1

Query: 382 RQADDIISWLKKKTGPPAVEVTSAEQAKE-LIDANTVIVFGFFWTRAQPEPKLSFQ 546
           +QA  ++ +L+++      EVT+ E  KE ++   T +  GF W  A+P+P   FQ
Sbjct: 118 KQALVLVEFLQREPDGTKNEVTAHELGKEAVLLGGTAVAPGFKWKPAEPQPMGVFQ 173


>AL831984-1|CAD89900.1|  510|Homo sapiens hypothetical protein
           protein.
          Length = 510

 Score = 32.3 bits (70), Expect = 2.4
 Identities = 18/56 (32%), Positives = 31/56 (55%), Gaps = 1/56 (1%)
 Frame = +1

Query: 382 RQADDIISWLKKKTGPPAVEVTSAEQAKE-LIDANTVIVFGFFWTRAQPEPKLSFQ 546
           +QA  ++ +L+++      EVT+ E  KE ++   T +  GF W  A+P+P   FQ
Sbjct: 118 KQALVLVEFLQREPDGTKNEVTAHELGKEAVLLGGTAVAPGFKWKPAEPQPMGVFQ 173


>BC093062-1|AAH93062.1|  258|Homo sapiens TXNDC14 protein protein.
          Length = 258

 Score = 31.1 bits (67), Expect = 5.6
 Identities = 12/25 (48%), Positives = 16/25 (64%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAKAATK 241
           +VEF+A W   C+S AP YA  + K
Sbjct: 121 IVEFFANWSNDCQSFAPIYADLSLK 145


>BC008953-1|AAH08953.1|  172|Homo sapiens thioredoxin domain
           containing 12 (endoplasmic reticulum) protein.
          Length = 172

 Score = 31.1 bits (67), Expect = 5.6
 Identities = 11/29 (37%), Positives = 22/29 (75%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           ++V  +  WCG CK+L P++A+ +T+++E
Sbjct: 57  LMVIIHKSWCGACKALKPKFAE-STEISE 84


>BC008913-1|AAH08913.1|  172|Homo sapiens thioredoxin domain
           containing 12 (endoplasmic reticulum) protein.
          Length = 172

 Score = 31.1 bits (67), Expect = 5.6
 Identities = 11/29 (37%), Positives = 22/29 (75%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           ++V  +  WCG CK+L P++A+ +T+++E
Sbjct: 57  LMVIIHKSWCGACKALKPKFAE-STEISE 84


>BC001493-1|AAH01493.1|  172|Homo sapiens thioredoxin domain
           containing 12 (endoplasmic reticulum) protein.
          Length = 172

 Score = 31.1 bits (67), Expect = 5.6
 Identities = 11/29 (37%), Positives = 22/29 (75%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           ++V  +  WCG CK+L P++A+ +T+++E
Sbjct: 57  LMVIIHKSWCGACKALKPKFAE-STEISE 84


>BC000666-1|AAH00666.1|  296|Homo sapiens thioredoxin domain
           containing 14 protein.
          Length = 296

 Score = 31.1 bits (67), Expect = 5.6
 Identities = 12/25 (48%), Positives = 16/25 (64%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAKAATK 241
           +VEF+A W   C+S AP YA  + K
Sbjct: 159 IVEFFANWSNDCQSFAPIYADLSLK 183


>AY358982-1|AAQ89341.1|  172|Homo sapiens ETRP713 protein.
          Length = 172

 Score = 31.1 bits (67), Expect = 5.6
 Identities = 11/29 (37%), Positives = 22/29 (75%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           ++V  +  WCG CK+L P++A+ +T+++E
Sbjct: 57  LMVIIHKSWCGACKALKPKFAE-STEISE 84


>AY358501-1|AAQ88865.1|  296|Homo sapiens AVLA237 protein.
          Length = 296

 Score = 31.1 bits (67), Expect = 5.6
 Identities = 12/25 (48%), Positives = 16/25 (64%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAKAATK 241
           +VEF+A W   C+S AP YA  + K
Sbjct: 159 IVEFFANWSNDCQSFAPIYADLSLK 183


>AL445685-5|CAI17031.1|  172|Homo sapiens thioredoxin domain
           containing 12 (endoplasmic reticulum) protein.
          Length = 172

 Score = 31.1 bits (67), Expect = 5.6
 Identities = 11/29 (37%), Positives = 22/29 (75%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           ++V  +  WCG CK+L P++A+ +T+++E
Sbjct: 57  LMVIIHKSWCGACKALKPKFAE-STEISE 84


>AL158158-2|CAI14067.1|   85|Homo sapiens thioredoxin protein.
          Length = 85

 Score = 31.1 bits (67), Expect = 5.6
 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 2/42 (4%)
 Frame = +2

Query: 122 SKANFETVITTT--EYILVEFYAPWCGHCKSLAPEYAKAATK 241
           SK  F+  +     + ++V+F A WCG CK + P +   A++
Sbjct: 7   SKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHDVASE 48


>AK223058-1|BAD96778.1|  296|Homo sapiens thioredoxin-related
           transmembrane protein 2 variant protein.
          Length = 296

 Score = 31.1 bits (67), Expect = 5.6
 Identities = 12/25 (48%), Positives = 16/25 (64%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAKAATK 241
           +VEF+A W   C+S AP YA  + K
Sbjct: 159 IVEFFANWSNDCQSFAPIYADLSLK 183


>AK075359-1|BAC11569.1|  372|Homo sapiens protein ( Homo sapiens
           cDNA PSEC0045 fis, clone NT2RP1001023. ).
          Length = 372

 Score = 31.1 bits (67), Expect = 5.6
 Identities = 12/25 (48%), Positives = 16/25 (64%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAKAATK 241
           +VEF+A W   C+S AP YA  + K
Sbjct: 159 IVEFFANWSNDCQSFAPIYADLSLK 183


>AF543416-1|AAN34781.1|  172|Homo sapiens thioredoxin-like protein
           p19 protein.
          Length = 172

 Score = 31.1 bits (67), Expect = 5.6
 Identities = 11/29 (37%), Positives = 22/29 (75%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           ++V  +  WCG CK+L P++A+ +T+++E
Sbjct: 57  LMVIIHKSWCGACKALKPKFAE-STEISE 84


>AF132965-1|AAD27740.1|  296|Homo sapiens CGI-31 protein protein.
          Length = 296

 Score = 31.1 bits (67), Expect = 5.6
 Identities = 12/25 (48%), Positives = 16/25 (64%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAKAATK 241
           +VEF+A W   C+S AP YA  + K
Sbjct: 159 IVEFFANWSNDCQSFAPIYADLSLK 183


>AF131758-1|AAD20035.1|  172|Homo sapiens Unknown protein.
          Length = 172

 Score = 31.1 bits (67), Expect = 5.6
 Identities = 11/29 (37%), Positives = 22/29 (75%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           ++V  +  WCG CK+L P++A+ +T+++E
Sbjct: 57  LMVIIHKSWCGACKALKPKFAE-STEISE 84


>AF065241-1|AAC17430.1|   84|Homo sapiens thioredoxin delta 3
           protein.
          Length = 84

 Score = 31.1 bits (67), Expect = 5.6
 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 2/42 (4%)
 Frame = +2

Query: 122 SKANFETVITTT--EYILVEFYAPWCGHCKSLAPEYAKAATK 241
           SK  F+  +     + ++V+F A WCG CK + P +   A++
Sbjct: 6   SKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHDVASE 47


>AF059753-1|AAG43122.1|  372|Homo sapiens My009 protein protein.
          Length = 372

 Score = 31.1 bits (67), Expect = 5.6
 Identities = 12/25 (48%), Positives = 16/25 (64%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAKAATK 241
           +VEF+A W   C+S AP YA  + K
Sbjct: 159 IVEFFANWSNDCQSFAPIYADLSLK 183


>X77584-1|CAA54687.1|  105|Homo sapiens ATL-derived
           factor/thioredoxin protein.
          Length = 105

 Score = 30.7 bits (66), Expect = 7.4
 Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 2/42 (4%)
 Frame = +2

Query: 122 SKANFETVITTT--EYILVEFYAPWCGHCKSLAPEYAKAATK 241
           SK  F+  +     + ++V+F A WCG CK + P +   + K
Sbjct: 7   SKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEK 48


>X54539-1|CAA38410.1|  105|Homo sapiens thioredoxin protein.
          Length = 105

 Score = 30.7 bits (66), Expect = 7.4
 Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 2/42 (4%)
 Frame = +2

Query: 122 SKANFETVITTT--EYILVEFYAPWCGHCKSLAPEYAKAATK 241
           SK  F+  +     + ++V+F A WCG CK + P +   + K
Sbjct: 7   SKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEK 48


>CR407665-1|CAG28593.1|  105|Homo sapiens TXN protein.
          Length = 105

 Score = 30.7 bits (66), Expect = 7.4
 Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 2/42 (4%)
 Frame = +2

Query: 122 SKANFETVITTT--EYILVEFYAPWCGHCKSLAPEYAKAATK 241
           SK  F+  +     + ++V+F A WCG CK + P +   + K
Sbjct: 7   SKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEK 48


>BC054866-1|AAH54866.1|  105|Homo sapiens thioredoxin protein.
          Length = 105

 Score = 30.7 bits (66), Expect = 7.4
 Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 2/42 (4%)
 Frame = +2

Query: 122 SKANFETVITTT--EYILVEFYAPWCGHCKSLAPEYAKAATK 241
           SK  F+  +     + ++V+F A WCG CK + P +   + K
Sbjct: 7   SKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEK 48


>BC003377-1|AAH03377.1|  105|Homo sapiens thioredoxin protein.
          Length = 105

 Score = 30.7 bits (66), Expect = 7.4
 Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 2/42 (4%)
 Frame = +2

Query: 122 SKANFETVITTT--EYILVEFYAPWCGHCKSLAPEYAKAATK 241
           SK  F+  +     + ++V+F A WCG CK + P +   + K
Sbjct: 7   SKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEK 48


>AY451237-1|AAS66642.1|  296|Homo sapiens proliferation-inducing
           gene 26 protein protein.
          Length = 296

 Score = 30.7 bits (66), Expect = 7.4
 Identities = 12/25 (48%), Positives = 16/25 (64%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAKAATK 241
           +VEF+A W   C+S AP YA  + K
Sbjct: 159 VVEFFANWSNDCQSFAPIYADLSLK 183


>AY004872-1|AAF87085.1|  105|Homo sapiens thioredoxin protein.
          Length = 105

 Score = 30.7 bits (66), Expect = 7.4
 Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 2/42 (4%)
 Frame = +2

Query: 122 SKANFETVITTT--EYILVEFYAPWCGHCKSLAPEYAKAATK 241
           SK  F+  +     + ++V+F A WCG CK + P +   + K
Sbjct: 7   SKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEK 48


>AL158158-1|CAI14066.1|  105|Homo sapiens thioredoxin protein.
          Length = 105

 Score = 30.7 bits (66), Expect = 7.4
 Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 2/42 (4%)
 Frame = +2

Query: 122 SKANFETVITTT--EYILVEFYAPWCGHCKSLAPEYAKAATK 241
           SK  F+  +     + ++V+F A WCG CK + P +   + K
Sbjct: 7   SKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEK 48


>AF548001-1|AAN33187.1|  105|Homo sapiens thioredoxin protein.
          Length = 105

 Score = 30.7 bits (66), Expect = 7.4
 Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 2/42 (4%)
 Frame = +2

Query: 122 SKANFETVITTT--EYILVEFYAPWCGHCKSLAPEYAKAATK 241
           SK  F+  +     + ++V+F A WCG CK + P +   + K
Sbjct: 7   SKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEK 48


>AF313911-1|AAG34699.1|  105|Homo sapiens thioredoxin protein.
          Length = 105

 Score = 30.7 bits (66), Expect = 7.4
 Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 2/42 (4%)
 Frame = +2

Query: 122 SKANFETVITTT--EYILVEFYAPWCGHCKSLAPEYAKAATK 241
           SK  F+  +     + ++V+F A WCG CK + P +   + K
Sbjct: 7   SKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEK 48


>L42379-1|AAA89173.1|  793|Homo sapiens bone-derived growth factor
           protein.
          Length = 793

 Score = 30.3 bits (65), Expect = 9.8
 Identities = 11/22 (50%), Positives = 14/22 (63%)
 Frame = +2

Query: 170 VEFYAPWCGHCKSLAPEYAKAA 235
           VEF+A WCGH  + AP +   A
Sbjct: 65  VEFFASWCGHSIAFAPTWKALA 86


>J04026-1|AAA74596.1|  105|Homo sapiens thioredoxin protein.
          Length = 105

 Score = 30.3 bits (65), Expect = 9.8
 Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 2/42 (4%)
 Frame = +2

Query: 122 SKANFETVITTT--EYILVEFYAPWCGHCKSLAPEYAKAATK 241
           SK  F+  +     + ++V+F A WCG CK + P +   + K
Sbjct: 7   SKTAFQEALDAAGDKLVVVDFSATWCGPCKMINPFFHSLSEK 48


>BC034713-1|AAH34713.1|   78|Homo sapiens DNAJC10 protein protein.
          Length = 78

 Score = 30.3 bits (65), Expect = 9.8
 Identities = 11/32 (34%), Positives = 17/32 (53%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFF 348
           +  +K  KVD        +  G+R YPT+KF+
Sbjct: 3   KGKVKAGKVDCQAYAQTCQKAGIRAYPTVKFY 34


>AF276919-1|AAF86466.1|  105|Homo sapiens thioredoxin 1 protein.
          Length = 105

 Score = 30.3 bits (65), Expect = 9.8
 Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 2/42 (4%)
 Frame = +2

Query: 122 SKANFETVITTT--EYILVEFYAPWCGHCKSLAPEYAKAATK 241
           SK  F+  +     + ++V+F A WCG CK + P +   + K
Sbjct: 7   SKTAFQEALDAAGDKLVVVDFSATWCGPCKMINPFFHSLSEK 48


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 125,825,561
Number of Sequences: 237096
Number of extensions: 2603611
Number of successful extensions: 6671
Number of sequences better than 10.0: 164
Number of HSP's better than 10.0 without gapping: 6078
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6621
length of database: 76,859,062
effective HSP length: 90
effective length of database: 55,520,422
effective search space used: 11437206932
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -