SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30158.Seq
         (813 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC065299-1|AAH65299.1|  271|Homo sapiens signal recognition part...    64   4e-10
BC063001-1|AAH63001.1|  271|Homo sapiens signal recognition part...    64   4e-10
AK075531-1|BAC11675.1|  271|Homo sapiens protein ( Homo sapiens ...    64   4e-10
AF141882-1|AAD34888.3|  271|Homo sapiens APMCF1 protein.               64   4e-10
AF086914-1|AAP97144.1|  271|Homo sapiens signal recognition part...    64   4e-10
AK027525-1|BAB55176.1|  271|Homo sapiens protein ( Homo sapiens ...    63   1e-09
CR457225-1|CAG33506.1|  204|Homo sapiens ARFRP2 protein.               33   1.2  
BC026093-1|AAH26093.1|  204|Homo sapiens ADP-ribosylation factor...    33   1.2  
AK000058-1|BAA90915.1|  204|Homo sapiens protein ( Homo sapiens ...    33   1.2  

>BC065299-1|AAH65299.1|  271|Homo sapiens signal recognition
           particle receptor, B subunit protein.
          Length = 271

 Score = 64.5 bits (150), Expect = 4e-10
 Identities = 47/125 (37%), Positives = 63/125 (50%), Gaps = 4/125 (3%)
 Frame = +3

Query: 258 TLXFVXLAYSQYXQTFTSMKENIEXXITSNK---TLKIVDLPGXERLRNKFFXQHXSSAK 428
           TL FV L    Y  T TS+ ++      +N    +L ++DLPG E LR +F  +  SSA+
Sbjct: 78  TLLFVRLLTGLYRDTQTSITDSCAVYRVNNNRGNSLTLIDLPGHESLRLQFLERFKSSAR 137

Query: 429 GIVFVIXSINIXEEIXDVAXYLYTILWIRSFXGTQLPX*YCG-NKQXQP*PKXAQLSKGY 605
            IVFV+ S     E+ DVA +LY +L I S      P      NKQ     K A+L +  
Sbjct: 138 AIVFVVDSAAFQREVKDVAEFLYQVL-IDSMGLKNTPSFLIACNKQDIAMAKSAKLIQQQ 196

Query: 606 SEKEL 620
            EKEL
Sbjct: 197 LEKEL 201



 Score = 35.9 bits (79), Expect = 0.17
 Identities = 21/41 (51%), Positives = 29/41 (70%), Gaps = 4/41 (9%)
 Frame = +1

Query: 145 TLLSLIV--LAV--TLIFWWIFSRRYTLRNSVLLMGLSDSG 255
           TLLS++V  LAV  TL+FW +   R + + +VLL+GL DSG
Sbjct: 36  TLLSVVVAVLAVLLTLVFWKLIRSRRSSQRAVLLVGLCDSG 76


>BC063001-1|AAH63001.1|  271|Homo sapiens signal recognition
           particle receptor, B subunit protein.
          Length = 271

 Score = 64.5 bits (150), Expect = 4e-10
 Identities = 47/125 (37%), Positives = 63/125 (50%), Gaps = 4/125 (3%)
 Frame = +3

Query: 258 TLXFVXLAYSQYXQTFTSMKENIEXXITSNK---TLKIVDLPGXERLRNKFFXQHXSSAK 428
           TL FV L    Y  T TS+ ++      +N    +L ++DLPG E LR +F  +  SSA+
Sbjct: 78  TLLFVRLLTGLYRDTQTSITDSCAVYRVNNNRGNSLTLIDLPGHESLRLQFLERFKSSAR 137

Query: 429 GIVFVIXSINIXEEIXDVAXYLYTILWIRSFXGTQLPX*YCG-NKQXQP*PKXAQLSKGY 605
            IVFV+ S     E+ DVA +LY +L I S      P      NKQ     K A+L +  
Sbjct: 138 AIVFVVDSAAFQREVKDVAEFLYQVL-IDSMGLKNTPSFLIACNKQDIAMAKSAKLIQQQ 196

Query: 606 SEKEL 620
            EKEL
Sbjct: 197 LEKEL 201



 Score = 35.9 bits (79), Expect = 0.17
 Identities = 21/41 (51%), Positives = 29/41 (70%), Gaps = 4/41 (9%)
 Frame = +1

Query: 145 TLLSLIV--LAV--TLIFWWIFSRRYTLRNSVLLMGLSDSG 255
           TLLS++V  LAV  TL+FW +   R + + +VLL+GL DSG
Sbjct: 36  TLLSVVVAVLAVLLTLVFWKLIRSRRSSQRAVLLVGLCDSG 76


>AK075531-1|BAC11675.1|  271|Homo sapiens protein ( Homo sapiens
           cDNA PSEC0230 fis, clone HEMBA1006391, highly similar to
           SIGNAL RECOGNITION PARTICLE RECEPTOR BETA SUBUNIT. ).
          Length = 271

 Score = 64.5 bits (150), Expect = 4e-10
 Identities = 47/125 (37%), Positives = 63/125 (50%), Gaps = 4/125 (3%)
 Frame = +3

Query: 258 TLXFVXLAYSQYXQTFTSMKENIEXXITSNK---TLKIVDLPGXERLRNKFFXQHXSSAK 428
           TL FV L    Y  T TS+ ++      +N    +L ++DLPG E LR +F  +  SSA+
Sbjct: 78  TLLFVRLLTGLYRDTQTSITDSCAVYRVNNNRGNSLTLIDLPGHESLRLQFLERFKSSAR 137

Query: 429 GIVFVIXSINIXEEIXDVAXYLYTILWIRSFXGTQLPX*YCG-NKQXQP*PKXAQLSKGY 605
            IVFV+ S     E+ DVA +LY +L I S      P      NKQ     K A+L +  
Sbjct: 138 AIVFVVDSAAFQREVKDVAEFLYQVL-IDSMGLKNTPSFLIACNKQDIAMAKSAKLIQQQ 196

Query: 606 SEKEL 620
            EKEL
Sbjct: 197 LEKEL 201



 Score = 35.9 bits (79), Expect = 0.17
 Identities = 21/41 (51%), Positives = 29/41 (70%), Gaps = 4/41 (9%)
 Frame = +1

Query: 145 TLLSLIV--LAV--TLIFWWIFSRRYTLRNSVLLMGLSDSG 255
           TLLS++V  LAV  TL+FW +   R + + +VLL+GL DSG
Sbjct: 36  TLLSVVVAVLAVLLTLVFWKLIRSRRSSQRAVLLVGLCDSG 76


>AF141882-1|AAD34888.3|  271|Homo sapiens APMCF1 protein.
          Length = 271

 Score = 64.5 bits (150), Expect = 4e-10
 Identities = 47/125 (37%), Positives = 63/125 (50%), Gaps = 4/125 (3%)
 Frame = +3

Query: 258 TLXFVXLAYSQYXQTFTSMKENIEXXITSNK---TLKIVDLPGXERLRNKFFXQHXSSAK 428
           TL FV L    Y  T TS+ ++      +N    +L ++DLPG E LR +F  +  SSA+
Sbjct: 78  TLLFVRLLTGLYRDTQTSITDSCAVYRVNNNRGNSLTLIDLPGHESLRLQFLERFKSSAR 137

Query: 429 GIVFVIXSINIXEEIXDVAXYLYTILWIRSFXGTQLPX*YCG-NKQXQP*PKXAQLSKGY 605
            IVFV+ S     E+ DVA +LY +L I S      P      NKQ     K A+L +  
Sbjct: 138 AIVFVVDSAAFQREVKDVAEFLYQVL-IDSMGLKNTPSFLIACNKQDIAMAKSAKLIQQQ 196

Query: 606 SEKEL 620
            EKEL
Sbjct: 197 LEKEL 201



 Score = 35.9 bits (79), Expect = 0.17
 Identities = 21/41 (51%), Positives = 29/41 (70%), Gaps = 4/41 (9%)
 Frame = +1

Query: 145 TLLSLIV--LAV--TLIFWWIFSRRYTLRNSVLLMGLSDSG 255
           TLLS++V  LAV  TL+FW +   R + + +VLL+GL DSG
Sbjct: 36  TLLSVVVAVLAVLLTLVFWKLIRSRRSSQRAVLLVGLCDSG 76


>AF086914-1|AAP97144.1|  271|Homo sapiens signal recognition
           particle receptor beta subunit protein.
          Length = 271

 Score = 64.5 bits (150), Expect = 4e-10
 Identities = 47/125 (37%), Positives = 63/125 (50%), Gaps = 4/125 (3%)
 Frame = +3

Query: 258 TLXFVXLAYSQYXQTFTSMKENIEXXITSNK---TLKIVDLPGXERLRNKFFXQHXSSAK 428
           TL FV L    Y  T TS+ ++      +N    +L ++DLPG E LR +F  +  SSA+
Sbjct: 78  TLLFVRLLTGLYRDTQTSITDSCAVYRVNNNRGNSLTLIDLPGHESLRLQFLERFKSSAR 137

Query: 429 GIVFVIXSINIXEEIXDVAXYLYTILWIRSFXGTQLPX*YCG-NKQXQP*PKXAQLSKGY 605
            IVFV+ S     E+ DVA +LY +L I S      P      NKQ     K A+L +  
Sbjct: 138 AIVFVVDSAAFQREVKDVAEFLYQVL-IDSMGLKNTPSFLIACNKQDIAMAKSAKLIQQQ 196

Query: 606 SEKEL 620
            EKEL
Sbjct: 197 LEKEL 201



 Score = 35.9 bits (79), Expect = 0.17
 Identities = 21/41 (51%), Positives = 29/41 (70%), Gaps = 4/41 (9%)
 Frame = +1

Query: 145 TLLSLIV--LAV--TLIFWWIFSRRYTLRNSVLLMGLSDSG 255
           TLLS++V  LAV  TL+FW +   R + + +VLL+GL DSG
Sbjct: 36  TLLSVVVAVLAVLLTLVFWKLIRSRRSSQRAVLLVGLCDSG 76


>AK027525-1|BAB55176.1|  271|Homo sapiens protein ( Homo sapiens
           cDNA FLJ14619 fis, clone NT2RP1001569, highly similar to
           SIGNAL RECOGNITION PARTICLE RECEPTOR BETA SUBUNIT. ).
          Length = 271

 Score = 62.9 bits (146), Expect = 1e-09
 Identities = 47/125 (37%), Positives = 62/125 (49%), Gaps = 4/125 (3%)
 Frame = +3

Query: 258 TLXFVXLAYSQYXQTFTSMKENIEXXITSNK---TLKIVDLPGXERLRNKFFXQHXSSAK 428
           TL FV L    Y  T TS+ ++      +N    +L ++DLPG E LR +F  +  SSA 
Sbjct: 78  TLLFVRLLTGLYRDTQTSITDSCAVYRVNNNRGNSLTLIDLPGHESLRLQFLERFKSSAG 137

Query: 429 GIVFVIXSINIXEEIXDVAXYLYTILWIRSFXGTQLPX*YCG-NKQXQP*PKXAQLSKGY 605
            IVFV+ S     E+ DVA +LY +L I S      P      NKQ     K A+L +  
Sbjct: 138 AIVFVVDSAAFQREVKDVAEFLYQVL-IDSMGLKNTPSFLIACNKQDIAMAKSAKLIQQQ 196

Query: 606 SEKEL 620
            EKEL
Sbjct: 197 LEKEL 201



 Score = 35.9 bits (79), Expect = 0.17
 Identities = 21/41 (51%), Positives = 29/41 (70%), Gaps = 4/41 (9%)
 Frame = +1

Query: 145 TLLSLIV--LAV--TLIFWWIFSRRYTLRNSVLLMGLSDSG 255
           TLLS++V  LAV  TL+FW +   R + + +VLL+GL DSG
Sbjct: 36  TLLSVVVAVLAVLLTLVFWKLIRSRRSSQRAVLLVGLCDSG 76


>CR457225-1|CAG33506.1|  204|Homo sapiens ARFRP2 protein.
          Length = 204

 Score = 33.1 bits (72), Expect = 1.2
 Identities = 22/91 (24%), Positives = 43/91 (47%)
 Frame = +3

Query: 345 NKTLKIVDLPGXERLRNKFFXQHXSSAKGIVFVIXSINIXEEIXDVAXYLYTILWIRSFX 524
           N  L + +L G + +R K++ ++   ++G++FV+ S +  +++      L++ L      
Sbjct: 75  NAILNVKELGGADNIR-KYWSRYYQGSQGVIFVLDSASSEDDLEAARNELHSALQHPQL- 132

Query: 525 GTQLPX*YCGNKQXQP*PKXAQLSKGYSEKE 617
              LP     N Q +P  +  Q  K Y E E
Sbjct: 133 -CTLPFLILANHQDKPAARSVQEIKKYFELE 162


>BC026093-1|AAH26093.1|  204|Homo sapiens ADP-ribosylation
           factor-like 15 protein.
          Length = 204

 Score = 33.1 bits (72), Expect = 1.2
 Identities = 22/91 (24%), Positives = 43/91 (47%)
 Frame = +3

Query: 345 NKTLKIVDLPGXERLRNKFFXQHXSSAKGIVFVIXSINIXEEIXDVAXYLYTILWIRSFX 524
           N  L + +L G + +R K++ ++   ++G++FV+ S +  +++      L++ L      
Sbjct: 75  NAILNVKELGGADNIR-KYWSRYYQGSQGVIFVLDSASSEDDLEAARNELHSALQHPQL- 132

Query: 525 GTQLPX*YCGNKQXQP*PKXAQLSKGYSEKE 617
              LP     N Q +P  +  Q  K Y E E
Sbjct: 133 -CTLPFLILANHQDKPAARSVQEIKKYFELE 162


>AK000058-1|BAA90915.1|  204|Homo sapiens protein ( Homo sapiens
           cDNA FLJ20051 fis, clone COL00720. ).
          Length = 204

 Score = 33.1 bits (72), Expect = 1.2
 Identities = 22/91 (24%), Positives = 43/91 (47%)
 Frame = +3

Query: 345 NKTLKIVDLPGXERLRNKFFXQHXSSAKGIVFVIXSINIXEEIXDVAXYLYTILWIRSFX 524
           N  L + +L G + +R K++ ++   ++G++FV+ S +  +++      L++ L      
Sbjct: 75  NAILNVKELGGADNIR-KYWSRYYQGSQGVIFVLDSASSEDDLEAARNELHSALQHPQL- 132

Query: 525 GTQLPX*YCGNKQXQP*PKXAQLSKGYSEKE 617
              LP     N Q +P  +  Q  K Y E E
Sbjct: 133 -CTLPFLILANHQDKPAARSVQEIKKYFELE 162


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 99,601,599
Number of Sequences: 237096
Number of extensions: 1842201
Number of successful extensions: 3476
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 3292
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3476
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 10092110758
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -