SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30162.Seq
         (465 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X15940-1|CAA34066.1|  125|Homo sapiens protein ( Human mRNA for ...   120   3e-27
BC070373-1|AAH70373.1|  125|Homo sapiens ribosomal protein L31 p...   120   3e-27
BC070210-1|AAH70210.1|  121|Homo sapiens RPL31 protein protein.       120   3e-27
BC017343-1|AAH17343.1|  125|Homo sapiens ribosomal protein L31 p...   120   3e-27
AC016738-2|AAY14823.1|  125|Homo sapiens unknown protein.             120   3e-27
AB061830-1|BAB79468.1|  125|Homo sapiens ribosomal protein L31 p...   120   3e-27
X69181-1|CAA48925.1|  121|Homo sapiens ribosomal protein L31 pro...   118   1e-26
AB007180-1|BAA25839.1|   47|Homo sapiens ribosomal protein L31 p...    54   2e-07

>X15940-1|CAA34066.1|  125|Homo sapiens protein ( Human mRNA for
           ribosomal protein L31. ).
          Length = 125

 Score =  120 bits (288), Expect = 3e-27
 Identities = 54/68 (79%), Positives = 64/68 (94%), Gaps = 1/68 (1%)
 Frame = +2

Query: 56  AKPKGERK-GKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIR 232
           AK  GE+K G+SAINEVVTREYT+N+HKR+HGVGFKKRAPRA+KEIRKFA K+MGTPD+R
Sbjct: 4   AKKGGEKKKGRSAINEVVTREYTINIHKRIHGVGFKKRAPRALKEIRKFAMKEMGTPDVR 63

Query: 233 VDTRLNKS 256
           +DTRLNK+
Sbjct: 64  IDTRLNKA 71



 Score = 68.9 bits (161), Expect = 8e-12
 Identities = 30/56 (53%), Positives = 39/56 (69%)
 Frame = +1

Query: 244 LKQILWSKGVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTENVD 411
           L + +W+KG+RNVP+          N+DEDS +KL+TLVTYVPV + K LQT NVD
Sbjct: 68  LNKAVWAKGIRNVPYRIRVRLSRKRNEDEDSPNKLYTLVTYVPVTTFKNLQTVNVD 123


>BC070373-1|AAH70373.1|  125|Homo sapiens ribosomal protein L31
           protein.
          Length = 125

 Score =  120 bits (288), Expect = 3e-27
 Identities = 54/68 (79%), Positives = 64/68 (94%), Gaps = 1/68 (1%)
 Frame = +2

Query: 56  AKPKGERK-GKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIR 232
           AK  GE+K G+SAINEVVTREYT+N+HKR+HGVGFKKRAPRA+KEIRKFA K+MGTPD+R
Sbjct: 4   AKKGGEKKKGRSAINEVVTREYTINIHKRIHGVGFKKRAPRALKEIRKFAMKEMGTPDVR 63

Query: 233 VDTRLNKS 256
           +DTRLNK+
Sbjct: 64  IDTRLNKA 71



 Score = 68.9 bits (161), Expect = 8e-12
 Identities = 30/56 (53%), Positives = 39/56 (69%)
 Frame = +1

Query: 244 LKQILWSKGVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTENVD 411
           L + +W+KG+RNVP+          N+DEDS +KL+TLVTYVPV + K LQT NVD
Sbjct: 68  LNKAVWAKGIRNVPYRIRVRLSRKRNEDEDSPNKLYTLVTYVPVTTFKNLQTVNVD 123


>BC070210-1|AAH70210.1|  121|Homo sapiens RPL31 protein protein.
          Length = 121

 Score =  120 bits (288), Expect = 3e-27
 Identities = 54/68 (79%), Positives = 64/68 (94%), Gaps = 1/68 (1%)
 Frame = +2

Query: 56  AKPKGERK-GKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIR 232
           AK  GE+K G+SAINEVVTREYT+N+HKR+HGVGFKKRAPRA+KEIRKFA K+MGTPD+R
Sbjct: 4   AKKGGEKKKGRSAINEVVTREYTINIHKRIHGVGFKKRAPRALKEIRKFAMKEMGTPDVR 63

Query: 233 VDTRLNKS 256
           +DTRLNK+
Sbjct: 64  IDTRLNKA 71



 Score = 57.6 bits (133), Expect = 2e-08
 Identities = 24/48 (50%), Positives = 33/48 (68%)
 Frame = +1

Query: 244 LKQILWSKGVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIK 387
           L + +W+KG+RNVP+          N+DEDS +KL+TLVTYVPV + K
Sbjct: 68  LNKAVWAKGIRNVPYRIRVRLSRKRNEDEDSPNKLYTLVTYVPVTTFK 115


>BC017343-1|AAH17343.1|  125|Homo sapiens ribosomal protein L31
           protein.
          Length = 125

 Score =  120 bits (288), Expect = 3e-27
 Identities = 54/68 (79%), Positives = 64/68 (94%), Gaps = 1/68 (1%)
 Frame = +2

Query: 56  AKPKGERK-GKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIR 232
           AK  GE+K G+SAINEVVTREYT+N+HKR+HGVGFKKRAPRA+KEIRKFA K+MGTPD+R
Sbjct: 4   AKKGGEKKKGRSAINEVVTREYTINIHKRIHGVGFKKRAPRALKEIRKFAMKEMGTPDVR 63

Query: 233 VDTRLNKS 256
           +DTRLNK+
Sbjct: 64  IDTRLNKA 71



 Score = 68.9 bits (161), Expect = 8e-12
 Identities = 30/56 (53%), Positives = 39/56 (69%)
 Frame = +1

Query: 244 LKQILWSKGVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTENVD 411
           L + +W+KG+RNVP+          N+DEDS +KL+TLVTYVPV + K LQT NVD
Sbjct: 68  LNKAVWAKGIRNVPYRIRVRLSRKRNEDEDSPNKLYTLVTYVPVTTFKNLQTVNVD 123


>AC016738-2|AAY14823.1|  125|Homo sapiens unknown protein.
          Length = 125

 Score =  120 bits (288), Expect = 3e-27
 Identities = 54/68 (79%), Positives = 64/68 (94%), Gaps = 1/68 (1%)
 Frame = +2

Query: 56  AKPKGERK-GKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIR 232
           AK  GE+K G+SAINEVVTREYT+N+HKR+HGVGFKKRAPRA+KEIRKFA K+MGTPD+R
Sbjct: 4   AKKGGEKKKGRSAINEVVTREYTINIHKRIHGVGFKKRAPRALKEIRKFAMKEMGTPDVR 63

Query: 233 VDTRLNKS 256
           +DTRLNK+
Sbjct: 64  IDTRLNKA 71



 Score = 68.9 bits (161), Expect = 8e-12
 Identities = 30/56 (53%), Positives = 39/56 (69%)
 Frame = +1

Query: 244 LKQILWSKGVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTENVD 411
           L + +W+KG+RNVP+          N+DEDS +KL+TLVTYVPV + K LQT NVD
Sbjct: 68  LNKAVWAKGIRNVPYRIRVRLSRKRNEDEDSPNKLYTLVTYVPVTTFKNLQTVNVD 123


>AB061830-1|BAB79468.1|  125|Homo sapiens ribosomal protein L31
           protein.
          Length = 125

 Score =  120 bits (288), Expect = 3e-27
 Identities = 54/68 (79%), Positives = 64/68 (94%), Gaps = 1/68 (1%)
 Frame = +2

Query: 56  AKPKGERK-GKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIR 232
           AK  GE+K G+SAINEVVTREYT+N+HKR+HGVGFKKRAPRA+KEIRKFA K+MGTPD+R
Sbjct: 4   AKKGGEKKKGRSAINEVVTREYTINIHKRIHGVGFKKRAPRALKEIRKFAMKEMGTPDVR 63

Query: 233 VDTRLNKS 256
           +DTRLNK+
Sbjct: 64  IDTRLNKA 71



 Score = 68.9 bits (161), Expect = 8e-12
 Identities = 30/56 (53%), Positives = 39/56 (69%)
 Frame = +1

Query: 244 LKQILWSKGVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTENVD 411
           L + +W+KG+RNVP+          N+DEDS +KL+TLVTYVPV + K LQT NVD
Sbjct: 68  LNKAVWAKGIRNVPYRIRVRLSRKRNEDEDSPNKLYTLVTYVPVTTFKNLQTVNVD 123


>X69181-1|CAA48925.1|  121|Homo sapiens ribosomal protein L31
           protein.
          Length = 121

 Score =  118 bits (284), Expect = 1e-26
 Identities = 53/67 (79%), Positives = 63/67 (94%), Gaps = 1/67 (1%)
 Frame = +2

Query: 59  KPKGERK-GKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRV 235
           K  GE+K G+SAINEVVTREYT+N+HKR+HGVGFKKRAPRA+KEIRKFA K+MGTPD+R+
Sbjct: 1   KKGGEKKKGRSAINEVVTREYTINIHKRIHGVGFKKRAPRALKEIRKFAMKEMGTPDVRI 60

Query: 236 DTRLNKS 256
           DTRLNK+
Sbjct: 61  DTRLNKA 67



 Score = 68.9 bits (161), Expect = 8e-12
 Identities = 30/56 (53%), Positives = 39/56 (69%)
 Frame = +1

Query: 244 LKQILWSKGVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTENVD 411
           L + +W+KG+RNVP+          N+DEDS +KL+TLVTYVPV + K LQT NVD
Sbjct: 64  LNKAVWAKGIRNVPYRIRVRLSRKRNEDEDSPNKLYTLVTYVPVTTFKNLQTVNVD 119


>AB007180-1|BAA25839.1|   47|Homo sapiens ribosomal protein L31
           protein.
          Length = 47

 Score = 54.4 bits (125), Expect = 2e-07
 Identities = 25/45 (55%), Positives = 30/45 (66%)
 Frame = +1

Query: 277 NVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTENVD 411
           NVP+          N+DEDS +KL+TLVTYVPV + K LQT NVD
Sbjct: 1   NVPYRIRVRLSRKRNEDEDSPNKLYTLVTYVPVTTFKNLQTVNVD 45


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 58,306,958
Number of Sequences: 237096
Number of extensions: 1045645
Number of successful extensions: 6402
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 6355
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6402
length of database: 76,859,062
effective HSP length: 84
effective length of database: 56,942,998
effective search space used: 3986009860
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -