SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30165.Seq
         (897 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U78774-1|AAC51669.1|  335|Homo sapiens NFY-C protein.                 118   4e-26
U62296-1|AAC50816.1|  335|Homo sapiens transcription factor NF-Y...   118   4e-26
D85425-1|BAA12818.1|  335|Homo sapiens transactivator HSM-1 prot...   118   4e-26
BT020081-1|AAV38884.1|  335|Homo sapiens nuclear transcription f...   118   4e-26
BC005003-1|AAH05003.1|  335|Homo sapiens nuclear transcription f...   118   4e-26
AL354914-7|CAI16536.1|  313|Homo sapiens nuclear transcription f...   118   4e-26
AL354914-6|CAI16535.1|  254|Homo sapiens nuclear transcription f...   118   4e-26
AL354914-5|CAI16534.1|  129|Homo sapiens nuclear transcription f...   118   4e-26
AL354914-4|CAI16530.1|  439|Homo sapiens nuclear transcription f...   118   4e-26
AL354914-3|CAI16533.1|  458|Homo sapiens nuclear transcription f...   118   4e-26
AL354914-2|CAI16532.1|  301|Homo sapiens nuclear transcription f...   118   4e-26
AL354914-1|CAI16531.1|  335|Homo sapiens nuclear transcription f...   118   4e-26
AK000346-1|BAA91100.1|  439|Homo sapiens protein ( Homo sapiens ...   118   4e-26
AF191744-1|AAG28389.1|  458|Homo sapiens NFY-C variant DS2.8 pro...   118   4e-26
AB208975-1|BAD92212.1|  378|Homo sapiens nuclear transcription f...   118   4e-26
D89986-1|BAA14051.1|  335|Homo sapiens HSM-2 protein.                 117   7e-26
Z74792-1|CAA99055.1|  335|Homo sapiens CCAAT transcription bindi...   116   1e-25
X96506-1|CAA65358.1|  205|Homo sapiens NC2 protein.                    47   8e-05
BC010025-1|AAH10025.1|  205|Homo sapiens DR1-associated protein ...    47   8e-05
U41843-1|AAB02192.1|  193|Homo sapiens Dr1-associated corepresso...    44   8e-04
BC015891-1|AAH15891.1|  131|Homo sapiens chromatin accessibility...    43   0.001
AK023537-1|BAB14601.1|  131|Homo sapiens protein ( Homo sapiens ...    43   0.001
AF226076-1|AAF72416.1|  131|Homo sapiens CHRAC15 protein.              43   0.001
AL354914-8|CAI16537.1|  256|Homo sapiens nuclear transcription f...    42   0.003
BC031331-1|AAH31331.1|  117|Homo sapiens polymerase (DNA-directe...    40   0.012
AF261688-1|AAF90132.1|  117|Homo sapiens DNA polymerase epsilon ...    40   0.012
AC007400-1|AAY15030.1|  117|Homo sapiens unknown protein.              40   0.012

>U78774-1|AAC51669.1|  335|Homo sapiens NFY-C protein.
          Length = 335

 Score =  118 bits (283), Expect = 4e-26
 Identities = 55/76 (72%), Positives = 66/76 (86%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           Q+LQ FW +V+E+I+ +  +DF+ Q LPLARIKKIMKLDE+VKMISAEAPVLFAKAA+IF
Sbjct: 17  QSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIF 76

Query: 469 IHELTLRAWSHTEEIK 516
           I ELTLRAW HTE+ K
Sbjct: 77  ITELTLRAWIHTEDNK 92



 Score = 41.9 bits (94), Expect = 0.003
 Identities = 21/42 (50%), Positives = 26/42 (61%), Gaps = 2/42 (4%)
 Frame = +2

Query: 548 SILKSDQFDFLIDIVPRHEVKPTKPRYDAAXKAPSTD--QYY 667
           +I K DQFDFLIDIVPR E+KP K + +        +  QYY
Sbjct: 104 AITKFDQFDFLIDIVPRDELKPPKRQEEVRQSVTPAEPVQYY 145


>U62296-1|AAC50816.1|  335|Homo sapiens transcription factor NF-YC
           subunit protein.
          Length = 335

 Score =  118 bits (283), Expect = 4e-26
 Identities = 55/76 (72%), Positives = 66/76 (86%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           Q+LQ FW +V+E+I+ +  +DF+ Q LPLARIKKIMKLDE+VKMISAEAPVLFAKAA+IF
Sbjct: 17  QSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIF 76

Query: 469 IHELTLRAWSHTEEIK 516
           I ELTLRAW HTE+ K
Sbjct: 77  ITELTLRAWIHTEDNK 92



 Score = 41.9 bits (94), Expect = 0.003
 Identities = 21/42 (50%), Positives = 26/42 (61%), Gaps = 2/42 (4%)
 Frame = +2

Query: 548 SILKSDQFDFLIDIVPRHEVKPTKPRYDAAXKAPSTD--QYY 667
           +I K DQFDFLIDIVPR E+KP K + +        +  QYY
Sbjct: 104 AITKFDQFDFLIDIVPRDELKPPKRQEEVRQSVTPAEPVQYY 145


>D85425-1|BAA12818.1|  335|Homo sapiens transactivator HSM-1
           protein.
          Length = 335

 Score =  118 bits (283), Expect = 4e-26
 Identities = 55/76 (72%), Positives = 66/76 (86%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           Q+LQ FW +V+E+I+ +  +DF+ Q LPLARIKKIMKLDE+VKMISAEAPVLFAKAA+IF
Sbjct: 17  QSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIF 76

Query: 469 IHELTLRAWSHTEEIK 516
           I ELTLRAW HTE+ K
Sbjct: 77  ITELTLRAWIHTEDNK 92



 Score = 41.9 bits (94), Expect = 0.003
 Identities = 21/42 (50%), Positives = 26/42 (61%), Gaps = 2/42 (4%)
 Frame = +2

Query: 548 SILKSDQFDFLIDIVPRHEVKPTKPRYDAAXKAPSTD--QYY 667
           +I K DQFDFLIDIVPR E+KP K + +        +  QYY
Sbjct: 104 AITKFDQFDFLIDIVPRDELKPPKRQEEVRQSVTPAEPVQYY 145


>BT020081-1|AAV38884.1|  335|Homo sapiens nuclear transcription
           factor Y, gamma protein.
          Length = 335

 Score =  118 bits (283), Expect = 4e-26
 Identities = 55/76 (72%), Positives = 66/76 (86%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           Q+LQ FW +V+E+I+ +  +DF+ Q LPLARIKKIMKLDE+VKMISAEAPVLFAKAA+IF
Sbjct: 17  QSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIF 76

Query: 469 IHELTLRAWSHTEEIK 516
           I ELTLRAW HTE+ K
Sbjct: 77  ITELTLRAWIHTEDNK 92



 Score = 41.9 bits (94), Expect = 0.003
 Identities = 21/42 (50%), Positives = 26/42 (61%), Gaps = 2/42 (4%)
 Frame = +2

Query: 548 SILKSDQFDFLIDIVPRHEVKPTKPRYDAAXKAPSTD--QYY 667
           +I K DQFDFLIDIVPR E+KP K + +        +  QYY
Sbjct: 104 AITKFDQFDFLIDIVPRDELKPPKRQEEVRQSVTPAEPVQYY 145


>BC005003-1|AAH05003.1|  335|Homo sapiens nuclear transcription
           factor Y, gamma protein.
          Length = 335

 Score =  118 bits (283), Expect = 4e-26
 Identities = 55/76 (72%), Positives = 66/76 (86%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           Q+LQ FW +V+E+I+ +  +DF+ Q LPLARIKKIMKLDE+VKMISAEAPVLFAKAA+IF
Sbjct: 17  QSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIF 76

Query: 469 IHELTLRAWSHTEEIK 516
           I ELTLRAW HTE+ K
Sbjct: 77  ITELTLRAWIHTEDNK 92



 Score = 41.9 bits (94), Expect = 0.003
 Identities = 21/42 (50%), Positives = 26/42 (61%), Gaps = 2/42 (4%)
 Frame = +2

Query: 548 SILKSDQFDFLIDIVPRHEVKPTKPRYDAAXKAPSTD--QYY 667
           +I K DQFDFLIDIVPR E+KP K + +        +  QYY
Sbjct: 104 AITKFDQFDFLIDIVPRDELKPPKRQEEVRQSVTPAEPVQYY 145


>AL354914-7|CAI16536.1|  313|Homo sapiens nuclear transcription
           factor Y, gamma protein.
          Length = 313

 Score =  118 bits (283), Expect = 4e-26
 Identities = 55/76 (72%), Positives = 66/76 (86%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           Q+LQ FW +V+E+I+ +  +DF+ Q LPLARIKKIMKLDE+VKMISAEAPVLFAKAA+IF
Sbjct: 17  QSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIF 76

Query: 469 IHELTLRAWSHTEEIK 516
           I ELTLRAW HTE+ K
Sbjct: 77  ITELTLRAWIHTEDNK 92



 Score = 41.9 bits (94), Expect = 0.003
 Identities = 21/42 (50%), Positives = 26/42 (61%), Gaps = 2/42 (4%)
 Frame = +2

Query: 548 SILKSDQFDFLIDIVPRHEVKPTKPRYDAAXKAPSTD--QYY 667
           +I K DQFDFLIDIVPR E+KP K + +        +  QYY
Sbjct: 104 AITKFDQFDFLIDIVPRDELKPPKRQEEVRQSVTPAEPVQYY 145


>AL354914-6|CAI16535.1|  254|Homo sapiens nuclear transcription
           factor Y, gamma protein.
          Length = 254

 Score =  118 bits (283), Expect = 4e-26
 Identities = 55/76 (72%), Positives = 66/76 (86%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           Q+LQ FW +V+E+I+ +  +DF+ Q LPLARIKKIMKLDE+VKMISAEAPVLFAKAA+IF
Sbjct: 17  QSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIF 76

Query: 469 IHELTLRAWSHTEEIK 516
           I ELTLRAW HTE+ K
Sbjct: 77  ITELTLRAWIHTEDNK 92



 Score = 41.9 bits (94), Expect = 0.003
 Identities = 21/42 (50%), Positives = 26/42 (61%), Gaps = 2/42 (4%)
 Frame = +2

Query: 548 SILKSDQFDFLIDIVPRHEVKPTKPRYDAAXKAPSTD--QYY 667
           +I K DQFDFLIDIVPR E+KP K + +        +  QYY
Sbjct: 104 AITKFDQFDFLIDIVPRDELKPPKRQEEVRQSVTPAEPVQYY 145


>AL354914-5|CAI16534.1|  129|Homo sapiens nuclear transcription
           factor Y, gamma protein.
          Length = 129

 Score =  118 bits (283), Expect = 4e-26
 Identities = 55/76 (72%), Positives = 66/76 (86%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           Q+LQ FW +V+E+I+ +  +DF+ Q LPLARIKKIMKLDE+VKMISAEAPVLFAKAA+IF
Sbjct: 17  QSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIF 76

Query: 469 IHELTLRAWSHTEEIK 516
           I ELTLRAW HTE+ K
Sbjct: 77  ITELTLRAWIHTEDNK 92



 Score = 40.7 bits (91), Expect = 0.007
 Identities = 18/24 (75%), Positives = 20/24 (83%)
 Frame = +2

Query: 548 SILKSDQFDFLIDIVPRHEVKPTK 619
           +I K DQFDFLIDIVPR E+KP K
Sbjct: 104 AITKFDQFDFLIDIVPRDELKPPK 127


>AL354914-4|CAI16530.1|  439|Homo sapiens nuclear transcription
           factor Y, gamma protein.
          Length = 439

 Score =  118 bits (283), Expect = 4e-26
 Identities = 55/76 (72%), Positives = 66/76 (86%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           Q+LQ FW +V+E+I+ +  +DF+ Q LPLARIKKIMKLDE+VKMISAEAPVLFAKAA+IF
Sbjct: 17  QSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIF 76

Query: 469 IHELTLRAWSHTEEIK 516
           I ELTLRAW HTE+ K
Sbjct: 77  ITELTLRAWIHTEDNK 92



 Score = 41.9 bits (94), Expect = 0.003
 Identities = 21/42 (50%), Positives = 26/42 (61%), Gaps = 2/42 (4%)
 Frame = +2

Query: 548 SILKSDQFDFLIDIVPRHEVKPTKPRYDAAXKAPSTD--QYY 667
           +I K DQFDFLIDIVPR E+KP K + +        +  QYY
Sbjct: 104 AITKFDQFDFLIDIVPRDELKPPKRQEEVRQSVTPAEPVQYY 145


>AL354914-3|CAI16533.1|  458|Homo sapiens nuclear transcription
           factor Y, gamma protein.
          Length = 458

 Score =  118 bits (283), Expect = 4e-26
 Identities = 55/76 (72%), Positives = 66/76 (86%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           Q+LQ FW +V+E+I+ +  +DF+ Q LPLARIKKIMKLDE+VKMISAEAPVLFAKAA+IF
Sbjct: 17  QSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIF 76

Query: 469 IHELTLRAWSHTEEIK 516
           I ELTLRAW HTE+ K
Sbjct: 77  ITELTLRAWIHTEDNK 92



 Score = 41.9 bits (94), Expect = 0.003
 Identities = 21/42 (50%), Positives = 26/42 (61%), Gaps = 2/42 (4%)
 Frame = +2

Query: 548 SILKSDQFDFLIDIVPRHEVKPTKPRYDAAXKAPSTD--QYY 667
           +I K DQFDFLIDIVPR E+KP K + +        +  QYY
Sbjct: 104 AITKFDQFDFLIDIVPRDELKPPKRQEEVRQSVTPAEPVQYY 145


>AL354914-2|CAI16532.1|  301|Homo sapiens nuclear transcription
           factor Y, gamma protein.
          Length = 301

 Score =  118 bits (283), Expect = 4e-26
 Identities = 55/76 (72%), Positives = 66/76 (86%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           Q+LQ FW +V+E+I+ +  +DF+ Q LPLARIKKIMKLDE+VKMISAEAPVLFAKAA+IF
Sbjct: 17  QSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIF 76

Query: 469 IHELTLRAWSHTEEIK 516
           I ELTLRAW HTE+ K
Sbjct: 77  ITELTLRAWIHTEDNK 92



 Score = 41.9 bits (94), Expect = 0.003
 Identities = 21/42 (50%), Positives = 26/42 (61%), Gaps = 2/42 (4%)
 Frame = +2

Query: 548 SILKSDQFDFLIDIVPRHEVKPTKPRYDAAXKAPSTD--QYY 667
           +I K DQFDFLIDIVPR E+KP K + +        +  QYY
Sbjct: 104 AITKFDQFDFLIDIVPRDELKPPKRQEEVRQSVTPAEPVQYY 145


>AL354914-1|CAI16531.1|  335|Homo sapiens nuclear transcription
           factor Y, gamma protein.
          Length = 335

 Score =  118 bits (283), Expect = 4e-26
 Identities = 55/76 (72%), Positives = 66/76 (86%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           Q+LQ FW +V+E+I+ +  +DF+ Q LPLARIKKIMKLDE+VKMISAEAPVLFAKAA+IF
Sbjct: 17  QSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIF 76

Query: 469 IHELTLRAWSHTEEIK 516
           I ELTLRAW HTE+ K
Sbjct: 77  ITELTLRAWIHTEDNK 92



 Score = 41.9 bits (94), Expect = 0.003
 Identities = 21/42 (50%), Positives = 26/42 (61%), Gaps = 2/42 (4%)
 Frame = +2

Query: 548 SILKSDQFDFLIDIVPRHEVKPTKPRYDAAXKAPSTD--QYY 667
           +I K DQFDFLIDIVPR E+KP K + +        +  QYY
Sbjct: 104 AITKFDQFDFLIDIVPRDELKPPKRQEEVRQSVTPAEPVQYY 145


>AK000346-1|BAA91100.1|  439|Homo sapiens protein ( Homo sapiens
           cDNA FLJ20339 fis, clone HEP12350. ).
          Length = 439

 Score =  118 bits (283), Expect = 4e-26
 Identities = 55/76 (72%), Positives = 66/76 (86%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           Q+LQ FW +V+E+I+ +  +DF+ Q LPLARIKKIMKLDE+VKMISAEAPVLFAKAA+IF
Sbjct: 17  QSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIF 76

Query: 469 IHELTLRAWSHTEEIK 516
           I ELTLRAW HTE+ K
Sbjct: 77  ITELTLRAWIHTEDNK 92



 Score = 41.9 bits (94), Expect = 0.003
 Identities = 21/42 (50%), Positives = 26/42 (61%), Gaps = 2/42 (4%)
 Frame = +2

Query: 548 SILKSDQFDFLIDIVPRHEVKPTKPRYDAAXKAPSTD--QYY 667
           +I K DQFDFLIDIVPR E+KP K + +        +  QYY
Sbjct: 104 AITKFDQFDFLIDIVPRDELKPPKRQEEVRQSVTPAEPVQYY 145


>AF191744-1|AAG28389.1|  458|Homo sapiens NFY-C variant DS2.8
           protein.
          Length = 458

 Score =  118 bits (283), Expect = 4e-26
 Identities = 55/76 (72%), Positives = 66/76 (86%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           Q+LQ FW +V+E+I+ +  +DF+ Q LPLARIKKIMKLDE+VKMISAEAPVLFAKAA+IF
Sbjct: 17  QSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIF 76

Query: 469 IHELTLRAWSHTEEIK 516
           I ELTLRAW HTE+ K
Sbjct: 77  ITELTLRAWIHTEDNK 92



 Score = 41.9 bits (94), Expect = 0.003
 Identities = 21/42 (50%), Positives = 26/42 (61%), Gaps = 2/42 (4%)
 Frame = +2

Query: 548 SILKSDQFDFLIDIVPRHEVKPTKPRYDAAXKAPSTD--QYY 667
           +I K DQFDFLIDIVPR E+KP K + +        +  QYY
Sbjct: 104 AITKFDQFDFLIDIVPRDELKPPKRQEEVRQSVTPAEPVQYY 145


>AB208975-1|BAD92212.1|  378|Homo sapiens nuclear transcription
           factor Y, gamma variant protein.
          Length = 378

 Score =  118 bits (283), Expect = 4e-26
 Identities = 55/76 (72%), Positives = 66/76 (86%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           Q+LQ FW +V+E+I+ +  +DF+ Q LPLARIKKIMKLDE+VKMISAEAPVLFAKAA+IF
Sbjct: 61  QSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIF 120

Query: 469 IHELTLRAWSHTEEIK 516
           I ELTLRAW HTE+ K
Sbjct: 121 ITELTLRAWIHTEDNK 136



 Score = 41.9 bits (94), Expect = 0.003
 Identities = 21/42 (50%), Positives = 26/42 (61%), Gaps = 2/42 (4%)
 Frame = +2

Query: 548 SILKSDQFDFLIDIVPRHEVKPTKPRYDAAXKAPSTD--QYY 667
           +I K DQFDFLIDIVPR E+KP K + +        +  QYY
Sbjct: 148 AITKFDQFDFLIDIVPRDELKPPKRQEEVRQSVTPAEPVQYY 189


>D89986-1|BAA14051.1|  335|Homo sapiens HSM-2 protein.
          Length = 335

 Score =  117 bits (281), Expect = 7e-26
 Identities = 55/76 (72%), Positives = 65/76 (85%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           Q+LQ FW +V+E+I+ +  +DF+ Q LPLARIKKIMKLDE+VKMISAEAPVLFAKAA+IF
Sbjct: 17  QSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIF 76

Query: 469 IHELTLRAWSHTEEIK 516
           I ELTLRAW HTE  K
Sbjct: 77  ITELTLRAWIHTENNK 92



 Score = 41.9 bits (94), Expect = 0.003
 Identities = 21/42 (50%), Positives = 26/42 (61%), Gaps = 2/42 (4%)
 Frame = +2

Query: 548 SILKSDQFDFLIDIVPRHEVKPTKPRYDAAXKAPSTD--QYY 667
           +I K DQFDFLIDIVPR E+KP K + +        +  QYY
Sbjct: 104 AITKFDQFDFLIDIVPRDELKPPKRQEEVRQSVTPAEPVQYY 145



 Score = 30.3 bits (65), Expect = 9.9
 Identities = 14/27 (51%), Positives = 17/27 (62%)
 Frame = +3

Query: 465 FYTRANVASLVAYGGNKRRTLQRNDIA 545
           F T   + + +    NKRRTLQRNDIA
Sbjct: 76  FITELTLRAWIHTENNKRRTLQRNDIA 102


>Z74792-1|CAA99055.1|  335|Homo sapiens CCAAT transcription binding
           factor, gamma subunit protein.
          Length = 335

 Score =  116 bits (279), Expect = 1e-25
 Identities = 54/76 (71%), Positives = 66/76 (86%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           Q+LQ FW +V+E+I+ +  +DF+ Q LPLARIKKI+KLDE+VKMISAEAPVLFAKAA+IF
Sbjct: 17  QSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIIKLDEDVKMISAEAPVLFAKAAQIF 76

Query: 469 IHELTLRAWSHTEEIK 516
           I ELTLRAW HTE+ K
Sbjct: 77  ITELTLRAWIHTEDNK 92



 Score = 41.9 bits (94), Expect = 0.003
 Identities = 21/42 (50%), Positives = 26/42 (61%), Gaps = 2/42 (4%)
 Frame = +2

Query: 548 SILKSDQFDFLIDIVPRHEVKPTKPRYDAAXKAPSTD--QYY 667
           +I K DQFDFLIDIVPR E+KP K + +        +  QYY
Sbjct: 104 AITKFDQFDFLIDIVPRDELKPPKRQEEVRQSVTPAEPVQYY 145


>X96506-1|CAA65358.1|  205|Homo sapiens NC2 protein.
          Length = 205

 Score = 47.2 bits (107), Expect = 8e-05
 Identities = 23/64 (35%), Positives = 38/64 (59%)
 Frame = +1

Query: 370 PLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHTEEIKGGLCSATT*RQ 549
           P ARIKKIM+ DEE+  ++A  PV+ ++A E+F+  L  +A   T+       + +  +Q
Sbjct: 13  PPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQ 72

Query: 550 YIEI 561
            IE+
Sbjct: 73  CIEL 76


>BC010025-1|AAH10025.1|  205|Homo sapiens DR1-associated protein 1
           (negative cofactor 2 alpha) protein.
          Length = 205

 Score = 47.2 bits (107), Expect = 8e-05
 Identities = 23/64 (35%), Positives = 38/64 (59%)
 Frame = +1

Query: 370 PLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHTEEIKGGLCSATT*RQ 549
           P ARIKKIM+ DEE+  ++A  PV+ ++A E+F+  L  +A   T+       + +  +Q
Sbjct: 13  PPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQ 72

Query: 550 YIEI 561
            IE+
Sbjct: 73  CIEL 76


>U41843-1|AAB02192.1|  193|Homo sapiens Dr1-associated corepressor
           protein.
          Length = 193

 Score = 44.0 bits (99), Expect = 8e-04
 Identities = 21/61 (34%), Positives = 36/61 (59%)
 Frame = +1

Query: 379 RIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHTEEIKGGLCSATT*RQYIE 558
           RIKKIM+ DEE+  ++A  PV+ ++A E+F+  L  +A   T+       + +  +Q IE
Sbjct: 4   RIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQCIE 63

Query: 559 I 561
           +
Sbjct: 64  L 64


>BC015891-1|AAH15891.1|  131|Homo sapiens chromatin accessibility
           complex 1 protein.
          Length = 131

 Score = 43.2 bits (97), Expect = 0.001
 Identities = 22/46 (47%), Positives = 30/46 (65%)
 Frame = +1

Query: 364 ALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSH 501
           +LPL+RI+ IMK   EV  I+ EA VL AKA E+F+  L   ++ H
Sbjct: 18  SLPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQCLATYSYRH 63


>AK023537-1|BAB14601.1|  131|Homo sapiens protein ( Homo sapiens
           cDNA FLJ13475 fis, clone PLACE1003605. ).
          Length = 131

 Score = 43.2 bits (97), Expect = 0.001
 Identities = 22/46 (47%), Positives = 30/46 (65%)
 Frame = +1

Query: 364 ALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSH 501
           +LPL+RI+ IMK   EV  I+ EA VL AKA E+F+  L   ++ H
Sbjct: 18  SLPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQCLATYSYRH 63


>AF226076-1|AAF72416.1|  131|Homo sapiens CHRAC15 protein.
          Length = 131

 Score = 43.2 bits (97), Expect = 0.001
 Identities = 22/46 (47%), Positives = 30/46 (65%)
 Frame = +1

Query: 364 ALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSH 501
           +LPL+RI+ IMK   EV  I+ EA VL AKA E+F+  L   ++ H
Sbjct: 18  SLPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQCLATYSYRH 63


>AL354914-8|CAI16537.1|  256|Homo sapiens nuclear transcription
           factor Y, gamma protein.
          Length = 256

 Score = 41.9 bits (94), Expect = 0.003
 Identities = 21/42 (50%), Positives = 26/42 (61%), Gaps = 2/42 (4%)
 Frame = +2

Query: 548 SILKSDQFDFLIDIVPRHEVKPTKPRYDAAXKAPSTD--QYY 667
           +I K DQFDFLIDIVPR E+KP K + +        +  QYY
Sbjct: 6   AITKFDQFDFLIDIVPRDELKPPKRQEEVRQSVTPAEPVQYY 47


>BC031331-1|AAH31331.1|  117|Homo sapiens polymerase (DNA-directed),
           epsilon 4 (p12 subunit) protein.
          Length = 117

 Score = 39.9 bits (89), Expect = 0.012
 Identities = 18/50 (36%), Positives = 31/50 (62%)
 Frame = +1

Query: 367 LPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHTEEIK 516
           LPLAR+K ++K D +V +   EA  + A+AAE+F+  +   A+   ++ K
Sbjct: 41  LPLARVKALVKADPDVTLAGQEAIFILARAAELFVETIAKDAYCCAQQGK 90


>AF261688-1|AAF90132.1|  117|Homo sapiens DNA polymerase epsilon p12
           subunit protein.
          Length = 117

 Score = 39.9 bits (89), Expect = 0.012
 Identities = 18/50 (36%), Positives = 31/50 (62%)
 Frame = +1

Query: 367 LPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHTEEIK 516
           LPLAR+K ++K D +V +   EA  + A+AAE+F+  +   A+   ++ K
Sbjct: 41  LPLARVKALVKADPDVTLAGQEAIFILARAAELFVETIAKDAYCCAQQGK 90


>AC007400-1|AAY15030.1|  117|Homo sapiens unknown protein.
          Length = 117

 Score = 39.9 bits (89), Expect = 0.012
 Identities = 18/50 (36%), Positives = 31/50 (62%)
 Frame = +1

Query: 367 LPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHTEEIK 516
           LPLAR+K ++K D +V +   EA  + A+AAE+F+  +   A+   ++ K
Sbjct: 41  LPLARVKALVKADPDVTLAGQEAIFILARAAELFVETIAKDAYCCAQQGK 90


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 112,879,247
Number of Sequences: 237096
Number of extensions: 2085028
Number of successful extensions: 4916
Number of sequences better than 10.0: 27
Number of HSP's better than 10.0 without gapping: 4689
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4916
length of database: 76,859,062
effective HSP length: 90
effective length of database: 55,520,422
effective search space used: 11548247776
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -