SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30161.Seq
         (888 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Y10275-1|CAA71318.1|  225|Homo sapiens L-3-phosphoserine phospha...   112   2e-24
BX537439-1|CAD97681.1|  225|Homo sapiens hypothetical protein pr...   112   2e-24
BC063614-1|AAH63614.1|  225|Homo sapiens phosphoserine phosphata...   112   2e-24
AK223508-1|BAD97228.1|  225|Homo sapiens phosphoserine phosphata...   108   2e-23
BT006661-1|AAP35307.1|   91|Homo sapiens phosphoserine phosphata...    42   0.004
AJ001612-1|CAA04865.1|   72|Homo sapiens L-3-phosphoserine-phosp...    42   0.004
AJ606308-1|CAE54436.1| 4262|Homo sapiens secreted mucin MUC17 pr...    35   0.34 
AJ606307-1|CAE54435.1| 4493|Homo sapiens membrane mucin MUC17 pr...    35   0.34 
BC117319-1|AAI17320.1|  257|Homo sapiens TPRXL protein protein.        34   0.60 
AK092426-1|BAC03887.1|  258|Homo sapiens protein ( Homo sapiens ...    34   0.79 
AK130324-1|BAC85326.1|  277|Homo sapiens protein ( Homo sapiens ...    31   4.2  
AF016694-1|AAB71687.1|  246|Homo sapiens small intestinal mucin ...    31   4.2  
U79283-1|AAB50219.1|  325|Homo sapiens albumin D-box binding pro...    31   5.6  
U48213-1|AAB18668.1|  325|Homo sapiens D-site binding protein pr...    31   5.6  
U06936-1|AAA81374.1|  325|Homo sapiens albumin D-box binding pro...    31   5.6  
EF015902-1|ABM64213.1|  325|Homo sapiens albumin D-box protein.        31   5.6  
BT006836-1|AAP35482.1|  325|Homo sapiens D site of albumin promo...    31   5.6  
BC011965-1|AAH11965.1|  325|Homo sapiens D site of albumin promo...    31   5.6  
AL590639-4|CAI14688.1| 1302|Homo sapiens ubiquitination factor E...    31   5.6  
AL096841-1|CAI21859.1| 1302|Homo sapiens ubiquitination factor E...    31   5.6  
AF043117-1|AAD02233.1| 1302|Homo sapiens ubiquitin-fusion degrad...    31   5.6  
AB208807-1|BAD92044.1|  248|Homo sapiens D site of albumin promo...    31   5.6  
U53831-2|AAB80689.1|  171|Homo sapiens putative collagen homolog...    30   9.8  
U53830-2|AAB80687.1|  200|Homo sapiens putative collagen homolog...    30   9.8  
U29175-1|AAB40977.1| 1647|Homo sapiens transcriptional activator...    30   9.8  
D26156-1|BAA05143.1| 1647|Homo sapiens transcriptional activator...    30   9.8  
BC150298-1|AAI50299.1| 1647|Homo sapiens SWI/SNF related, matrix...    30   9.8  
BC139924-1|AAI39925.1|  584|Homo sapiens SMARCA4 protein protein.      30   9.8  
BC139917-1|AAI39918.1|  584|Homo sapiens SMARCA4 protein protein.      30   9.8  
AF254822-2|AAG24789.1| 1647|Homo sapiens SMARCA4 isoform 1 protein.    30   9.8  
AF254822-1|AAG24790.1| 1679|Homo sapiens SMARCA4 isoform 2 protein.    30   9.8  

>Y10275-1|CAA71318.1|  225|Homo sapiens L-3-phosphoserine
           phosphatase protein.
          Length = 225

 Score =  112 bits (269), Expect = 2e-24
 Identities = 52/94 (55%), Positives = 69/94 (73%)
 Frame = +3

Query: 510 LVKELHERGVIVYLVSGGFRSLIEPVAERLNIPTINIFANRLKFYFNGEYAGFDENEPTS 689
           LV  L ER V V+L+SGGFRS++E VA +LNIP  N+FANRLKFYFNGEYAGFDE +PT+
Sbjct: 94  LVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTA 153

Query: 690 RSGGXXLVVRRLXELHGYQRLVIVRGPGLPMPEA 791
            SGG   V++ L E   +++++++ G G    EA
Sbjct: 154 ESGGKGKVIKLLKEKFHFKKIIMI-GDGATDMEA 186



 Score = 97.9 bits (233), Expect = 4e-20
 Identities = 46/90 (51%), Positives = 64/90 (71%)
 Frame = +1

Query: 235 VAPTDCPELFRTADCVCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEA 414
           ++ ++  +LF +AD VCFDVDSTVI++EGIDELAK CG  D V  +T  AMGG + F+ A
Sbjct: 2   ISHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAA 61

Query: 415 LKKRLDIIRPNVGQIREFIEKFPVRLTPGI 504
           L +RL +I+P+  Q++  I + P  LTPGI
Sbjct: 62  LTERLALIQPSREQVQRLIAEQPPHLTPGI 91


>BX537439-1|CAD97681.1|  225|Homo sapiens hypothetical protein
           protein.
          Length = 225

 Score =  112 bits (269), Expect = 2e-24
 Identities = 52/94 (55%), Positives = 69/94 (73%)
 Frame = +3

Query: 510 LVKELHERGVIVYLVSGGFRSLIEPVAERLNIPTINIFANRLKFYFNGEYAGFDENEPTS 689
           LV  L ER V V+L+SGGFRS++E VA +LNIP  N+FANRLKFYFNGEYAGFDE +PT+
Sbjct: 94  LVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTA 153

Query: 690 RSGGXXLVVRRLXELHGYQRLVIVRGPGLPMPEA 791
            SGG   V++ L E   +++++++ G G    EA
Sbjct: 154 ESGGKGKVIKLLKEKFHFKKIIMI-GDGATDMEA 186



 Score = 98.3 bits (234), Expect = 3e-20
 Identities = 47/90 (52%), Positives = 64/90 (71%)
 Frame = +1

Query: 235 VAPTDCPELFRTADCVCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEA 414
           V+ ++  +LF +AD VCFDVDSTVI++EGIDELAK CG  D V  +T  AMGG + F+ A
Sbjct: 2   VSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAA 61

Query: 415 LKKRLDIIRPNVGQIREFIEKFPVRLTPGI 504
           L +RL +I+P+  Q++  I + P  LTPGI
Sbjct: 62  LTERLALIQPSREQVQRLIAEQPPHLTPGI 91


>BC063614-1|AAH63614.1|  225|Homo sapiens phosphoserine phosphatase
           protein.
          Length = 225

 Score =  112 bits (269), Expect = 2e-24
 Identities = 52/94 (55%), Positives = 69/94 (73%)
 Frame = +3

Query: 510 LVKELHERGVIVYLVSGGFRSLIEPVAERLNIPTINIFANRLKFYFNGEYAGFDENEPTS 689
           LV  L ER V V+L+SGGFRS++E VA +LNIP  N+FANRLKFYFNGEYAGFDE +PT+
Sbjct: 94  LVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTA 153

Query: 690 RSGGXXLVVRRLXELHGYQRLVIVRGPGLPMPEA 791
            SGG   V++ L E   +++++++ G G    EA
Sbjct: 154 ESGGKGKVIKLLKEKFHFKKIIMI-GDGATDMEA 186



 Score = 98.3 bits (234), Expect = 3e-20
 Identities = 47/90 (52%), Positives = 64/90 (71%)
 Frame = +1

Query: 235 VAPTDCPELFRTADCVCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEA 414
           V+ ++  +LF +AD VCFDVDSTVI++EGIDELAK CG  D V  +T  AMGG + F+ A
Sbjct: 2   VSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAA 61

Query: 415 LKKRLDIIRPNVGQIREFIEKFPVRLTPGI 504
           L +RL +I+P+  Q++  I + P  LTPGI
Sbjct: 62  LTERLALIQPSREQVQRLIAEQPPHLTPGI 91


>AK223508-1|BAD97228.1|  225|Homo sapiens phosphoserine phosphatase
           variant protein.
          Length = 225

 Score =  108 bits (260), Expect = 2e-23
 Identities = 51/94 (54%), Positives = 68/94 (72%)
 Frame = +3

Query: 510 LVKELHERGVIVYLVSGGFRSLIEPVAERLNIPTINIFANRLKFYFNGEYAGFDENEPTS 689
           LV  L ER V V+L+SGGFRS++E VA +LNIP  N+FANRLK YFNGEYAGFDE +PT+
Sbjct: 94  LVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKSYFNGEYAGFDETQPTA 153

Query: 690 RSGGXXLVVRRLXELHGYQRLVIVRGPGLPMPEA 791
            SGG   V++ L E   +++++++ G G    EA
Sbjct: 154 ESGGKGEVIKLLKEKFHFKKIIMI-GDGATDMEA 186



 Score = 98.3 bits (234), Expect = 3e-20
 Identities = 47/90 (52%), Positives = 64/90 (71%)
 Frame = +1

Query: 235 VAPTDCPELFRTADCVCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEA 414
           V+ ++  +LF +AD VCFDVDSTVI++EGIDELAK CG  D V  +T  AMGG + F+ A
Sbjct: 2   VSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAA 61

Query: 415 LKKRLDIIRPNVGQIREFIEKFPVRLTPGI 504
           L +RL +I+P+  Q++  I + P  LTPGI
Sbjct: 62  LTERLALIQPSREQVQRLIAEQPPHLTPGI 91


>BT006661-1|AAP35307.1|   91|Homo sapiens phosphoserine
           phosphatase-like protein.
          Length = 91

 Score = 41.5 bits (93), Expect = 0.004
 Identities = 18/32 (56%), Positives = 25/32 (78%)
 Frame = +1

Query: 229 RDVAPTDCPELFRTADCVCFDVDSTVIQDEGI 324
           R ++ ++  +LF +AD VCFDVDSTVI +EGI
Sbjct: 24  RMISHSELRKLFYSADAVCFDVDSTVISEEGI 55


>AJ001612-1|CAA04865.1|   72|Homo sapiens
           L-3-phosphoserine-phosphatase homologue protein.
          Length = 72

 Score = 41.5 bits (93), Expect = 0.004
 Identities = 18/32 (56%), Positives = 25/32 (78%)
 Frame = +1

Query: 229 RDVAPTDCPELFRTADCVCFDVDSTVIQDEGI 324
           R ++ ++  +LF +AD VCFDVDSTVI +EGI
Sbjct: 24  RMISHSELRKLFYSADAVCFDVDSTVISEEGI 55


>AJ606308-1|CAE54436.1| 4262|Homo sapiens secreted mucin MUC17
            protein.
          Length = 4262

 Score = 35.1 bits (77), Expect = 0.34
 Identities = 25/79 (31%), Positives = 35/79 (44%), Gaps = 1/79 (1%)
 Frame = -2

Query: 392  PPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR-*STP 216
            PP A   S+ TS+P   +   +SMP S  TV S+   T S    ++   V   S+  S+P
Sbjct: 3263 PPTAEGTSMPTSTPSEGSTPLTSMPVSTTTVASSETSTLSTTPADTSTPVTTYSQASSSP 3322

Query: 215  VRASSTSRTAGCFSNCKEP 159
              A  TS     +S    P
Sbjct: 3323 PIADGTSMPTSTYSEGSTP 3341



 Score = 31.5 bits (68), Expect = 4.2
 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 1/68 (1%)
 Frame = -2

Query: 395 LPPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSV-GATSR*ST 219
           LP  A A S+LTS+    +   ++MP S + V S+   T S +  +S   V  A+   S+
Sbjct: 374 LPTTAEATSMLTSTLSEGSTPLTNMPVSTILVASSEASTTSTIPVDSKTFVTTASEASSS 433

Query: 218 PVRASSTS 195
           P  A  TS
Sbjct: 434 PTTAEDTS 441



 Score = 31.5 bits (68), Expect = 4.2
 Identities = 23/79 (29%), Positives = 34/79 (43%), Gaps = 1/79 (1%)
 Frame = -2

Query: 392  PPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAV-LNNSGQSVGATSR*STP 216
            P  +   S+ TS+P   +   +SMP S M V ++   T SA  ++ S     +T   S+P
Sbjct: 2202 PTTSEGTSMPTSTPSEGSTPFTSMPVSTMPVVTSEASTLSATPVDTSTPVTTSTEATSSP 2261

Query: 215  VRASSTSRTAGCFSNCKEP 159
              A  TS      S    P
Sbjct: 2262 TTAEGTSIPTSTLSEGTTP 2280



 Score = 30.7 bits (66), Expect = 7.4
 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 1/67 (1%)
 Frame = -2

Query: 392  PPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAV-LNNSGQSVGATSR*STP 216
            P  +   S+ TS+P   +   +SMP S   V S+  +T SA  ++ S     +T   S+P
Sbjct: 906  PTTSEGTSMPTSTPGEGSTPLTSMPDSTTPVVSSEARTLSATPVDTSTPVTTSTEATSSP 965

Query: 215  VRASSTS 195
              A  TS
Sbjct: 966  TTAEGTS 972



 Score = 30.3 bits (65), Expect = 9.8
 Identities = 24/79 (30%), Positives = 34/79 (43%), Gaps = 1/79 (1%)
 Frame = -2

Query: 392  PPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR-*STP 216
            P  A   S+ TS+P       +S+P S  TV S+   T S  L ++   V   S+  S+P
Sbjct: 1908 PTTADGSSMPTSTPREGRPPLTSIPVSTTTVASSEINTLSTTLADTRTPVTTYSQASSSP 1967

Query: 215  VRASSTSRTAGCFSNCKEP 159
              A  TS     +S    P
Sbjct: 1968 TTADGTSMPTPAYSEGSTP 1986


>AJ606307-1|CAE54435.1| 4493|Homo sapiens membrane mucin MUC17
            protein.
          Length = 4493

 Score = 35.1 bits (77), Expect = 0.34
 Identities = 25/79 (31%), Positives = 35/79 (44%), Gaps = 1/79 (1%)
 Frame = -2

Query: 392  PPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR-*STP 216
            PP A   S+ TS+P   +   +SMP S  TV S+   T S    ++   V   S+  S+P
Sbjct: 3263 PPTAEGTSMPTSTPSEGSTPLTSMPVSTTTVASSETSTLSTTPADTSTPVTTYSQASSSP 3322

Query: 215  VRASSTSRTAGCFSNCKEP 159
              A  TS     +S    P
Sbjct: 3323 PIADGTSMPTSTYSEGSTP 3341



 Score = 31.5 bits (68), Expect = 4.2
 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 1/68 (1%)
 Frame = -2

Query: 395 LPPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSV-GATSR*ST 219
           LP  A A S+LTS+    +   ++MP S + V S+   T S +  +S   V  A+   S+
Sbjct: 374 LPTTAEATSMLTSTLSEGSTPLTNMPVSTILVASSEASTTSTIPVDSKTFVTTASEASSS 433

Query: 218 PVRASSTS 195
           P  A  TS
Sbjct: 434 PTTAEDTS 441



 Score = 31.5 bits (68), Expect = 4.2
 Identities = 23/79 (29%), Positives = 34/79 (43%), Gaps = 1/79 (1%)
 Frame = -2

Query: 392  PPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAV-LNNSGQSVGATSR*STP 216
            P  +   S+ TS+P   +   +SMP S M V ++   T SA  ++ S     +T   S+P
Sbjct: 2202 PTTSEGTSMPTSTPSEGSTPFTSMPVSTMPVVTSEASTLSATPVDTSTPVTTSTEATSSP 2261

Query: 215  VRASSTSRTAGCFSNCKEP 159
              A  TS      S    P
Sbjct: 2262 TTAEGTSIPTSTLSEGTTP 2280



 Score = 30.7 bits (66), Expect = 7.4
 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 1/67 (1%)
 Frame = -2

Query: 392  PPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAV-LNNSGQSVGATSR*STP 216
            P  +   S+ TS+P   +   +SMP S   V S+  +T SA  ++ S     +T   S+P
Sbjct: 906  PTTSEGTSMPTSTPGEGSTPLTSMPDSTTPVVSSEARTLSATPVDTSTPVTTSTEATSSP 965

Query: 215  VRASSTS 195
              A  TS
Sbjct: 966  TTAEGTS 972



 Score = 30.3 bits (65), Expect = 9.8
 Identities = 24/79 (30%), Positives = 34/79 (43%), Gaps = 1/79 (1%)
 Frame = -2

Query: 392  PPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR-*STP 216
            P  A   S+ TS+P       +S+P S  TV S+   T S  L ++   V   S+  S+P
Sbjct: 1908 PTTADGSSMPTSTPREGRPPLTSIPVSTTTVASSEINTLSTTLADTRTPVTTYSQASSSP 1967

Query: 215  VRASSTSRTAGCFSNCKEP 159
              A  TS     +S    P
Sbjct: 1968 TTADGTSMPTPAYSEGSTP 1986


>BC117319-1|AAI17320.1|  257|Homo sapiens TPRXL protein protein.
          Length = 257

 Score = 34.3 bits (75), Expect = 0.60
 Identities = 24/69 (34%), Positives = 40/69 (57%)
 Frame = -2

Query: 362 TSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRASSTSRTAG 183
           TSSP   + +SSS PSS  +  S+S  + S+  ++S  S  ++S  S+P  +SS+S ++ 
Sbjct: 89  TSSPSSSSSSSSSSPSSSNSSSSSSSSSPSSSSSSSSSSPSSSS--SSP-SSSSSSSSSS 145

Query: 182 CFSNCKEPS 156
             S+   PS
Sbjct: 146 PSSSSSSPS 154



 Score = 33.5 bits (73), Expect = 1.0
 Identities = 24/76 (31%), Positives = 40/76 (52%)
 Frame = -2

Query: 383 ASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRAS 204
           +S+ S   SS  P +  SSS PSS  +  S S  + S+  + S  +  ++S  S+P  +S
Sbjct: 62  SSSPSSSHSSSSPSSSHSSSSPSSSSSTSSPSSSSSSSSSSPSSSNSSSSSSSSSP-SSS 120

Query: 203 STSRTAGCFSNCKEPS 156
           S+S ++   S+   PS
Sbjct: 121 SSSSSSSPSSSSSSPS 136



 Score = 31.5 bits (68), Expect = 4.2
 Identities = 23/75 (30%), Positives = 41/75 (54%)
 Frame = -2

Query: 380 SAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRASS 201
           S+ S  +SSP   + +SSS PSS  +  S+S  + S+  ++S  S  ++S  S+   +SS
Sbjct: 108 SSSSSSSSSPSSSSSSSSSSPSSSSSSPSSSSSSSSSSPSSSSSSPSSSS--SSSSSSSS 165

Query: 200 TSRTAGCFSNCKEPS 156
           +  ++   S+   PS
Sbjct: 166 SPSSSSPSSSGSSPS 180



 Score = 31.1 bits (67), Expect = 5.6
 Identities = 23/76 (30%), Positives = 41/76 (53%)
 Frame = -2

Query: 383 ASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRAS 204
           +S+ S  +SSP   N +SSS  SS  +  S+S  + S+  ++S  S  ++S  S+P  +S
Sbjct: 93  SSSSSSSSSSPSSSNSSSSSSSSSPSSSSSSSSSSPSS--SSSSPSSSSSSSSSSPSSSS 150

Query: 203 STSRTAGCFSNCKEPS 156
           S+  ++   S+    S
Sbjct: 151 SSPSSSSSSSSSSSSS 166



 Score = 30.3 bits (65), Expect = 9.8
 Identities = 22/72 (30%), Positives = 35/72 (48%)
 Frame = -2

Query: 371 SLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRASSTSR 192
           S + SS  P + +SSS PSS  +  S S  + S+   +S  S  + S  S+   +S +S 
Sbjct: 48  SSILSSSIPSSSSSSSSPSSSHSSSSPS-SSHSSSSPSSSSSTSSPSSSSSSSSSSPSSS 106

Query: 191 TAGCFSNCKEPS 156
            +   S+   PS
Sbjct: 107 NSSSSSSSSSPS 118


>AK092426-1|BAC03887.1|  258|Homo sapiens protein ( Homo sapiens
           cDNA FLJ35107 fis, clone PLACE6006871, moderately
           similar to SUPPRESSOR PROTEIN SRP40. ).
          Length = 258

 Score = 33.9 bits (74), Expect = 0.79
 Identities = 23/76 (30%), Positives = 39/76 (51%)
 Frame = -2

Query: 383 ASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRAS 204
           +S+ S   SS  P +  SSS PSS  +  S S  + S+  ++   S  ++S  S+   +S
Sbjct: 62  SSSPSSSHSSSSPSSSHSSSSPSSSSSTSSPSSSSSSSSSSSPSSSNSSSSSSSSSPSSS 121

Query: 203 STSRTAGCFSNCKEPS 156
           S+S ++   S+   PS
Sbjct: 122 SSSSSSSPSSSSSSPS 137



 Score = 33.1 bits (72), Expect = 1.4
 Identities = 24/78 (30%), Positives = 42/78 (53%)
 Frame = -2

Query: 389 PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
           P +S+ S  +SSP   N +SSS  SS  +  S+S  + S+  ++S  S  ++S  S+P  
Sbjct: 92  PSSSSSSSSSSSPSSSNSSSSSSSSSPSSSSSSSSSSPSS--SSSSPSSSSSSSSSSPSS 149

Query: 209 ASSTSRTAGCFSNCKEPS 156
           +SS+  ++   S+    S
Sbjct: 150 SSSSPSSSSSSSSSSSSS 167



 Score = 32.3 bits (70), Expect = 2.4
 Identities = 21/72 (29%), Positives = 35/72 (48%)
 Frame = -2

Query: 371 SLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRASSTSR 192
           S + SS  P + +SSS PSS  +  S S    S+  ++S  +   +S  S+   +S +S 
Sbjct: 48  SSILSSSIPSSSSSSSSPSSSHSSSSPSSSHSSSSPSSSSSTSSPSSSSSSSSSSSPSSS 107

Query: 191 TAGCFSNCKEPS 156
            +   S+   PS
Sbjct: 108 NSSSSSSSSSPS 119



 Score = 31.5 bits (68), Expect = 4.2
 Identities = 23/75 (30%), Positives = 41/75 (54%)
 Frame = -2

Query: 380 SAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRASS 201
           S+ S  +SSP   + +SSS PSS  +  S+S  + S+  ++S  S  ++S  S+   +SS
Sbjct: 109 SSSSSSSSSPSSSSSSSSSSPSSSSSSPSSSSSSSSSSPSSSSSSPSSSS--SSSSSSSS 166

Query: 200 TSRTAGCFSNCKEPS 156
           +  ++   S+   PS
Sbjct: 167 SPSSSSPSSSGSSPS 181



 Score = 30.3 bits (65), Expect = 9.8
 Identities = 24/78 (30%), Positives = 39/78 (50%), Gaps = 2/78 (2%)
 Frame = -2

Query: 383 ASAVSLLTSSPFPQNLASSSMPSS--CMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
           +S  S  +SS  P +  SSS PSS    +  S+S  T S   ++S  S  + S  ++   
Sbjct: 53  SSIPSSSSSSSSPSSSHSSSSPSSSHSSSSPSSSSSTSSPSSSSSSSSSSSPSSSNSSSS 112

Query: 209 ASSTSRTAGCFSNCKEPS 156
           +SS+S ++   S+   PS
Sbjct: 113 SSSSSPSSSSSSSSSSPS 130



 Score = 30.3 bits (65), Expect = 9.8
 Identities = 30/106 (28%), Positives = 50/106 (47%)
 Frame = -2

Query: 473 SMNSLI*PTLGLMMSSLFFKASWNVILPPIASAVSLLTSSPFPQNLASSSMPSSCMTVES 294
           S +S   P+     SS    +S N      +S+ S  +SS      +SSS PSS  +  S
Sbjct: 85  SSSSTSSPSSSSSSSSSSSPSSSNSSSSSSSSSPSSSSSSSSSSPSSSSSSPSSSSSSSS 144

Query: 293 TSKQTQSAVLNNSGQSVGATSR*STPVRASSTSRTAGCFSNCKEPS 156
           +S  + S+  ++S  S  ++S  S+P  +S +S  +   S+   PS
Sbjct: 145 SSPSSSSSSPSSSSSSSSSSS--SSPSSSSPSSSGSSPSSSNSSPS 188


>AK130324-1|BAC85326.1|  277|Homo sapiens protein ( Homo sapiens
           cDNA FLJ26814 fis, clone PRS06344. ).
          Length = 277

 Score = 31.5 bits (68), Expect = 4.2
 Identities = 13/30 (43%), Positives = 15/30 (50%)
 Frame = -1

Query: 825 PKPMKPSAGGXKPRASVAPVPGRSPGAGTR 736
           P P+ P+  G     S  PVPG  P  GTR
Sbjct: 78  PHPLGPAGAGVPRSLSPRPVPGSEPSTGTR 107


>AF016694-1|AAB71687.1|  246|Homo sapiens small intestinal mucin
           MUC3 protein.
          Length = 246

 Score = 31.5 bits (68), Expect = 4.2
 Identities = 23/79 (29%), Positives = 33/79 (41%), Gaps = 1/79 (1%)
 Frame = -2

Query: 392 PPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR-*STP 216
           PP A   S+ TS+P   +   + MP S   V S+   T S    ++   V   S+  S+P
Sbjct: 22  PPTAEGTSMPTSTPSEGSTPLTRMPVSTTMVASSETSTLSTTPADTSTPVTTYSQASSSP 81

Query: 215 VRASSTSRTAGCFSNCKEP 159
             A  TS     +S    P
Sbjct: 82  TTADGTSMPTSTYSEGGTP 100


>U79283-1|AAB50219.1|  325|Homo sapiens albumin D-box binding
           protein protein.
          Length = 325

 Score = 31.1 bits (67), Expect = 5.6
 Identities = 15/32 (46%), Positives = 16/32 (50%)
 Frame = -1

Query: 834 GXPPKPMKPSAGGXKPRASVAPVPGRSPGAGT 739
           G PP P  P  GG  P  S A  P  SPG G+
Sbjct: 127 GLPPSP--PPPGGPSPEPSPARTPAPSPGPGS 156


>U48213-1|AAB18668.1|  325|Homo sapiens D-site binding protein
           protein.
          Length = 325

 Score = 31.1 bits (67), Expect = 5.6
 Identities = 15/32 (46%), Positives = 16/32 (50%)
 Frame = -1

Query: 834 GXPPKPMKPSAGGXKPRASVAPVPGRSPGAGT 739
           G PP P  P  GG  P  S A  P  SPG G+
Sbjct: 127 GLPPSP--PPPGGPSPEPSPARTPAPSPGPGS 156


>U06936-1|AAA81374.1|  325|Homo sapiens albumin D-box binding
           protein protein.
          Length = 325

 Score = 31.1 bits (67), Expect = 5.6
 Identities = 15/32 (46%), Positives = 16/32 (50%)
 Frame = -1

Query: 834 GXPPKPMKPSAGGXKPRASVAPVPGRSPGAGT 739
           G PP P  P  GG  P  S A  P  SPG G+
Sbjct: 127 GLPPSP--PPPGGPSPEPSPARTPAPSPGPGS 156


>EF015902-1|ABM64213.1|  325|Homo sapiens albumin D-box protein.
          Length = 325

 Score = 31.1 bits (67), Expect = 5.6
 Identities = 15/32 (46%), Positives = 16/32 (50%)
 Frame = -1

Query: 834 GXPPKPMKPSAGGXKPRASVAPVPGRSPGAGT 739
           G PP P  P  GG  P  S A  P  SPG G+
Sbjct: 127 GLPPSP--PPPGGPSPEPSPARTPAPSPGPGS 156


>BT006836-1|AAP35482.1|  325|Homo sapiens D site of albumin promoter
           (albumin D-box) binding protein protein.
          Length = 325

 Score = 31.1 bits (67), Expect = 5.6
 Identities = 15/32 (46%), Positives = 16/32 (50%)
 Frame = -1

Query: 834 GXPPKPMKPSAGGXKPRASVAPVPGRSPGAGT 739
           G PP P  P  GG  P  S A  P  SPG G+
Sbjct: 127 GLPPSP--PPPGGPSPEPSPARTPAPSPGPGS 156


>BC011965-1|AAH11965.1|  325|Homo sapiens D site of albumin promoter
           (albumin D-box) binding protein protein.
          Length = 325

 Score = 31.1 bits (67), Expect = 5.6
 Identities = 15/32 (46%), Positives = 16/32 (50%)
 Frame = -1

Query: 834 GXPPKPMKPSAGGXKPRASVAPVPGRSPGAGT 739
           G PP P  P  GG  P  S A  P  SPG G+
Sbjct: 127 GLPPSP--PPPGGPSPEPSPARTPAPSPGPGS 156


>AL590639-4|CAI14688.1| 1302|Homo sapiens ubiquitination factor E4B
           (UFD2 homolog, yeast) protein.
          Length = 1302

 Score = 31.1 bits (67), Expect = 5.6
 Identities = 26/79 (32%), Positives = 38/79 (48%)
 Frame = -2

Query: 407 WNVILPPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR 228
           + V  P  +S VS+L+SSP P  LASS      +   S+ ++  S        S  ATSR
Sbjct: 333 YTVTHPWASSGVSILSSSPSPPALASS---PQAVPASSSRQRPSSTGPPLPPASPSATSR 389

Query: 227 *STPVRASSTSRTAGCFSN 171
             + +R S +   +G  SN
Sbjct: 390 RPSSLRISPSLGASGGASN 408


>AL096841-1|CAI21859.1| 1302|Homo sapiens ubiquitination factor E4B
           (UFD2 homolog, yeast) protein.
          Length = 1302

 Score = 31.1 bits (67), Expect = 5.6
 Identities = 26/79 (32%), Positives = 38/79 (48%)
 Frame = -2

Query: 407 WNVILPPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR 228
           + V  P  +S VS+L+SSP P  LASS      +   S+ ++  S        S  ATSR
Sbjct: 333 YTVTHPWASSGVSILSSSPSPPALASS---PQAVPASSSRQRPSSTGPPLPPASPSATSR 389

Query: 227 *STPVRASSTSRTAGCFSN 171
             + +R S +   +G  SN
Sbjct: 390 RPSSLRISPSLGASGGASN 408


>AF043117-1|AAD02233.1| 1302|Homo sapiens ubiquitin-fusion
           degradation protein 2 protein.
          Length = 1302

 Score = 31.1 bits (67), Expect = 5.6
 Identities = 26/79 (32%), Positives = 38/79 (48%)
 Frame = -2

Query: 407 WNVILPPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR 228
           + V  P  +S VS+L+SSP P  LASS      +   S+ ++  S        S  ATSR
Sbjct: 333 YTVTHPWASSGVSILSSSPSPPALASS---PQAVPASSSRQRPSSTGPPLPPASPSATSR 389

Query: 227 *STPVRASSTSRTAGCFSN 171
             + +R S +   +G  SN
Sbjct: 390 RPSSLRISPSLGASGGASN 408


>AB208807-1|BAD92044.1|  248|Homo sapiens D site of albumin promoter
           (albumin D-box) binding protein variant protein.
          Length = 248

 Score = 31.1 bits (67), Expect = 5.6
 Identities = 15/32 (46%), Positives = 16/32 (50%)
 Frame = -1

Query: 834 GXPPKPMKPSAGGXKPRASVAPVPGRSPGAGT 739
           G PP P  P  GG  P  S A  P  SPG G+
Sbjct: 137 GLPPSP--PPPGGPSPEPSPARTPAPSPGPGS 166


>U53831-2|AAB80689.1|  171|Homo sapiens putative collagen homolog
           protein-b protein.
          Length = 171

 Score = 30.3 bits (65), Expect = 9.8
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -1

Query: 828 PPKPMKPSAGGXKPRASVAPVPGRSPGAGTRAI 730
           P +P +PS  G +P A   P P R+PG    A+
Sbjct: 84  PIRPPRPSCPGHRPPAGSIPQPCRAPGPEAAAL 116


>U53830-2|AAB80687.1|  200|Homo sapiens putative collagen homolog
           protein-a protein.
          Length = 200

 Score = 30.3 bits (65), Expect = 9.8
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -1

Query: 828 PPKPMKPSAGGXKPRASVAPVPGRSPGAGTRAI 730
           P +P +PS  G +P A   P P R+PG    A+
Sbjct: 113 PIRPPRPSCPGHRPPAGSIPQPCRAPGPEAAAL 145


>U29175-1|AAB40977.1| 1647|Homo sapiens transcriptional activator
           protein.
          Length = 1647

 Score = 30.3 bits (65), Expect = 9.8
 Identities = 15/48 (31%), Positives = 20/48 (41%)
 Frame = -1

Query: 834 GXPPKPMKPSAGGXKPRASVAPVPGRSPGAGTRAIXSVVSPLNXXHQI 691
           G  P+P      G  P A + P PG SPG+    +     P +  H I
Sbjct: 9   GGTPRPGPSPGPGPSPGAMLGPSPGPSPGSAHSMMGPSPGPPSAGHPI 56


>D26156-1|BAA05143.1| 1647|Homo sapiens transcriptional activator
           hSNF2b protein.
          Length = 1647

 Score = 30.3 bits (65), Expect = 9.8
 Identities = 15/48 (31%), Positives = 20/48 (41%)
 Frame = -1

Query: 834 GXPPKPMKPSAGGXKPRASVAPVPGRSPGAGTRAIXSVVSPLNXXHQI 691
           G  P+P      G  P A + P PG SPG+    +     P +  H I
Sbjct: 9   GGTPRPGPSPGPGPSPGAMLGPSPGPSPGSAHSMMGPSPGPPSAGHPI 56


>BC150298-1|AAI50299.1| 1647|Homo sapiens SWI/SNF related, matrix
           associated, actin dependent regulator of chromatin, sub
           protein.
          Length = 1647

 Score = 30.3 bits (65), Expect = 9.8
 Identities = 15/48 (31%), Positives = 20/48 (41%)
 Frame = -1

Query: 834 GXPPKPMKPSAGGXKPRASVAPVPGRSPGAGTRAIXSVVSPLNXXHQI 691
           G  P+P      G  P A + P PG SPG+    +     P +  H I
Sbjct: 9   GGTPRPGPSPGPGPSPGAMLGPSPGPSPGSAHSMMGPSPGPPSAGHPI 56


>BC139924-1|AAI39925.1|  584|Homo sapiens SMARCA4 protein protein.
          Length = 584

 Score = 30.3 bits (65), Expect = 9.8
 Identities = 15/48 (31%), Positives = 20/48 (41%)
 Frame = -1

Query: 834 GXPPKPMKPSAGGXKPRASVAPVPGRSPGAGTRAIXSVVSPLNXXHQI 691
           G  P+P      G  P A + P PG SPG+    +     P +  H I
Sbjct: 9   GGTPRPGPSPGPGPSPGAMLGPSPGPSPGSAHSMMGPSPGPPSAGHPI 56


>BC139917-1|AAI39918.1|  584|Homo sapiens SMARCA4 protein protein.
          Length = 584

 Score = 30.3 bits (65), Expect = 9.8
 Identities = 15/48 (31%), Positives = 20/48 (41%)
 Frame = -1

Query: 834 GXPPKPMKPSAGGXKPRASVAPVPGRSPGAGTRAIXSVVSPLNXXHQI 691
           G  P+P      G  P A + P PG SPG+    +     P +  H I
Sbjct: 9   GGTPRPGPSPGPGPSPGAMLGPSPGPSPGSAHSMMGPSPGPPSAGHPI 56


>AF254822-2|AAG24789.1| 1647|Homo sapiens SMARCA4 isoform 1 protein.
          Length = 1647

 Score = 30.3 bits (65), Expect = 9.8
 Identities = 15/48 (31%), Positives = 20/48 (41%)
 Frame = -1

Query: 834 GXPPKPMKPSAGGXKPRASVAPVPGRSPGAGTRAIXSVVSPLNXXHQI 691
           G  P+P      G  P A + P PG SPG+    +     P +  H I
Sbjct: 9   GGTPRPGPSPGPGPSPGAMLGPSPGPSPGSAHSMMGPSPGPPSAGHPI 56


>AF254822-1|AAG24790.1| 1679|Homo sapiens SMARCA4 isoform 2 protein.
          Length = 1679

 Score = 30.3 bits (65), Expect = 9.8
 Identities = 15/48 (31%), Positives = 20/48 (41%)
 Frame = -1

Query: 834 GXPPKPMKPSAGGXKPRASVAPVPGRSPGAGTRAIXSVVSPLNXXHQI 691
           G  P+P      G  P A + P PG SPG+    +     P +  H I
Sbjct: 9   GGTPRPGPSPGPGPSPGAMLGPSPGPSPGSAHSMMGPSPGPPSAGHPI 56


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 121,534,469
Number of Sequences: 237096
Number of extensions: 2516231
Number of successful extensions: 7709
Number of sequences better than 10.0: 31
Number of HSP's better than 10.0 without gapping: 6758
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7622
length of database: 76,859,062
effective HSP length: 90
effective length of database: 55,520,422
effective search space used: 11381686510
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -