SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30164.Seq
         (888 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC121794-1|AAI21795.1|  806|Homo sapiens valosin-containing prot...   162   1e-39
BC110913-1|AAI10914.1|  806|Homo sapiens valosin-containing prot...   161   4e-39
AL353795-2|CAH70993.1|  806|Homo sapiens valosin-containing prot...   161   4e-39
AF100752-1|AAD43016.1|  806|Homo sapiens transitional endoplasmi...   161   4e-39
AC004472-1|AAC07984.1|  806|Homo sapiens TERA_HUMAN protein.          161   4e-39
AF313485-1|AAG29873.1|  307|Homo sapiens valosin-containing prot...   160   7e-39
BC007562-1|AAH07562.2|  644|Homo sapiens VCP protein protein.         120   7e-27
AB065574-1|BAC05807.1|  337|Homo sapiens seven transmembrane hel...    33   1.8  

>BC121794-1|AAI21795.1|  806|Homo sapiens valosin-containing protein
           protein.
          Length = 806

 Score =  162 bits (394), Expect = 1e-39
 Identities = 100/224 (44%), Positives = 128/224 (57%), Gaps = 2/224 (0%)
 Frame = +1

Query: 223 LAQGQTPQGNRCIVLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHIL 402
           L +G+  +   CIVLSDD C DEKIRM             DV+SI PCP VKYGKR+H+L
Sbjct: 58  LLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVL 117

Query: 403 PIDDSVEGLTGNLFEVYLKPYFMEAYRPIHRDDTFRSAGACAPSSSKWSKQIHHHFASWL 582
           PIDD+VEG+TGNLFEVYLKPYF+EAYRPI + D F   G       K  +   H     +
Sbjct: 118 PIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVET--HPSPYCI 175

Query: 583 LIP*YTVTVNRLNVRKKRKH*MLSAMMTSAV--VANNWAQIKEMVELPLRSSFTVSRLLE 756
           + P   +      ++++ +   L+ +    +       AQIKEMVELPLR    + + + 
Sbjct: 176 VAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHP-ALFKAIG 234

Query: 757 *KLPRGILHVWGRLVTGKNTHWLVLLLMETGASSFLINGPGIMS 888
            K PRGIL ++G   TGK T     +  ETGA  FLINGP IMS
Sbjct: 235 VKPPRGIL-LYGPPGTGK-TLIARAVANETGAFFFLINGPEIMS 276



 Score =  135 bits (326), Expect = 2e-31
 Identities = 75/118 (63%), Positives = 82/118 (69%), Gaps = 2/118 (1%)
 Frame = +3

Query: 510 VRGGMRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 689
           VRGGMRAVEFKVVET PSP+CIVAPDTVIHC+GEPIKRE+EEE+LN VGYDDIGGCRKQL
Sbjct: 154 VRGGMRAVEFKVVETHPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQL 213

Query: 690 GAN*GDGGVATAVILH--CFKAIGVKASTRHSPCMGPPXNRKKHSLARAVANGNRGFF 857
                   +    + H   FKAIGVK   R     GPP   K   +ARAVAN    FF
Sbjct: 214 AQ---IKEMVELPLRHPALFKAIGVK-PPRGILLYGPPGTGKT-LIARAVANETGAFF 266



 Score =  101 bits (241), Expect = 5e-21
 Identities = 48/65 (73%), Positives = 61/65 (93%)
 Frame = +2

Query: 62  ADNKSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGKR 241
           AD+K  DDLSTAIL++K+RPNRLIV+EA+++DNSVV+LSQ KM++LQLFRGDTVLLKGK+
Sbjct: 5   ADSKG-DDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKK 63

Query: 242 RKETV 256
           R+E V
Sbjct: 64  RREAV 68


>BC110913-1|AAI10914.1|  806|Homo sapiens valosin-containing protein
           protein.
          Length = 806

 Score =  161 bits (390), Expect = 4e-39
 Identities = 99/224 (44%), Positives = 128/224 (57%), Gaps = 2/224 (0%)
 Frame = +1

Query: 223 LAQGQTPQGNRCIVLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHIL 402
           L +G+  +   CIVLSDD C DEKIRM             DV+SI PCP VKYGKR+H+L
Sbjct: 58  LLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVL 117

Query: 403 PIDDSVEGLTGNLFEVYLKPYFMEAYRPIHRDDTFRSAGACAPSSSKWSKQIHHHFASWL 582
           PIDD+VEG+TGNLFEVYLKPYF+EAYRPI + D F   G       K  +     +   +
Sbjct: 118 PIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYC--I 175

Query: 583 LIP*YTVTVNRLNVRKKRKH*MLSAMMTSAV--VANNWAQIKEMVELPLRSSFTVSRLLE 756
           + P   +      ++++ +   L+ +    +       AQIKEMVELPLR    + + + 
Sbjct: 176 VAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHP-ALFKAIG 234

Query: 757 *KLPRGILHVWGRLVTGKNTHWLVLLLMETGASSFLINGPGIMS 888
            K PRGIL ++G   TGK T     +  ETGA  FLINGP IMS
Sbjct: 235 VKPPRGIL-LYGPPGTGK-TLIARAVANETGAFFFLINGPEIMS 276



 Score =  138 bits (333), Expect = 3e-32
 Identities = 76/118 (64%), Positives = 83/118 (70%), Gaps = 2/118 (1%)
 Frame = +3

Query: 510 VRGGMRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 689
           VRGGMRAVEFKVVETDPSP+CIVAPDTVIHC+GEPIKRE+EEE+LN VGYDDIGGCRKQL
Sbjct: 154 VRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQL 213

Query: 690 GAN*GDGGVATAVILH--CFKAIGVKASTRHSPCMGPPXNRKKHSLARAVANGNRGFF 857
                   +    + H   FKAIGVK   R     GPP   K   +ARAVAN    FF
Sbjct: 214 AQ---IKEMVELPLRHPALFKAIGVK-PPRGILLYGPPGTGKT-LIARAVANETGAFF 266



 Score =  101 bits (241), Expect = 5e-21
 Identities = 48/65 (73%), Positives = 61/65 (93%)
 Frame = +2

Query: 62  ADNKSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGKR 241
           AD+K  DDLSTAIL++K+RPNRLIV+EA+++DNSVV+LSQ KM++LQLFRGDTVLLKGK+
Sbjct: 5   ADSKG-DDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKK 63

Query: 242 RKETV 256
           R+E V
Sbjct: 64  RREAV 68


>AL353795-2|CAH70993.1|  806|Homo sapiens valosin-containing protein
           protein.
          Length = 806

 Score =  161 bits (390), Expect = 4e-39
 Identities = 99/224 (44%), Positives = 128/224 (57%), Gaps = 2/224 (0%)
 Frame = +1

Query: 223 LAQGQTPQGNRCIVLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHIL 402
           L +G+  +   CIVLSDD C DEKIRM             DV+SI PCP VKYGKR+H+L
Sbjct: 58  LLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVL 117

Query: 403 PIDDSVEGLTGNLFEVYLKPYFMEAYRPIHRDDTFRSAGACAPSSSKWSKQIHHHFASWL 582
           PIDD+VEG+TGNLFEVYLKPYF+EAYRPI + D F   G       K  +     +   +
Sbjct: 118 PIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYC--I 175

Query: 583 LIP*YTVTVNRLNVRKKRKH*MLSAMMTSAV--VANNWAQIKEMVELPLRSSFTVSRLLE 756
           + P   +      ++++ +   L+ +    +       AQIKEMVELPLR    + + + 
Sbjct: 176 VAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHP-ALFKAIG 234

Query: 757 *KLPRGILHVWGRLVTGKNTHWLVLLLMETGASSFLINGPGIMS 888
            K PRGIL ++G   TGK T     +  ETGA  FLINGP IMS
Sbjct: 235 VKPPRGIL-LYGPPGTGK-TLIARAVANETGAFFFLINGPEIMS 276



 Score =  138 bits (333), Expect = 3e-32
 Identities = 76/118 (64%), Positives = 83/118 (70%), Gaps = 2/118 (1%)
 Frame = +3

Query: 510 VRGGMRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 689
           VRGGMRAVEFKVVETDPSP+CIVAPDTVIHC+GEPIKRE+EEE+LN VGYDDIGGCRKQL
Sbjct: 154 VRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQL 213

Query: 690 GAN*GDGGVATAVILH--CFKAIGVKASTRHSPCMGPPXNRKKHSLARAVANGNRGFF 857
                   +    + H   FKAIGVK   R     GPP   K   +ARAVAN    FF
Sbjct: 214 AQ---IKEMVELPLRHPALFKAIGVK-PPRGILLYGPPGTGKT-LIARAVANETGAFF 266



 Score =  101 bits (241), Expect = 5e-21
 Identities = 48/65 (73%), Positives = 61/65 (93%)
 Frame = +2

Query: 62  ADNKSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGKR 241
           AD+K  DDLSTAIL++K+RPNRLIV+EA+++DNSVV+LSQ KM++LQLFRGDTVLLKGK+
Sbjct: 5   ADSKG-DDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKK 63

Query: 242 RKETV 256
           R+E V
Sbjct: 64  RREAV 68


>AF100752-1|AAD43016.1|  806|Homo sapiens transitional endoplasmic
           reticulum ATPase protein.
          Length = 806

 Score =  161 bits (390), Expect = 4e-39
 Identities = 99/224 (44%), Positives = 128/224 (57%), Gaps = 2/224 (0%)
 Frame = +1

Query: 223 LAQGQTPQGNRCIVLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHIL 402
           L +G+  +   CIVLSDD C DEKIRM             DV+SI PCP VKYGKR+H+L
Sbjct: 58  LLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVL 117

Query: 403 PIDDSVEGLTGNLFEVYLKPYFMEAYRPIHRDDTFRSAGACAPSSSKWSKQIHHHFASWL 582
           PIDD+VEG+TGNLFEVYLKPYF+EAYRPI + D F   G       K  +     +   +
Sbjct: 118 PIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYC--I 175

Query: 583 LIP*YTVTVNRLNVRKKRKH*MLSAMMTSAV--VANNWAQIKEMVELPLRSSFTVSRLLE 756
           + P   +      ++++ +   L+ +    +       AQIKEMVELPLR    + + + 
Sbjct: 176 VAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHP-ALFKAIG 234

Query: 757 *KLPRGILHVWGRLVTGKNTHWLVLLLMETGASSFLINGPGIMS 888
            K PRGIL ++G   TGK T     +  ETGA  FLINGP IMS
Sbjct: 235 VKPPRGIL-LYGPPGTGK-TLIARAVANETGAFFFLINGPEIMS 276



 Score =  138 bits (333), Expect = 3e-32
 Identities = 76/118 (64%), Positives = 83/118 (70%), Gaps = 2/118 (1%)
 Frame = +3

Query: 510 VRGGMRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 689
           VRGGMRAVEFKVVETDPSP+CIVAPDTVIHC+GEPIKRE+EEE+LN VGYDDIGGCRKQL
Sbjct: 154 VRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQL 213

Query: 690 GAN*GDGGVATAVILH--CFKAIGVKASTRHSPCMGPPXNRKKHSLARAVANGNRGFF 857
                   +    + H   FKAIGVK   R     GPP   K   +ARAVAN    FF
Sbjct: 214 AQ---IKEMVELPLRHPALFKAIGVK-PPRGILLYGPPGTGKT-LIARAVANETGAFF 266



 Score =  101 bits (241), Expect = 5e-21
 Identities = 48/65 (73%), Positives = 61/65 (93%)
 Frame = +2

Query: 62  ADNKSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGKR 241
           AD+K  DDLSTAIL++K+RPNRLIV+EA+++DNSVV+LSQ KM++LQLFRGDTVLLKGK+
Sbjct: 5   ADSKG-DDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKK 63

Query: 242 RKETV 256
           R+E V
Sbjct: 64  RREAV 68


>AC004472-1|AAC07984.1|  806|Homo sapiens TERA_HUMAN protein.
          Length = 806

 Score =  161 bits (390), Expect = 4e-39
 Identities = 99/224 (44%), Positives = 128/224 (57%), Gaps = 2/224 (0%)
 Frame = +1

Query: 223 LAQGQTPQGNRCIVLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHIL 402
           L +G+  +   CIVLSDD C DEKIRM             DV+SI PCP VKYGKR+H+L
Sbjct: 58  LLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVL 117

Query: 403 PIDDSVEGLTGNLFEVYLKPYFMEAYRPIHRDDTFRSAGACAPSSSKWSKQIHHHFASWL 582
           PIDD+VEG+TGNLFEVYLKPYF+EAYRPI + D F   G       K  +     +   +
Sbjct: 118 PIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYC--I 175

Query: 583 LIP*YTVTVNRLNVRKKRKH*MLSAMMTSAV--VANNWAQIKEMVELPLRSSFTVSRLLE 756
           + P   +      ++++ +   L+ +    +       AQIKEMVELPLR    + + + 
Sbjct: 176 VAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHP-ALFKAIG 234

Query: 757 *KLPRGILHVWGRLVTGKNTHWLVLLLMETGASSFLINGPGIMS 888
            K PRGIL ++G   TGK T     +  ETGA  FLINGP IMS
Sbjct: 235 VKPPRGIL-LYGPPGTGK-TLIARAVANETGAFFFLINGPEIMS 276



 Score =  138 bits (333), Expect = 3e-32
 Identities = 76/118 (64%), Positives = 83/118 (70%), Gaps = 2/118 (1%)
 Frame = +3

Query: 510 VRGGMRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 689
           VRGGMRAVEFKVVETDPSP+CIVAPDTVIHC+GEPIKRE+EEE+LN VGYDDIGGCRKQL
Sbjct: 154 VRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQL 213

Query: 690 GAN*GDGGVATAVILH--CFKAIGVKASTRHSPCMGPPXNRKKHSLARAVANGNRGFF 857
                   +    + H   FKAIGVK   R     GPP   K   +ARAVAN    FF
Sbjct: 214 AQ---IKEMVELPLRHPALFKAIGVK-PPRGILLYGPPGTGKT-LIARAVANETGAFF 266



 Score =  101 bits (241), Expect = 5e-21
 Identities = 48/65 (73%), Positives = 61/65 (93%)
 Frame = +2

Query: 62  ADNKSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGKR 241
           AD+K  DDLSTAIL++K+RPNRLIV+EA+++DNSVV+LSQ KM++LQLFRGDTVLLKGK+
Sbjct: 5   ADSKG-DDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKK 63

Query: 242 RKETV 256
           R+E V
Sbjct: 64  RREAV 68


>AF313485-1|AAG29873.1|  307|Homo sapiens valosin-containing protein
           protein.
          Length = 307

 Score =  160 bits (388), Expect = 7e-39
 Identities = 97/213 (45%), Positives = 123/213 (57%), Gaps = 2/213 (0%)
 Frame = +1

Query: 256 CIVLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHILPIDDSVEGLTG 435
           CIVLSDD C DEKIRM             DV+SI PCP VKYGKR+H+LPIDD+VEG+TG
Sbjct: 7   CIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITG 66

Query: 436 NLFEVYLKPYFMEAYRPIHRDDTFRSAGACAPSSSKWSKQIHHHFASWLLIP*YTVTVNR 615
           NLFEVYLKPYF+EAYRPI + D F   G       K  +     +   ++ P   +    
Sbjct: 67  NLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYC--IVAPDTVIHCEG 124

Query: 616 LNVRKKRKH*MLSAMMTSAV--VANNWAQIKEMVELPLRSSFTVSRLLE*KLPRGILHVW 789
             ++++ +   L+ +    +       AQIKEMVELPLR    + + +  K PRGIL ++
Sbjct: 125 EPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHP-ALFKAIGVKPPRGIL-LY 182

Query: 790 GRLVTGKNTHWLVLLLMETGASSFLINGPGIMS 888
           G   TGK T     +  ETGA  FLINGP IMS
Sbjct: 183 GPPGTGK-TLIARAVANETGAFFFLINGPEIMS 214



 Score =  138 bits (333), Expect = 3e-32
 Identities = 76/118 (64%), Positives = 83/118 (70%), Gaps = 2/118 (1%)
 Frame = +3

Query: 510 VRGGMRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 689
           VRGGMRAVEFKVVETDPSP+CIVAPDTVIHC+GEPIKRE+EEE+LN VGYDDIGGCRKQL
Sbjct: 92  VRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQL 151

Query: 690 GAN*GDGGVATAVILH--CFKAIGVKASTRHSPCMGPPXNRKKHSLARAVANGNRGFF 857
                   +    + H   FKAIGVK   R     GPP   K   +ARAVAN    FF
Sbjct: 152 AQ---IKEMVELPLRHPALFKAIGVK-PPRGILLYGPPGTGKT-LIARAVANETGAFF 204


>BC007562-1|AAH07562.2|  644|Homo sapiens VCP protein protein.
          Length = 644

 Score =  120 bits (289), Expect = 7e-27
 Identities = 67/109 (61%), Positives = 74/109 (67%), Gaps = 2/109 (1%)
 Frame = +3

Query: 537 FKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQLGAN*GDGGV 716
           FKVVETDPSP+CIVAPDTVIHC+GEPIKRE+EEE+LN VGYDDIGGCRKQL        +
Sbjct: 1   FKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQ---IKEM 57

Query: 717 ATAVILH--CFKAIGVKASTRHSPCMGPPXNRKKHSLARAVANGNRGFF 857
               + H   FKAIGVK   R     GPP   K   +ARAVAN    FF
Sbjct: 58  VELPLRHPALFKAIGVK-PPRGILLYGPPGTGKT-LIARAVANETGAFF 104



 Score = 50.4 bits (115), Expect = 9e-06
 Identities = 36/66 (54%), Positives = 42/66 (63%)
 Frame = +1

Query: 691 AQIKEMVELPLRSSFTVSRLLE*KLPRGILHVWGRLVTGKNTHWLVLLLMETGASSFLIN 870
           AQIKEMVELPLR    + + +  K PRGIL ++G   TGK T     +  ETGA  FLIN
Sbjct: 52  AQIKEMVELPLRHP-ALFKAIGVKPPRGIL-LYGPPGTGK-TLIARAVANETGAFFFLIN 108

Query: 871 GPGIMS 888
           GP IMS
Sbjct: 109 GPEIMS 114


>AB065574-1|BAC05807.1|  337|Homo sapiens seven transmembrane helix
           receptor protein.
          Length = 337

 Score = 32.7 bits (71), Expect = 1.8
 Identities = 15/47 (31%), Positives = 30/47 (63%)
 Frame = +2

Query: 440 YSKYT*SRTSWRLTVRSIVTTPSGPRGHARRRVQSGRNRSITILHRG 580
           Y++   ++ +W L+ R++   PSG R   +RR +SG+ RS++ + +G
Sbjct: 24  YTRSCPTQRAWTLSHRALTVQPSGKRSGVQRR-KSGQPRSLSTMAQG 69


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 135,576,268
Number of Sequences: 237096
Number of extensions: 2971610
Number of successful extensions: 6362
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 6073
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6348
length of database: 76,859,062
effective HSP length: 90
effective length of database: 55,520,422
effective search space used: 11381686510
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -