SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30163.Seq
         (824 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X95325-1|CAA64631.1|  372|Homo sapiens DNA-binding protein protein.   117   6e-26
X72712-1|CAA51261.1|  372|Homo sapiens cold shock domain protein...   117   6e-26
M24069-1|AAA35749.1|  412|Homo sapiens protein ( Human DNA-bindi...   117   6e-26
L29071-1|AAA79243.1|  342|Homo sapiens DNA-binding protein A pro...   117   6e-26
BC021926-1|AAH21926.1|  372|Homo sapiens cold shock domain prote...   117   6e-26
BC015913-1|AAH15913.1|  303|Homo sapiens CSDA protein protein.        117   6e-26
BC015564-1|AAH15564.1|  372|Homo sapiens cold shock domain prote...   117   6e-26
BC008801-1|AAH08801.1|  372|Homo sapiens cold shock domain prote...   117   6e-26
AB209896-1|BAD93133.1|  134|Homo sapiens CSDA protein variant pr...   117   6e-26
BC009744-1|AAH09744.1|  303|Homo sapiens CSDA protein protein.        116   1e-25
M85234-1|AAA36569.1|  322|Homo sapiens nuclease sensitive elemen...   114   3e-25
M83234-1|AAA59949.1|  320|Homo sapiens DNA-binding protein protein.   114   3e-25
M24070-1|AAA35750.1|  364|Homo sapiens protein ( Human DNA-bindi...   114   3e-25
L28809-1|AAA20871.1|  324|Homo sapiens protein ( Homo sapiens db...   114   3e-25
BC106045-1|AAI06046.1|  324|Homo sapiens Y box binding protein 1...   114   3e-25
BC098435-1|AAH98435.1|  324|Homo sapiens Y box binding protein 1...   114   3e-25
BC090038-1|AAH90038.1|  324|Homo sapiens Y box binding protein 1...   114   3e-25
BC072014-1|AAH72014.1|  266|Homo sapiens YBX1 protein protein.        114   3e-25
BC071708-1|AAH71708.1|  324|Homo sapiens Y box binding protein 1...   114   3e-25
BC070084-1|AAH70084.1|  324|Homo sapiens Y box binding protein 1...   114   3e-25
BC065571-1|AAH65571.1|  324|Homo sapiens Y box binding protein 1...   114   3e-25
BC038384-1|AAH38384.1|  324|Homo sapiens Y box binding protein 1...   114   3e-25
BC018393-1|AAH18393.1|  267|Homo sapiens Unknown (protein for IM...   114   3e-25
BC015208-1|AAH15208.1|  324|Homo sapiens Y box binding protein 1...   114   3e-25
BC010430-1|AAH10430.1|  324|Homo sapiens Y box binding protein 1...   114   3e-25
BC002411-1|AAH02411.1|  324|Homo sapiens Y box binding protein 1...   114   3e-25
BC000064-1|AAH00064.1|  266|Homo sapiens YBX1 protein protein.        114   3e-25
J03827-1|AAA61308.1|  317|Homo sapiens NFYA protein.                  114   4e-25
BC047760-1|AAH47760.1|  364|Homo sapiens Y box binding protein 2...   113   6e-25
BC033800-1|AAH33800.1|  364|Homo sapiens Y box binding protein 2...   113   6e-25
AF096834-1|AAD30662.1|  364|Homo sapiens germ cell specific Y-bo...   113   6e-25
DQ120685-1|ABB92460.1|  319|Homo sapiens rcNSEP1 protein.             108   3e-23
AB208818-1|BAD92055.1|  268|Homo sapiens germ cell specific Y-bo...    95   4e-19
Z95329-1|CAI21661.2|  250|Homo sapiens lin-28 homolog B (C. eleg...    48   3e-05
DQ127228-1|AAZ38897.1|  250|Homo sapiens LIN28B protein.               48   3e-05
BC150538-1|AAI50539.1|  227|Homo sapiens Unknown (protein for IM...    48   3e-05
BC150537-1|AAI50538.1|  227|Homo sapiens Unknown (protein for IM...    48   3e-05
BC141960-1|AAI41961.1|  227|Homo sapiens LIN28B protein protein.       48   3e-05
BC127713-1|AAI27714.1|  227|Homo sapiens LIN28B protein protein.       48   3e-05
BC127712-1|AAI27713.1|  227|Homo sapiens LIN28B protein protein.       48   3e-05
AL135911-2|CAI20969.2|  250|Homo sapiens lin-28 homolog B (C. el...    48   3e-05
AK131411-1|BAD18558.1|  250|Homo sapiens protein ( Homo sapiens ...    48   3e-05
BC028566-1|AAH28566.1|  209|Homo sapiens LIN28 protein protein.        44   5e-04
AL513365-12|CAI21500.1|  209|Homo sapiens lin-28 homolog (C. ele...    44   5e-04
AK022519-1|BAB14075.1|  209|Homo sapiens protein ( Homo sapiens ...    44   5e-04
AF521099-1|AAM77751.1|  209|Homo sapiens RNA-binding protein LIN...    44   5e-04
Z74615-1|CAA98968.1| 1464|Homo sapiens prepro-alpha1(I) collagen...    31   6.7  
X98705-1|CAA67261.1| 1069|Homo sapiens collagen type I alpha 1 p...    31   6.7  
K01228-1|AAA51995.1| 1040|Homo sapiens COL1A1 protein.                 31   6.7  
BC036531-1|AAH36531.1| 1464|Homo sapiens collagen, type I, alpha...    31   6.7  
AF017178-1|AAB94054.2| 1461|Homo sapiens pro alpha 1(I) collagen...    31   6.7  
AB209597-1|BAD92834.1| 1467|Homo sapiens Collagen alpha 1 chain ...    31   6.7  

>X95325-1|CAA64631.1|  372|Homo sapiens DNA-binding protein protein.
          Length = 372

 Score =  117 bits (281), Expect = 6e-26
 Identities = 57/81 (70%), Positives = 65/81 (80%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  ++DTKEDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGP G PV
Sbjct: 106 FINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPV 165

Query: 421 KGSPYAADKRRGYHRQYFPRQ 483
           +GS YAAD+RR Y R Y+ R+
Sbjct: 166 EGSRYAADRRR-YRRGYYGRR 185



 Score = 46.8 bits (106), Expect = 1e-04
 Identities = 19/24 (79%), Positives = 22/24 (91%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           V+A KV GTVKWFNV++GYGFINR
Sbjct: 86  VLATKVLGTVKWFNVRNGYGFINR 109


>X72712-1|CAA51261.1|  372|Homo sapiens cold shock domain protein A
           protein.
          Length = 372

 Score =  117 bits (281), Expect = 6e-26
 Identities = 57/81 (70%), Positives = 65/81 (80%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  ++DTKEDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGP G PV
Sbjct: 106 FINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPV 165

Query: 421 KGSPYAADKRRGYHRQYFPRQ 483
           +GS YAAD+RR Y R Y+ R+
Sbjct: 166 EGSRYAADRRR-YRRGYYGRR 185



 Score = 46.8 bits (106), Expect = 1e-04
 Identities = 19/24 (79%), Positives = 22/24 (91%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           V+A KV GTVKWFNV++GYGFINR
Sbjct: 86  VLATKVLGTVKWFNVRNGYGFINR 109


>M24069-1|AAA35749.1|  412|Homo sapiens protein ( Human DNA-binding
           protein A (dbpA) gene, 3' end. ).
          Length = 412

 Score =  117 bits (281), Expect = 6e-26
 Identities = 57/81 (70%), Positives = 65/81 (80%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  ++DTKEDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGP G PV
Sbjct: 176 FINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPV 235

Query: 421 KGSPYAADKRRGYHRQYFPRQ 483
           +GS YAAD+RR Y R Y+ R+
Sbjct: 236 EGSRYAADRRR-YRRGYYGRR 255



 Score = 46.8 bits (106), Expect = 1e-04
 Identities = 19/24 (79%), Positives = 22/24 (91%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           V+A KV GTVKWFNV++GYGFINR
Sbjct: 156 VLATKVLGTVKWFNVRNGYGFINR 179


>L29071-1|AAA79243.1|  342|Homo sapiens DNA-binding protein A
           protein.
          Length = 342

 Score =  117 bits (281), Expect = 6e-26
 Identities = 57/81 (70%), Positives = 65/81 (80%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  ++DTKEDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGP G PV
Sbjct: 106 FINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPV 165

Query: 421 KGSPYAADKRRGYHRQYFPRQ 483
           +GS YAAD+RR Y R Y+ R+
Sbjct: 166 EGSRYAADRRR-YRRGYYGRR 185



 Score = 46.8 bits (106), Expect = 1e-04
 Identities = 19/24 (79%), Positives = 22/24 (91%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           V+A KV GTVKWFNV++GYGFINR
Sbjct: 86  VLATKVLGTVKWFNVRNGYGFINR 109


>BC021926-1|AAH21926.1|  372|Homo sapiens cold shock domain protein
           A protein.
          Length = 372

 Score =  117 bits (281), Expect = 6e-26
 Identities = 57/81 (70%), Positives = 65/81 (80%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  ++DTKEDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGP G PV
Sbjct: 106 FINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPV 165

Query: 421 KGSPYAADKRRGYHRQYFPRQ 483
           +GS YAAD+RR Y R Y+ R+
Sbjct: 166 EGSRYAADRRR-YRRGYYGRR 185



 Score = 46.8 bits (106), Expect = 1e-04
 Identities = 19/24 (79%), Positives = 22/24 (91%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           V+A KV GTVKWFNV++GYGFINR
Sbjct: 86  VLATKVLGTVKWFNVRNGYGFINR 109


>BC015913-1|AAH15913.1|  303|Homo sapiens CSDA protein protein.
          Length = 303

 Score =  117 bits (281), Expect = 6e-26
 Identities = 57/81 (70%), Positives = 65/81 (80%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  ++DTKEDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGP G PV
Sbjct: 106 FINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPV 165

Query: 421 KGSPYAADKRRGYHRQYFPRQ 483
           +GS YAAD+RR Y R Y+ R+
Sbjct: 166 EGSRYAADRRR-YRRGYYGRR 185



 Score = 46.8 bits (106), Expect = 1e-04
 Identities = 19/24 (79%), Positives = 22/24 (91%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           V+A KV GTVKWFNV++GYGFINR
Sbjct: 86  VLATKVLGTVKWFNVRNGYGFINR 109


>BC015564-1|AAH15564.1|  372|Homo sapiens cold shock domain protein
           A protein.
          Length = 372

 Score =  117 bits (281), Expect = 6e-26
 Identities = 57/81 (70%), Positives = 65/81 (80%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  ++DTKEDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGP G PV
Sbjct: 106 FINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPV 165

Query: 421 KGSPYAADKRRGYHRQYFPRQ 483
           +GS YAAD+RR Y R Y+ R+
Sbjct: 166 EGSRYAADRRR-YRRGYYGRR 185



 Score = 46.8 bits (106), Expect = 1e-04
 Identities = 19/24 (79%), Positives = 22/24 (91%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           V+A KV GTVKWFNV++GYGFINR
Sbjct: 86  VLATKVLGTVKWFNVRNGYGFINR 109


>BC008801-1|AAH08801.1|  372|Homo sapiens cold shock domain protein
           A protein.
          Length = 372

 Score =  117 bits (281), Expect = 6e-26
 Identities = 57/81 (70%), Positives = 65/81 (80%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  ++DTKEDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGP G PV
Sbjct: 106 FINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPV 165

Query: 421 KGSPYAADKRRGYHRQYFPRQ 483
           +GS YAAD+RR Y R Y+ R+
Sbjct: 166 EGSRYAADRRR-YRRGYYGRR 185



 Score = 46.8 bits (106), Expect = 1e-04
 Identities = 19/24 (79%), Positives = 22/24 (91%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           V+A KV GTVKWFNV++GYGFINR
Sbjct: 86  VLATKVLGTVKWFNVRNGYGFINR 109


>AB209896-1|BAD93133.1|  134|Homo sapiens CSDA protein variant
           protein.
          Length = 134

 Score =  117 bits (281), Expect = 6e-26
 Identities = 57/81 (70%), Positives = 65/81 (80%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  ++DTKEDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGP G PV
Sbjct: 39  FINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPV 98

Query: 421 KGSPYAADKRRGYHRQYFPRQ 483
           +GS YAAD+RR Y R Y+ R+
Sbjct: 99  EGSRYAADRRR-YRRGYYGRR 118



 Score = 46.8 bits (106), Expect = 1e-04
 Identities = 19/24 (79%), Positives = 22/24 (91%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           V+A KV GTVKWFNV++GYGFINR
Sbjct: 19  VLATKVLGTVKWFNVRNGYGFINR 42


>BC009744-1|AAH09744.1|  303|Homo sapiens CSDA protein protein.
          Length = 303

 Score =  116 bits (278), Expect = 1e-25
 Identities = 56/81 (69%), Positives = 65/81 (80%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  ++DTKEDVFVHQTAI +NNPRK +RS+GDGE VEF VV GEKG EAA VTGP G PV
Sbjct: 106 FINRNDTKEDVFVHQTAIKKNNPRKYLRSLGDGETVEFDVVEGEKGAEAANVTGPDGVPV 165

Query: 421 KGSPYAADKRRGYHRQYFPRQ 483
           +GS YAAD+RR Y R Y+ R+
Sbjct: 166 EGSRYAADRRR-YRRGYYGRR 185



 Score = 46.8 bits (106), Expect = 1e-04
 Identities = 19/24 (79%), Positives = 22/24 (91%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           V+A KV GTVKWFNV++GYGFINR
Sbjct: 86  VLATKVLGTVKWFNVRNGYGFINR 109


>M85234-1|AAA36569.1|  322|Homo sapiens nuclease sensitive element
           binding protein-1 protein.
          Length = 322

 Score =  114 bits (275), Expect = 3e-25
 Identities = 57/81 (70%), Positives = 66/81 (81%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  ++DTKEDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGPGG PV
Sbjct: 73  FINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPV 132

Query: 421 KGSPYAADKRRGYHRQYFPRQ 483
           +GS YAAD  R ++R+Y PR+
Sbjct: 133 QGSKYAAD--RNHYRRY-PRR 150



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 20/24 (83%), Positives = 22/24 (91%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           VIA KV GTVKWFNV++GYGFINR
Sbjct: 53  VIATKVLGTVKWFNVRNGYGFINR 76


>M83234-1|AAA59949.1|  320|Homo sapiens DNA-binding protein protein.
          Length = 320

 Score =  114 bits (275), Expect = 3e-25
 Identities = 57/81 (70%), Positives = 66/81 (81%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  ++DTKEDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGPGG PV
Sbjct: 71  FINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPV 130

Query: 421 KGSPYAADKRRGYHRQYFPRQ 483
           +GS YAAD  R ++R+Y PR+
Sbjct: 131 QGSKYAAD--RNHYRRY-PRR 148



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 20/24 (83%), Positives = 22/24 (91%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           VIA KV GTVKWFNV++GYGFINR
Sbjct: 51  VIATKVLGTVKWFNVRNGYGFINR 74


>M24070-1|AAA35750.1|  364|Homo sapiens protein ( Human DNA-binding
           protein B (dbpB) gene, 3' end. ).
          Length = 364

 Score =  114 bits (275), Expect = 3e-25
 Identities = 57/81 (70%), Positives = 66/81 (81%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  ++DTKEDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGPGG PV
Sbjct: 114 FINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPV 173

Query: 421 KGSPYAADKRRGYHRQYFPRQ 483
           +GS YAAD  R ++R+Y PR+
Sbjct: 174 QGSKYAAD--RNHYRRY-PRR 191



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 20/24 (83%), Positives = 22/24 (91%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           VIA KV GTVKWFNV++GYGFINR
Sbjct: 94  VIATKVLGTVKWFNVRNGYGFINR 117


>L28809-1|AAA20871.1|  324|Homo sapiens protein ( Homo sapiens
           dbpB-like protein mRNA, complete cds. ).
          Length = 324

 Score =  114 bits (275), Expect = 3e-25
 Identities = 57/81 (70%), Positives = 66/81 (81%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  ++DTKEDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGPGG PV
Sbjct: 74  FINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPV 133

Query: 421 KGSPYAADKRRGYHRQYFPRQ 483
           +GS YAAD  R ++R+Y PR+
Sbjct: 134 QGSKYAAD--RNHYRRY-PRR 151



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 20/24 (83%), Positives = 22/24 (91%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           VIA KV GTVKWFNV++GYGFINR
Sbjct: 54  VIATKVLGTVKWFNVRNGYGFINR 77


>BC106045-1|AAI06046.1|  324|Homo sapiens Y box binding protein 1
           protein.
          Length = 324

 Score =  114 bits (275), Expect = 3e-25
 Identities = 57/81 (70%), Positives = 66/81 (81%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  ++DTKEDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGPGG PV
Sbjct: 74  FINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPV 133

Query: 421 KGSPYAADKRRGYHRQYFPRQ 483
           +GS YAAD  R ++R+Y PR+
Sbjct: 134 QGSKYAAD--RNHYRRY-PRR 151



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 20/24 (83%), Positives = 22/24 (91%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           VIA KV GTVKWFNV++GYGFINR
Sbjct: 54  VIATKVLGTVKWFNVRNGYGFINR 77


>BC098435-1|AAH98435.1|  324|Homo sapiens Y box binding protein 1
           protein.
          Length = 324

 Score =  114 bits (275), Expect = 3e-25
 Identities = 57/81 (70%), Positives = 66/81 (81%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  ++DTKEDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGPGG PV
Sbjct: 74  FINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPV 133

Query: 421 KGSPYAADKRRGYHRQYFPRQ 483
           +GS YAAD  R ++R+Y PR+
Sbjct: 134 QGSKYAAD--RNHYRRY-PRR 151



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 20/24 (83%), Positives = 22/24 (91%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           VIA KV GTVKWFNV++GYGFINR
Sbjct: 54  VIATKVLGTVKWFNVRNGYGFINR 77


>BC090038-1|AAH90038.1|  324|Homo sapiens Y box binding protein 1
           protein.
          Length = 324

 Score =  114 bits (275), Expect = 3e-25
 Identities = 57/81 (70%), Positives = 66/81 (81%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  ++DTKEDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGPGG PV
Sbjct: 74  FINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPV 133

Query: 421 KGSPYAADKRRGYHRQYFPRQ 483
           +GS YAAD  R ++R+Y PR+
Sbjct: 134 QGSKYAAD--RNHYRRY-PRR 151



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 20/24 (83%), Positives = 22/24 (91%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           VIA KV GTVKWFNV++GYGFINR
Sbjct: 54  VIATKVLGTVKWFNVRNGYGFINR 77


>BC072014-1|AAH72014.1|  266|Homo sapiens YBX1 protein protein.
          Length = 266

 Score =  114 bits (275), Expect = 3e-25
 Identities = 57/81 (70%), Positives = 66/81 (81%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  ++DTKEDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGPGG PV
Sbjct: 74  FINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPV 133

Query: 421 KGSPYAADKRRGYHRQYFPRQ 483
           +GS YAAD  R ++R+Y PR+
Sbjct: 134 QGSKYAAD--RNHYRRY-PRR 151



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 20/24 (83%), Positives = 22/24 (91%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           VIA KV GTVKWFNV++GYGFINR
Sbjct: 54  VIATKVLGTVKWFNVRNGYGFINR 77


>BC071708-1|AAH71708.1|  324|Homo sapiens Y box binding protein 1
           protein.
          Length = 324

 Score =  114 bits (275), Expect = 3e-25
 Identities = 57/81 (70%), Positives = 66/81 (81%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  ++DTKEDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGPGG PV
Sbjct: 74  FINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPV 133

Query: 421 KGSPYAADKRRGYHRQYFPRQ 483
           +GS YAAD  R ++R+Y PR+
Sbjct: 134 QGSKYAAD--RNHYRRY-PRR 151



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 20/24 (83%), Positives = 22/24 (91%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           VIA KV GTVKWFNV++GYGFINR
Sbjct: 54  VIATKVLGTVKWFNVRNGYGFINR 77


>BC070084-1|AAH70084.1|  324|Homo sapiens Y box binding protein 1
           protein.
          Length = 324

 Score =  114 bits (275), Expect = 3e-25
 Identities = 57/81 (70%), Positives = 66/81 (81%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  ++DTKEDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGPGG PV
Sbjct: 74  FINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPV 133

Query: 421 KGSPYAADKRRGYHRQYFPRQ 483
           +GS YAAD  R ++R+Y PR+
Sbjct: 134 QGSKYAAD--RNHYRRY-PRR 151



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 20/24 (83%), Positives = 22/24 (91%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           VIA KV GTVKWFNV++GYGFINR
Sbjct: 54  VIATKVLGTVKWFNVRNGYGFINR 77


>BC065571-1|AAH65571.1|  324|Homo sapiens Y box binding protein 1
           protein.
          Length = 324

 Score =  114 bits (275), Expect = 3e-25
 Identities = 57/81 (70%), Positives = 66/81 (81%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  ++DTKEDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGPGG PV
Sbjct: 74  FINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPV 133

Query: 421 KGSPYAADKRRGYHRQYFPRQ 483
           +GS YAAD  R ++R+Y PR+
Sbjct: 134 QGSKYAAD--RNHYRRY-PRR 151



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 20/24 (83%), Positives = 22/24 (91%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           VIA KV GTVKWFNV++GYGFINR
Sbjct: 54  VIATKVLGTVKWFNVRNGYGFINR 77


>BC038384-1|AAH38384.1|  324|Homo sapiens Y box binding protein 1
           protein.
          Length = 324

 Score =  114 bits (275), Expect = 3e-25
 Identities = 57/81 (70%), Positives = 66/81 (81%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  ++DTKEDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGPGG PV
Sbjct: 74  FINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPV 133

Query: 421 KGSPYAADKRRGYHRQYFPRQ 483
           +GS YAAD  R ++R+Y PR+
Sbjct: 134 QGSKYAAD--RNHYRRY-PRR 151



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 20/24 (83%), Positives = 22/24 (91%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           VIA KV GTVKWFNV++GYGFINR
Sbjct: 54  VIATKVLGTVKWFNVRNGYGFINR 77


>BC018393-1|AAH18393.1|  267|Homo sapiens Unknown (protein for
           IMAGE:3882730) protein.
          Length = 267

 Score =  114 bits (275), Expect = 3e-25
 Identities = 57/81 (70%), Positives = 66/81 (81%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  ++DTKEDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGPGG PV
Sbjct: 74  FINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPV 133

Query: 421 KGSPYAADKRRGYHRQYFPRQ 483
           +GS YAAD  R ++R+Y PR+
Sbjct: 134 QGSKYAAD--RNHYRRY-PRR 151



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 20/24 (83%), Positives = 22/24 (91%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           VIA KV GTVKWFNV++GYGFINR
Sbjct: 54  VIATKVLGTVKWFNVRNGYGFINR 77


>BC015208-1|AAH15208.1|  324|Homo sapiens Y box binding protein 1
           protein.
          Length = 324

 Score =  114 bits (275), Expect = 3e-25
 Identities = 57/81 (70%), Positives = 66/81 (81%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  ++DTKEDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGPGG PV
Sbjct: 74  FINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPV 133

Query: 421 KGSPYAADKRRGYHRQYFPRQ 483
           +GS YAAD  R ++R+Y PR+
Sbjct: 134 QGSKYAAD--RNHYRRY-PRR 151



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 20/24 (83%), Positives = 22/24 (91%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           VIA KV GTVKWFNV++GYGFINR
Sbjct: 54  VIATKVLGTVKWFNVRNGYGFINR 77


>BC010430-1|AAH10430.1|  324|Homo sapiens Y box binding protein 1
           protein.
          Length = 324

 Score =  114 bits (275), Expect = 3e-25
 Identities = 57/81 (70%), Positives = 66/81 (81%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  ++DTKEDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGPGG PV
Sbjct: 74  FINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPV 133

Query: 421 KGSPYAADKRRGYHRQYFPRQ 483
           +GS YAAD  R ++R+Y PR+
Sbjct: 134 QGSKYAAD--RNHYRRY-PRR 151



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 20/24 (83%), Positives = 22/24 (91%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           VIA KV GTVKWFNV++GYGFINR
Sbjct: 54  VIATKVLGTVKWFNVRNGYGFINR 77


>BC002411-1|AAH02411.1|  324|Homo sapiens Y box binding protein 1
           protein.
          Length = 324

 Score =  114 bits (275), Expect = 3e-25
 Identities = 57/81 (70%), Positives = 66/81 (81%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  ++DTKEDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGPGG PV
Sbjct: 74  FINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPV 133

Query: 421 KGSPYAADKRRGYHRQYFPRQ 483
           +GS YAAD  R ++R+Y PR+
Sbjct: 134 QGSKYAAD--RNHYRRY-PRR 151



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 20/24 (83%), Positives = 22/24 (91%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           VIA KV GTVKWFNV++GYGFINR
Sbjct: 54  VIATKVLGTVKWFNVRNGYGFINR 77


>BC000064-1|AAH00064.1|  266|Homo sapiens YBX1 protein protein.
          Length = 266

 Score =  114 bits (275), Expect = 3e-25
 Identities = 57/81 (70%), Positives = 66/81 (81%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  ++DTKEDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGPGG PV
Sbjct: 74  FINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPV 133

Query: 421 KGSPYAADKRRGYHRQYFPRQ 483
           +GS YAAD  R ++R+Y PR+
Sbjct: 134 QGSKYAAD--RNHYRRY-PRR 151



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 20/24 (83%), Positives = 22/24 (91%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           VIA KV GTVKWFNV++GYGFINR
Sbjct: 54  VIATKVLGTVKWFNVRNGYGFINR 77


>J03827-1|AAA61308.1|  317|Homo sapiens NFYA protein.
          Length = 317

 Score =  114 bits (274), Expect = 4e-25
 Identities = 57/81 (70%), Positives = 66/81 (81%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  ++DTKEDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGPGG PV
Sbjct: 74  FINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGEEAANVTGPGGVPV 133

Query: 421 KGSPYAADKRRGYHRQYFPRQ 483
           +GS YAAD  R ++R+Y PR+
Sbjct: 134 QGSKYAAD--RNHYRRY-PRR 151



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 20/24 (83%), Positives = 22/24 (91%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           VIA KV GTVKWFNV++GYGFINR
Sbjct: 54  VIATKVLGTVKWFNVRNGYGFINR 77


>BC047760-1|AAH47760.1|  364|Homo sapiens Y box binding protein 2
           protein.
          Length = 364

 Score =  113 bits (273), Expect = 6e-25
 Identities = 55/80 (68%), Positives = 63/80 (78%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  ++DTKEDVFVHQTAI RNNPRK +RSVGDGE VEF VV GEKG EA  VTGPGG PV
Sbjct: 109 FINRNDTKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEATNVTGPGGVPV 168

Query: 421 KGSPYAADKRRGYHRQYFPR 480
           KGS YA ++R+   R++ PR
Sbjct: 169 KGSRYAPNRRKS--RRFIPR 186



 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 18/24 (75%), Positives = 22/24 (91%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           V+A +V GTVKWFNV++GYGFINR
Sbjct: 89  VLAIQVLGTVKWFNVRNGYGFINR 112


>BC033800-1|AAH33800.1|  364|Homo sapiens Y box binding protein 2
           protein.
          Length = 364

 Score =  113 bits (273), Expect = 6e-25
 Identities = 55/80 (68%), Positives = 63/80 (78%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  ++DTKEDVFVHQTAI RNNPRK +RSVGDGE VEF VV GEKG EA  VTGPGG PV
Sbjct: 109 FINRNDTKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEATNVTGPGGVPV 168

Query: 421 KGSPYAADKRRGYHRQYFPR 480
           KGS YA ++R+   R++ PR
Sbjct: 169 KGSRYAPNRRKS--RRFIPR 186



 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 18/24 (75%), Positives = 22/24 (91%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           V+A +V GTVKWFNV++GYGFINR
Sbjct: 89  VLAIQVLGTVKWFNVRNGYGFINR 112


>AF096834-1|AAD30662.1|  364|Homo sapiens germ cell specific Y-box
           binding protein protein.
          Length = 364

 Score =  113 bits (273), Expect = 6e-25
 Identities = 55/80 (68%), Positives = 63/80 (78%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  ++DTKEDVFVHQTAI RNNPRK +RSVGDGE VEF VV GEKG EA  VTGPGG PV
Sbjct: 109 FINRNDTKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEATNVTGPGGVPV 168

Query: 421 KGSPYAADKRRGYHRQYFPR 480
           KGS YA ++R+   R++ PR
Sbjct: 169 KGSRYAPNRRKS--RRFIPR 186



 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 18/24 (75%), Positives = 22/24 (91%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           V+A +V GTVKWFNV++GYGFINR
Sbjct: 89  VLAIQVLGTVKWFNVRNGYGFINR 112


>DQ120685-1|ABB92460.1|  319|Homo sapiens rcNSEP1 protein.
          Length = 319

 Score =  108 bits (259), Expect = 3e-23
 Identities = 54/80 (67%), Positives = 63/80 (78%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  ++DTKEDVFVH TA  +NNPRK +RSVGDGE VEF VV GEKG +AA VTGPGG PV
Sbjct: 70  FIHRNDTKEDVFVHHTAXKKNNPRKYLRSVGDGEXVEFDVVEGEKGAKAANVTGPGGVPV 129

Query: 421 KGSPYAADKRRGYHRQYFPR 480
           +GS YAAD  R ++R+Y PR
Sbjct: 130 QGSKYAAD--RNHYRRY-PR 146



 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 19/24 (79%), Positives = 22/24 (91%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINR 253
           VIA KV GTVKWFNV++GYGFI+R
Sbjct: 50  VIATKVLGTVKWFNVRNGYGFIHR 73


>AB208818-1|BAD92055.1|  268|Homo sapiens germ cell specific Y-box
           binding protein variant protein.
          Length = 268

 Score = 94.7 bits (225), Expect = 4e-19
 Identities = 46/70 (65%), Positives = 54/70 (77%)
 Frame = +1

Query: 271 VFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAADKR 450
           +F +QTAI RNNPRK +RSVGDGE VEF VV GEKG EA  VTGPGG PVKGS YA ++R
Sbjct: 23  LFPNQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEATNVTGPGGVPVKGSRYAPNRR 82

Query: 451 RGYHRQYFPR 480
           +   R++ PR
Sbjct: 83  KS--RRFIPR 90


>Z95329-1|CAI21661.2|  250|Homo sapiens lin-28 homolog B (C.
           elegans) protein.
          Length = 250

 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 26/58 (44%), Positives = 32/58 (55%)
 Frame = +1

Query: 256 DTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGS 429
           D   DVFVHQ+ +      +  RS+ +GE VEF      KG E+  VTGPGG P  GS
Sbjct: 57  DIPVDVFVHQSKLFM----EGFRSLKEGEPVEFTFKKSSKGLESIRVTGPGGSPCLGS 110


>DQ127228-1|AAZ38897.1|  250|Homo sapiens LIN28B protein.
          Length = 250

 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 26/58 (44%), Positives = 32/58 (55%)
 Frame = +1

Query: 256 DTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGS 429
           D   DVFVHQ+ +      +  RS+ +GE VEF      KG E+  VTGPGG P  GS
Sbjct: 57  DIPVDVFVHQSKLFM----EGFRSLKEGEPVEFTFKKSSKGLESIRVTGPGGSPCLGS 110


>BC150538-1|AAI50539.1|  227|Homo sapiens Unknown (protein for
           IMAGE:40127315) protein.
          Length = 227

 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 26/58 (44%), Positives = 32/58 (55%)
 Frame = +1

Query: 256 DTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGS 429
           D   DVFVHQ+ +      +  RS+ +GE VEF      KG E+  VTGPGG P  GS
Sbjct: 34  DIPVDVFVHQSKLFM----EGFRSLKEGEPVEFTFKKSSKGLESIRVTGPGGSPCLGS 87


>BC150537-1|AAI50538.1|  227|Homo sapiens Unknown (protein for
           IMAGE:40127314) protein.
          Length = 227

 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 26/58 (44%), Positives = 32/58 (55%)
 Frame = +1

Query: 256 DTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGS 429
           D   DVFVHQ+ +      +  RS+ +GE VEF      KG E+  VTGPGG P  GS
Sbjct: 34  DIPVDVFVHQSKLFM----EGFRSLKEGEPVEFTFKKSSKGLESIRVTGPGGSPCLGS 87


>BC141960-1|AAI41961.1|  227|Homo sapiens LIN28B protein protein.
          Length = 227

 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 26/58 (44%), Positives = 32/58 (55%)
 Frame = +1

Query: 256 DTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGS 429
           D   DVFVHQ+ +      +  RS+ +GE VEF      KG E+  VTGPGG P  GS
Sbjct: 34  DIPVDVFVHQSKLFM----EGFRSLKEGEPVEFTFKKSSKGLESIRVTGPGGSPCLGS 87


>BC127713-1|AAI27714.1|  227|Homo sapiens LIN28B protein protein.
          Length = 227

 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 26/58 (44%), Positives = 32/58 (55%)
 Frame = +1

Query: 256 DTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGS 429
           D   DVFVHQ+ +      +  RS+ +GE VEF      KG E+  VTGPGG P  GS
Sbjct: 34  DIPVDVFVHQSKLFM----EGFRSLKEGEPVEFTFKKSSKGLESIRVTGPGGSPCLGS 87


>BC127712-1|AAI27713.1|  227|Homo sapiens LIN28B protein protein.
          Length = 227

 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 26/58 (44%), Positives = 32/58 (55%)
 Frame = +1

Query: 256 DTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGS 429
           D   DVFVHQ+ +      +  RS+ +GE VEF      KG E+  VTGPGG P  GS
Sbjct: 34  DIPVDVFVHQSKLFM----EGFRSLKEGEPVEFTFKKSSKGLESIRVTGPGGSPCLGS 87


>AL135911-2|CAI20969.2|  250|Homo sapiens lin-28 homolog B (C.
           elegans) protein.
          Length = 250

 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 26/58 (44%), Positives = 32/58 (55%)
 Frame = +1

Query: 256 DTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGS 429
           D   DVFVHQ+ +      +  RS+ +GE VEF      KG E+  VTGPGG P  GS
Sbjct: 57  DIPVDVFVHQSKLFM----EGFRSLKEGEPVEFTFKKSSKGLESIRVTGPGGSPCLGS 110


>AK131411-1|BAD18558.1|  250|Homo sapiens protein ( Homo sapiens
           cDNA FLJ16517 fis, clone NT2RI3007167. ).
          Length = 250

 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 26/58 (44%), Positives = 32/58 (55%)
 Frame = +1

Query: 256 DTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGS 429
           D   DVFVHQ+ +      +  RS+ +GE VEF      KG E+  VTGPGG P  GS
Sbjct: 57  DIPVDVFVHQSKLFM----EGFRSLKEGEPVEFTFKKSSKGLESIRVTGPGGSPCLGS 110


>BC028566-1|AAH28566.1|  209|Homo sapiens LIN28 protein protein.
          Length = 209

 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 24/52 (46%), Positives = 30/52 (57%)
 Frame = +1

Query: 256 DTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGG 411
           D   DVFVHQ+ +      +  RS+ +GEAVEF      KG E+  VTGPGG
Sbjct: 67  DPPVDVFVHQSKLHM----EGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGG 114



 Score = 30.3 bits (65), Expect = 8.8
 Identities = 12/22 (54%), Positives = 17/22 (77%)
 Frame = +2

Query: 200 SGTVKWFNVKSGYGFINRMTPR 265
           +G  KWFNV+ G+GF++ MT R
Sbjct: 41  AGICKWFNVRMGFGFLS-MTAR 61


>AL513365-12|CAI21500.1|  209|Homo sapiens lin-28 homolog (C.
           elegans) protein.
          Length = 209

 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 24/52 (46%), Positives = 30/52 (57%)
 Frame = +1

Query: 256 DTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGG 411
           D   DVFVHQ+ +      +  RS+ +GEAVEF      KG E+  VTGPGG
Sbjct: 67  DPPVDVFVHQSKLHM----EGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGG 114



 Score = 30.3 bits (65), Expect = 8.8
 Identities = 12/22 (54%), Positives = 17/22 (77%)
 Frame = +2

Query: 200 SGTVKWFNVKSGYGFINRMTPR 265
           +G  KWFNV+ G+GF++ MT R
Sbjct: 41  AGICKWFNVRMGFGFLS-MTAR 61


>AK022519-1|BAB14075.1|  209|Homo sapiens protein ( Homo sapiens
           cDNA FLJ12457 fis, clone NT2RM1000666, weakly similar to
           DNA-BINDING PROTEIN A. ).
          Length = 209

 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 24/52 (46%), Positives = 30/52 (57%)
 Frame = +1

Query: 256 DTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGG 411
           D   DVFVHQ+ +      +  RS+ +GEAVEF      KG E+  VTGPGG
Sbjct: 67  DPPVDVFVHQSKLHM----EGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGG 114



 Score = 30.3 bits (65), Expect = 8.8
 Identities = 12/22 (54%), Positives = 17/22 (77%)
 Frame = +2

Query: 200 SGTVKWFNVKSGYGFINRMTPR 265
           +G  KWFNV+ G+GF++ MT R
Sbjct: 41  AGICKWFNVRMGFGFLS-MTAR 61


>AF521099-1|AAM77751.1|  209|Homo sapiens RNA-binding protein LIN-28
           protein.
          Length = 209

 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 24/52 (46%), Positives = 30/52 (57%)
 Frame = +1

Query: 256 DTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGG 411
           D   DVFVHQ+ +      +  RS+ +GEAVEF      KG E+  VTGPGG
Sbjct: 67  DPPVDVFVHQSKLHM----EGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGG 114



 Score = 30.3 bits (65), Expect = 8.8
 Identities = 12/22 (54%), Positives = 17/22 (77%)
 Frame = +2

Query: 200 SGTVKWFNVKSGYGFINRMTPR 265
           +G  KWFNV+ G+GF++ MT R
Sbjct: 41  AGICKWFNVRMGFGFLS-MTAR 61


>Z74615-1|CAA98968.1| 1464|Homo sapiens prepro-alpha1(I) collagen
            protein.
          Length = 1464

 Score = 30.7 bits (66), Expect = 6.7
 Identities = 15/30 (50%), Positives = 17/30 (56%)
 Frame = +1

Query: 367  GEKGFEAAGVTGPGGEPVKGSPYAADKRRG 456
            GE+GF   G+ GP GEP K  P  A   RG
Sbjct: 968  GERGFP--GLPGPSGEPGKQGPSGASGERG 995


>X98705-1|CAA67261.1| 1069|Homo sapiens collagen type I alpha 1
            protein.
          Length = 1069

 Score = 30.7 bits (66), Expect = 6.7
 Identities = 15/30 (50%), Positives = 17/30 (56%)
 Frame = +1

Query: 367  GEKGFEAAGVTGPGGEPVKGSPYAADKRRG 456
            GE+GF   G+ GP GEP K  P  A   RG
Sbjct: 968  GERGFP--GLPGPSGEPGKQGPSGASGERG 995


>K01228-1|AAA51995.1| 1040|Homo sapiens COL1A1 protein.
          Length = 1040

 Score = 30.7 bits (66), Expect = 6.7
 Identities = 15/30 (50%), Positives = 17/30 (56%)
 Frame = +1

Query: 367 GEKGFEAAGVTGPGGEPVKGSPYAADKRRG 456
           GE+GF   G+ GP GEP K  P  A   RG
Sbjct: 544 GERGFP--GLPGPSGEPGKQGPSGASGERG 571


>BC036531-1|AAH36531.1| 1464|Homo sapiens collagen, type I, alpha 1
            protein.
          Length = 1464

 Score = 30.7 bits (66), Expect = 6.7
 Identities = 15/30 (50%), Positives = 17/30 (56%)
 Frame = +1

Query: 367  GEKGFEAAGVTGPGGEPVKGSPYAADKRRG 456
            GE+GF   G+ GP GEP K  P  A   RG
Sbjct: 968  GERGFP--GLPGPSGEPGKQGPSGASGERG 995


>AF017178-1|AAB94054.2| 1461|Homo sapiens pro alpha 1(I) collagen
            protein.
          Length = 1461

 Score = 30.7 bits (66), Expect = 6.7
 Identities = 15/30 (50%), Positives = 17/30 (56%)
 Frame = +1

Query: 367  GEKGFEAAGVTGPGGEPVKGSPYAADKRRG 456
            GE+GF   G+ GP GEP K  P  A   RG
Sbjct: 965  GERGFP--GLPGPSGEPGKQGPSGASGERG 992


>AB209597-1|BAD92834.1| 1467|Homo sapiens Collagen alpha 1 chain
            precursor variant protein.
          Length = 1467

 Score = 30.7 bits (66), Expect = 6.7
 Identities = 15/30 (50%), Positives = 17/30 (56%)
 Frame = +1

Query: 367  GEKGFEAAGVTGPGGEPVKGSPYAADKRRG 456
            GE+GF   G+ GP GEP K  P  A   RG
Sbjct: 971  GERGFP--GLPGPSGEPGKQGPSGASGERG 998


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 97,396,744
Number of Sequences: 237096
Number of extensions: 1720306
Number of successful extensions: 5244
Number of sequences better than 10.0: 52
Number of HSP's better than 10.0 without gapping: 4913
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5244
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 10315140830
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -