SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30156.Seq
         (961 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X17206-1|CAA35078.1|  221|Homo sapiens protein ( Human mRNA for ...   165   3e-40
BC106060-1|AAI06061.1|  293|Homo sapiens ribosomal protein S2 pr...   165   3e-40
BC105985-1|AAI05986.1|  293|Homo sapiens ribosomal protein S2 pr...   165   3e-40
BC103756-1|AAI03757.1|  293|Homo sapiens ribosomal protein S2 pr...   165   3e-40
BC075830-1|AAH75830.1|  293|Homo sapiens ribosomal protein S2 pr...   165   3e-40
BC073966-1|AAH73966.1|  293|Homo sapiens ribosomal protein S2 pr...   165   3e-40
BC071924-1|AAH71924.1|  293|Homo sapiens ribosomal protein S2 pr...   165   3e-40
BC071923-1|AAH71923.1|  293|Homo sapiens ribosomal protein S2 pr...   165   3e-40
BC071922-1|AAH71922.1|  293|Homo sapiens ribosomal protein S2 pr...   165   3e-40
BC071673-1|AAH71673.1|  293|Homo sapiens ribosomal protein S2 pr...   165   3e-40
BC068051-1|AAH68051.1|  293|Homo sapiens ribosomal protein S2 pr...   165   3e-40
BC066321-1|AAH66321.1|  293|Homo sapiens ribosomal protein S2 pr...   165   3e-40
BC032129-1|AAH32129.1|  293|Homo sapiens ribosomal protein S2 pr...   165   3e-40
BC025677-1|AAH25677.1|  293|Homo sapiens ribosomal protein S2 pr...   165   3e-40
BC023541-1|AAH23541.1|  293|Homo sapiens ribosomal protein S2 pr...   165   3e-40
BC021545-1|AAH21545.1|  293|Homo sapiens ribosomal protein S2 pr...   165   3e-40
BC018993-1|AAH18993.1|  293|Homo sapiens ribosomal protein S2 pr...   165   3e-40
BC016951-1|AAH16951.1|  293|Homo sapiens ribosomal protein S2 pr...   165   3e-40
BC016178-1|AAH16178.1|  293|Homo sapiens ribosomal protein S2 pr...   165   3e-40
BC012354-1|AAH12354.1|  293|Homo sapiens ribosomal protein S2 pr...   165   3e-40
BC010165-1|AAH10165.1|  293|Homo sapiens ribosomal protein S2 pr...   165   3e-40
BC008862-1|AAH08862.1|  293|Homo sapiens ribosomal protein S2 pr...   165   3e-40
BC006559-1|AAH06559.1|  293|Homo sapiens ribosomal protein S2 pr...   165   3e-40
BC001795-1|AAH01795.1|  293|Homo sapiens ribosomal protein S2 pr...   165   3e-40
AB082925-1|BAC16801.1|  233|Homo sapiens ribosomal protein S2 pr...   165   3e-40
AB065089-1|BAB93526.1|  203|Homo sapiens ribosomal protein S2 pr...   165   3e-40
BC026177-1|AAH26177.1|  172|Homo sapiens MGC27348 protein protein.     93   1e-18
BC030267-1|AAH30267.1| 1158|Homo sapiens ATP13A2 protein protein.      35   0.38 
AY461712-1|AAR23423.1| 1175|Homo sapiens putative N-ATPase protein.    35   0.38 
AL049569-7|CAI20367.1| 1158|Homo sapiens ATPase type 13A2 protein.     35   0.38 
BC034575-1|AAH34575.1| 1088|Homo sapiens ATP13A2 protein protein.      32   2.7  
AL354615-1|CAB89728.1| 1180|Homo sapiens hypothetical protein pr...    32   2.7  
AL049569-6|CAI20366.1| 1180|Homo sapiens ATPase type 13A2 protein.     32   2.7  

>X17206-1|CAA35078.1|  221|Homo sapiens protein ( Human mRNA for
           LLRep3. ).
          Length = 221

 Score =  165 bits (400), Expect = 3e-40
 Identities = 83/108 (76%), Positives = 88/108 (81%)
 Frame = +1

Query: 220 KNRQTREHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDN 399
           K +   E  L  LPIKE EIIDFFLG SL DEVLKIMPVQKQTRAGQRTRFKAFVAIGD 
Sbjct: 2   KIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDY 61

Query: 400 NGHIGLGVKCSKEVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRP 543
           NGH+GLGVKCSKEVATAIRGAIILAKLS++   +   GNKIGKPH  P
Sbjct: 62  NGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVP 109



 Score = 30.7 bits (66), Expect = 8.2
 Identities = 18/37 (48%), Positives = 20/37 (54%)
 Frame = +2

Query: 491 PVRRSYGVTR*ESHTTVPCKVXGQXWFPKQFRLIPAP 601
           PVRR Y   +     TVPCKV G+       RLIPAP
Sbjct: 92  PVRRGYWGNKIGKPHTVPCKVTGRCG-SVLVRLIPAP 127


>BC106060-1|AAI06061.1|  293|Homo sapiens ribosomal protein S2
           protein.
          Length = 293

 Score =  165 bits (400), Expect = 3e-40
 Identities = 83/108 (76%), Positives = 88/108 (81%)
 Frame = +1

Query: 220 KNRQTREHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDN 399
           K +   E  L  LPIKE EIIDFFLG SL DEVLKIMPVQKQTRAGQRTRFKAFVAIGD 
Sbjct: 74  KIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDY 133

Query: 400 NGHIGLGVKCSKEVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRP 543
           NGH+GLGVKCSKEVATAIRGAIILAKLS++   +   GNKIGKPH  P
Sbjct: 134 NGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVP 181



 Score = 54.8 bits (126), Expect = 4e-07
 Identities = 44/150 (29%), Positives = 67/150 (44%), Gaps = 3/150 (2%)
 Frame = +2

Query: 161 KEDQKEWVPVTKLGRLVREGKIDKLESIYLFFYQSKNSRSL---ISSSARP*MMRFLRSC 331
           K + KEW+PVTKLGRLV++ KI  LE IYLF    K S  +   + +S +  +++ +   
Sbjct: 54  KAEDKEWMPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMP-- 111

Query: 332 LYRNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCQF*PVRRSYG 511
           + +             +        + + V   +++        + L      PVRR Y 
Sbjct: 112 VQKQTRAGQRTRFKAFVAIGDYNGHVGLGV-KCSKEVATAIRGAIILAKLSIVPVRRGYW 170

Query: 512 VTR*ESHTTVPCKVXGQXWFPKQFRLIPAP 601
             +     TVPCKV G+       RLIPAP
Sbjct: 171 GNKIGKPHTVPCKVTGRCG-SVLVRLIPAP 199


>BC105985-1|AAI05986.1|  293|Homo sapiens ribosomal protein S2
           protein.
          Length = 293

 Score =  165 bits (400), Expect = 3e-40
 Identities = 83/108 (76%), Positives = 88/108 (81%)
 Frame = +1

Query: 220 KNRQTREHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDN 399
           K +   E  L  LPIKE EIIDFFLG SL DEVLKIMPVQKQTRAGQRTRFKAFVAIGD 
Sbjct: 74  KIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDY 133

Query: 400 NGHIGLGVKCSKEVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRP 543
           NGH+GLGVKCSKEVATAIRGAIILAKLS++   +   GNKIGKPH  P
Sbjct: 134 NGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVP 181



 Score = 54.8 bits (126), Expect = 4e-07
 Identities = 44/150 (29%), Positives = 67/150 (44%), Gaps = 3/150 (2%)
 Frame = +2

Query: 161 KEDQKEWVPVTKLGRLVREGKIDKLESIYLFFYQSKNSRSL---ISSSARP*MMRFLRSC 331
           K + KEW+PVTKLGRLV++ KI  LE IYLF    K S  +   + +S +  +++ +   
Sbjct: 54  KAEDKEWMPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMP-- 111

Query: 332 LYRNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCQF*PVRRSYG 511
           + +             +        + + V   +++        + L      PVRR Y 
Sbjct: 112 VQKQTRAGQRTRFKAFVAIGDYNGHVGLGV-KCSKEVATAIRGAIILAKLSIVPVRRGYW 170

Query: 512 VTR*ESHTTVPCKVXGQXWFPKQFRLIPAP 601
             +     TVPCKV G+       RLIPAP
Sbjct: 171 GNKIGKPHTVPCKVTGRCG-SVLVRLIPAP 199


>BC103756-1|AAI03757.1|  293|Homo sapiens ribosomal protein S2
           protein.
          Length = 293

 Score =  165 bits (400), Expect = 3e-40
 Identities = 83/108 (76%), Positives = 88/108 (81%)
 Frame = +1

Query: 220 KNRQTREHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDN 399
           K +   E  L  LPIKE EIIDFFLG SL DEVLKIMPVQKQTRAGQRTRFKAFVAIGD 
Sbjct: 74  KIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDY 133

Query: 400 NGHIGLGVKCSKEVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRP 543
           NGH+GLGVKCSKEVATAIRGAIILAKLS++   +   GNKIGKPH  P
Sbjct: 134 NGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVP 181



 Score = 54.8 bits (126), Expect = 4e-07
 Identities = 44/150 (29%), Positives = 67/150 (44%), Gaps = 3/150 (2%)
 Frame = +2

Query: 161 KEDQKEWVPVTKLGRLVREGKIDKLESIYLFFYQSKNSRSL---ISSSARP*MMRFLRSC 331
           K + KEW+PVTKLGRLV++ KI  LE IYLF    K S  +   + +S +  +++ +   
Sbjct: 54  KAEDKEWMPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMP-- 111

Query: 332 LYRNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCQF*PVRRSYG 511
           + +             +        + + V   +++        + L      PVRR Y 
Sbjct: 112 VQKQTRAGQRTRFKAFVAIGDYNGHVGLGV-KCSKEVATAIRGAIILAKLSIVPVRRGYW 170

Query: 512 VTR*ESHTTVPCKVXGQXWFPKQFRLIPAP 601
             +     TVPCKV G+       RLIPAP
Sbjct: 171 GNKIGKPHTVPCKVTGRCG-SVLVRLIPAP 199


>BC075830-1|AAH75830.1|  293|Homo sapiens ribosomal protein S2
           protein.
          Length = 293

 Score =  165 bits (400), Expect = 3e-40
 Identities = 83/108 (76%), Positives = 88/108 (81%)
 Frame = +1

Query: 220 KNRQTREHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDN 399
           K +   E  L  LPIKE EIIDFFLG SL DEVLKIMPVQKQTRAGQRTRFKAFVAIGD 
Sbjct: 74  KIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDY 133

Query: 400 NGHIGLGVKCSKEVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRP 543
           NGH+GLGVKCSKEVATAIRGAIILAKLS++   +   GNKIGKPH  P
Sbjct: 134 NGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVP 181



 Score = 54.8 bits (126), Expect = 4e-07
 Identities = 44/150 (29%), Positives = 67/150 (44%), Gaps = 3/150 (2%)
 Frame = +2

Query: 161 KEDQKEWVPVTKLGRLVREGKIDKLESIYLFFYQSKNSRSL---ISSSARP*MMRFLRSC 331
           K + KEW+PVTKLGRLV++ KI  LE IYLF    K S  +   + +S +  +++ +   
Sbjct: 54  KAEDKEWMPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMP-- 111

Query: 332 LYRNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCQF*PVRRSYG 511
           + +             +        + + V   +++        + L      PVRR Y 
Sbjct: 112 VQKQTRAGQRTRFKAFVAIGDYNGHVGLGV-KCSKEVATAIRGAIILAKLSIVPVRRGYW 170

Query: 512 VTR*ESHTTVPCKVXGQXWFPKQFRLIPAP 601
             +     TVPCKV G+       RLIPAP
Sbjct: 171 GNKIGKPHTVPCKVTGRCG-SVLVRLIPAP 199


>BC073966-1|AAH73966.1|  293|Homo sapiens ribosomal protein S2
           protein.
          Length = 293

 Score =  165 bits (400), Expect = 3e-40
 Identities = 83/108 (76%), Positives = 88/108 (81%)
 Frame = +1

Query: 220 KNRQTREHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDN 399
           K +   E  L  LPIKE EIIDFFLG SL DEVLKIMPVQKQTRAGQRTRFKAFVAIGD 
Sbjct: 74  KIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDY 133

Query: 400 NGHIGLGVKCSKEVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRP 543
           NGH+GLGVKCSKEVATAIRGAIILAKLS++   +   GNKIGKPH  P
Sbjct: 134 NGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVP 181



 Score = 54.8 bits (126), Expect = 4e-07
 Identities = 44/150 (29%), Positives = 67/150 (44%), Gaps = 3/150 (2%)
 Frame = +2

Query: 161 KEDQKEWVPVTKLGRLVREGKIDKLESIYLFFYQSKNSRSL---ISSSARP*MMRFLRSC 331
           K + KEW+PVTKLGRLV++ KI  LE IYLF    K S  +   + +S +  +++ +   
Sbjct: 54  KAEDKEWMPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMP-- 111

Query: 332 LYRNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCQF*PVRRSYG 511
           + +             +        + + V   +++        + L      PVRR Y 
Sbjct: 112 VQKQTRAGQRTRFKAFVAIGDYNGHVGLGV-KCSKEVATAIRGAIILAKLSIVPVRRGYW 170

Query: 512 VTR*ESHTTVPCKVXGQXWFPKQFRLIPAP 601
             +     TVPCKV G+       RLIPAP
Sbjct: 171 GNKIGKPHTVPCKVTGRCG-SVLVRLIPAP 199


>BC071924-1|AAH71924.1|  293|Homo sapiens ribosomal protein S2
           protein.
          Length = 293

 Score =  165 bits (400), Expect = 3e-40
 Identities = 83/108 (76%), Positives = 88/108 (81%)
 Frame = +1

Query: 220 KNRQTREHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDN 399
           K +   E  L  LPIKE EIIDFFLG SL DEVLKIMPVQKQTRAGQRTRFKAFVAIGD 
Sbjct: 74  KIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDY 133

Query: 400 NGHIGLGVKCSKEVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRP 543
           NGH+GLGVKCSKEVATAIRGAIILAKLS++   +   GNKIGKPH  P
Sbjct: 134 NGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVP 181



 Score = 54.8 bits (126), Expect = 4e-07
 Identities = 44/150 (29%), Positives = 67/150 (44%), Gaps = 3/150 (2%)
 Frame = +2

Query: 161 KEDQKEWVPVTKLGRLVREGKIDKLESIYLFFYQSKNSRSL---ISSSARP*MMRFLRSC 331
           K + KEW+PVTKLGRLV++ KI  LE IYLF    K S  +   + +S +  +++ +   
Sbjct: 54  KAEDKEWMPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMP-- 111

Query: 332 LYRNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCQF*PVRRSYG 511
           + +             +        + + V   +++        + L      PVRR Y 
Sbjct: 112 VQKQTRAGQRTRFKAFVAIGDYNGHVGLGV-KCSKEVATAIRGAIILAKLSIVPVRRGYW 170

Query: 512 VTR*ESHTTVPCKVXGQXWFPKQFRLIPAP 601
             +     TVPCKV G+       RLIPAP
Sbjct: 171 GNKIGKPHTVPCKVTGRCG-SVLVRLIPAP 199


>BC071923-1|AAH71923.1|  293|Homo sapiens ribosomal protein S2
           protein.
          Length = 293

 Score =  165 bits (400), Expect = 3e-40
 Identities = 83/108 (76%), Positives = 88/108 (81%)
 Frame = +1

Query: 220 KNRQTREHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDN 399
           K +   E  L  LPIKE EIIDFFLG SL DEVLKIMPVQKQTRAGQRTRFKAFVAIGD 
Sbjct: 74  KIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDY 133

Query: 400 NGHIGLGVKCSKEVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRP 543
           NGH+GLGVKCSKEVATAIRGAIILAKLS++   +   GNKIGKPH  P
Sbjct: 134 NGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVP 181



 Score = 54.8 bits (126), Expect = 4e-07
 Identities = 44/150 (29%), Positives = 67/150 (44%), Gaps = 3/150 (2%)
 Frame = +2

Query: 161 KEDQKEWVPVTKLGRLVREGKIDKLESIYLFFYQSKNSRSL---ISSSARP*MMRFLRSC 331
           K + KEW+PVTKLGRLV++ KI  LE IYLF    K S  +   + +S +  +++ +   
Sbjct: 54  KAEDKEWMPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMP-- 111

Query: 332 LYRNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCQF*PVRRSYG 511
           + +             +        + + V   +++        + L      PVRR Y 
Sbjct: 112 VQKQTRAGQRTRFKAFVAIGDYNGHVGLGV-KCSKEVATAIRGAIILAKLSIVPVRRGYW 170

Query: 512 VTR*ESHTTVPCKVXGQXWFPKQFRLIPAP 601
             +     TVPCKV G+       RLIPAP
Sbjct: 171 GNKIGKPHTVPCKVTGRCG-SVLVRLIPAP 199


>BC071922-1|AAH71922.1|  293|Homo sapiens ribosomal protein S2
           protein.
          Length = 293

 Score =  165 bits (400), Expect = 3e-40
 Identities = 83/108 (76%), Positives = 88/108 (81%)
 Frame = +1

Query: 220 KNRQTREHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDN 399
           K +   E  L  LPIKE EIIDFFLG SL DEVLKIMPVQKQTRAGQRTRFKAFVAIGD 
Sbjct: 74  KIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDY 133

Query: 400 NGHIGLGVKCSKEVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRP 543
           NGH+GLGVKCSKEVATAIRGAIILAKLS++   +   GNKIGKPH  P
Sbjct: 134 NGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVP 181



 Score = 54.8 bits (126), Expect = 4e-07
 Identities = 44/150 (29%), Positives = 67/150 (44%), Gaps = 3/150 (2%)
 Frame = +2

Query: 161 KEDQKEWVPVTKLGRLVREGKIDKLESIYLFFYQSKNSRSL---ISSSARP*MMRFLRSC 331
           K + KEW+PVTKLGRLV++ KI  LE IYLF    K S  +   + +S +  +++ +   
Sbjct: 54  KAEDKEWMPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMP-- 111

Query: 332 LYRNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCQF*PVRRSYG 511
           + +             +        + + V   +++        + L      PVRR Y 
Sbjct: 112 VQKQTRAGQRTRFKAFVAIGDYNGHVGLGV-KCSKEVATAIRGAIILAKLSIVPVRRGYW 170

Query: 512 VTR*ESHTTVPCKVXGQXWFPKQFRLIPAP 601
             +     TVPCKV G+       RLIPAP
Sbjct: 171 GNKIGKPHTVPCKVTGRCG-SVLVRLIPAP 199


>BC071673-1|AAH71673.1|  293|Homo sapiens ribosomal protein S2
           protein.
          Length = 293

 Score =  165 bits (400), Expect = 3e-40
 Identities = 83/108 (76%), Positives = 88/108 (81%)
 Frame = +1

Query: 220 KNRQTREHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDN 399
           K +   E  L  LPIKE EIIDFFLG SL DEVLKIMPVQKQTRAGQRTRFKAFVAIGD 
Sbjct: 74  KIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDY 133

Query: 400 NGHIGLGVKCSKEVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRP 543
           NGH+GLGVKCSKEVATAIRGAIILAKLS++   +   GNKIGKPH  P
Sbjct: 134 NGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVP 181



 Score = 54.8 bits (126), Expect = 4e-07
 Identities = 44/150 (29%), Positives = 67/150 (44%), Gaps = 3/150 (2%)
 Frame = +2

Query: 161 KEDQKEWVPVTKLGRLVREGKIDKLESIYLFFYQSKNSRSL---ISSSARP*MMRFLRSC 331
           K + KEW+PVTKLGRLV++ KI  LE IYLF    K S  +   + +S +  +++ +   
Sbjct: 54  KAEDKEWMPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMP-- 111

Query: 332 LYRNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCQF*PVRRSYG 511
           + +             +        + + V   +++        + L      PVRR Y 
Sbjct: 112 VQKQTRAGQRTRFKAFVAIGDYNGHVGLGV-KCSKEVATAIRGAIILAKLSIVPVRRGYW 170

Query: 512 VTR*ESHTTVPCKVXGQXWFPKQFRLIPAP 601
             +     TVPCKV G+       RLIPAP
Sbjct: 171 GNKIGKPHTVPCKVTGRCG-SVLVRLIPAP 199


>BC068051-1|AAH68051.1|  293|Homo sapiens ribosomal protein S2
           protein.
          Length = 293

 Score =  165 bits (400), Expect = 3e-40
 Identities = 83/108 (76%), Positives = 88/108 (81%)
 Frame = +1

Query: 220 KNRQTREHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDN 399
           K +   E  L  LPIKE EIIDFFLG SL DEVLKIMPVQKQTRAGQRTRFKAFVAIGD 
Sbjct: 74  KIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDY 133

Query: 400 NGHIGLGVKCSKEVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRP 543
           NGH+GLGVKCSKEVATAIRGAIILAKLS++   +   GNKIGKPH  P
Sbjct: 134 NGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVP 181



 Score = 54.8 bits (126), Expect = 4e-07
 Identities = 44/150 (29%), Positives = 67/150 (44%), Gaps = 3/150 (2%)
 Frame = +2

Query: 161 KEDQKEWVPVTKLGRLVREGKIDKLESIYLFFYQSKNSRSL---ISSSARP*MMRFLRSC 331
           K + KEW+PVTKLGRLV++ KI  LE IYLF    K S  +   + +S +  +++ +   
Sbjct: 54  KAEDKEWMPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMP-- 111

Query: 332 LYRNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCQF*PVRRSYG 511
           + +             +        + + V   +++        + L      PVRR Y 
Sbjct: 112 VQKQTRAGQRTRFKAFVAIGDYNGHVGLGV-KCSKEVATAIRGAIILAKLSIVPVRRGYW 170

Query: 512 VTR*ESHTTVPCKVXGQXWFPKQFRLIPAP 601
             +     TVPCKV G+       RLIPAP
Sbjct: 171 GNKIGKPHTVPCKVTGRCG-SVLVRLIPAP 199


>BC066321-1|AAH66321.1|  293|Homo sapiens ribosomal protein S2
           protein.
          Length = 293

 Score =  165 bits (400), Expect = 3e-40
 Identities = 83/108 (76%), Positives = 88/108 (81%)
 Frame = +1

Query: 220 KNRQTREHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDN 399
           K +   E  L  LPIKE EIIDFFLG SL DEVLKIMPVQKQTRAGQRTRFKAFVAIGD 
Sbjct: 74  KIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDY 133

Query: 400 NGHIGLGVKCSKEVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRP 543
           NGH+GLGVKCSKEVATAIRGAIILAKLS++   +   GNKIGKPH  P
Sbjct: 134 NGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVP 181



 Score = 54.8 bits (126), Expect = 4e-07
 Identities = 44/150 (29%), Positives = 67/150 (44%), Gaps = 3/150 (2%)
 Frame = +2

Query: 161 KEDQKEWVPVTKLGRLVREGKIDKLESIYLFFYQSKNSRSL---ISSSARP*MMRFLRSC 331
           K + KEW+PVTKLGRLV++ KI  LE IYLF    K S  +   + +S +  +++ +   
Sbjct: 54  KAEDKEWMPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMP-- 111

Query: 332 LYRNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCQF*PVRRSYG 511
           + +             +        + + V   +++        + L      PVRR Y 
Sbjct: 112 VQKQTRAGQRTRFKAFVAIGDYNGHVGLGV-KCSKEVATAIRGAIILAKLSIVPVRRGYW 170

Query: 512 VTR*ESHTTVPCKVXGQXWFPKQFRLIPAP 601
             +     TVPCKV G+       RLIPAP
Sbjct: 171 GNKIGKPHTVPCKVTGRCG-SVLVRLIPAP 199


>BC032129-1|AAH32129.1|  293|Homo sapiens ribosomal protein S2
           protein.
          Length = 293

 Score =  165 bits (400), Expect = 3e-40
 Identities = 83/108 (76%), Positives = 88/108 (81%)
 Frame = +1

Query: 220 KNRQTREHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDN 399
           K +   E  L  LPIKE EIIDFFLG SL DEVLKIMPVQKQTRAGQRTRFKAFVAIGD 
Sbjct: 74  KIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDY 133

Query: 400 NGHIGLGVKCSKEVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRP 543
           NGH+GLGVKCSKEVATAIRGAIILAKLS++   +   GNKIGKPH  P
Sbjct: 134 NGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVP 181



 Score = 54.8 bits (126), Expect = 4e-07
 Identities = 44/150 (29%), Positives = 67/150 (44%), Gaps = 3/150 (2%)
 Frame = +2

Query: 161 KEDQKEWVPVTKLGRLVREGKIDKLESIYLFFYQSKNSRSL---ISSSARP*MMRFLRSC 331
           K + KEW+PVTKLGRLV++ KI  LE IYLF    K S  +   + +S +  +++ +   
Sbjct: 54  KAEDKEWMPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMP-- 111

Query: 332 LYRNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCQF*PVRRSYG 511
           + +             +        + + V   +++        + L      PVRR Y 
Sbjct: 112 VQKQTRAGQRTRFKAFVAIGDYNGHVGLGV-KCSKEVATAIRGAIILAKLSIVPVRRGYW 170

Query: 512 VTR*ESHTTVPCKVXGQXWFPKQFRLIPAP 601
             +     TVPCKV G+       RLIPAP
Sbjct: 171 GNKIGKPHTVPCKVTGRCG-SVLVRLIPAP 199


>BC025677-1|AAH25677.1|  293|Homo sapiens ribosomal protein S2
           protein.
          Length = 293

 Score =  165 bits (400), Expect = 3e-40
 Identities = 83/108 (76%), Positives = 88/108 (81%)
 Frame = +1

Query: 220 KNRQTREHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDN 399
           K +   E  L  LPIKE EIIDFFLG SL DEVLKIMPVQKQTRAGQRTRFKAFVAIGD 
Sbjct: 74  KIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDY 133

Query: 400 NGHIGLGVKCSKEVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRP 543
           NGH+GLGVKCSKEVATAIRGAIILAKLS++   +   GNKIGKPH  P
Sbjct: 134 NGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVP 181



 Score = 54.8 bits (126), Expect = 4e-07
 Identities = 44/150 (29%), Positives = 67/150 (44%), Gaps = 3/150 (2%)
 Frame = +2

Query: 161 KEDQKEWVPVTKLGRLVREGKIDKLESIYLFFYQSKNSRSL---ISSSARP*MMRFLRSC 331
           K + KEW+PVTKLGRLV++ KI  LE IYLF    K S  +   + +S +  +++ +   
Sbjct: 54  KAEDKEWMPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMP-- 111

Query: 332 LYRNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCQF*PVRRSYG 511
           + +             +        + + V   +++        + L      PVRR Y 
Sbjct: 112 VQKQTRAGQRTRFKAFVAIGDYNGHVGLGV-KCSKEVATAIRGAIILAKLSIVPVRRGYW 170

Query: 512 VTR*ESHTTVPCKVXGQXWFPKQFRLIPAP 601
             +     TVPCKV G+       RLIPAP
Sbjct: 171 GNKIGKPHTVPCKVTGRCG-SVLVRLIPAP 199


>BC023541-1|AAH23541.1|  293|Homo sapiens ribosomal protein S2
           protein.
          Length = 293

 Score =  165 bits (400), Expect = 3e-40
 Identities = 83/108 (76%), Positives = 88/108 (81%)
 Frame = +1

Query: 220 KNRQTREHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDN 399
           K +   E  L  LPIKE EIIDFFLG SL DEVLKIMPVQKQTRAGQRTRFKAFVAIGD 
Sbjct: 74  KIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDY 133

Query: 400 NGHIGLGVKCSKEVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRP 543
           NGH+GLGVKCSKEVATAIRGAIILAKLS++   +   GNKIGKPH  P
Sbjct: 134 NGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVP 181



 Score = 54.8 bits (126), Expect = 4e-07
 Identities = 44/150 (29%), Positives = 67/150 (44%), Gaps = 3/150 (2%)
 Frame = +2

Query: 161 KEDQKEWVPVTKLGRLVREGKIDKLESIYLFFYQSKNSRSL---ISSSARP*MMRFLRSC 331
           K + KEW+PVTKLGRLV++ KI  LE IYLF    K S  +   + +S +  +++ +   
Sbjct: 54  KAEDKEWMPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMP-- 111

Query: 332 LYRNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCQF*PVRRSYG 511
           + +             +        + + V   +++        + L      PVRR Y 
Sbjct: 112 VQKQTRAGQRTRFKAFVAIGDYNGHVGLGV-KCSKEVATAIRGAIILAKLSIVPVRRGYW 170

Query: 512 VTR*ESHTTVPCKVXGQXWFPKQFRLIPAP 601
             +     TVPCKV G+       RLIPAP
Sbjct: 171 GNKIGKPHTVPCKVTGRCG-SVLVRLIPAP 199


>BC021545-1|AAH21545.1|  293|Homo sapiens ribosomal protein S2
           protein.
          Length = 293

 Score =  165 bits (400), Expect = 3e-40
 Identities = 83/108 (76%), Positives = 88/108 (81%)
 Frame = +1

Query: 220 KNRQTREHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDN 399
           K +   E  L  LPIKE EIIDFFLG SL DEVLKIMPVQKQTRAGQRTRFKAFVAIGD 
Sbjct: 74  KIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDY 133

Query: 400 NGHIGLGVKCSKEVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRP 543
           NGH+GLGVKCSKEVATAIRGAIILAKLS++   +   GNKIGKPH  P
Sbjct: 134 NGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVP 181



 Score = 54.8 bits (126), Expect = 4e-07
 Identities = 44/150 (29%), Positives = 67/150 (44%), Gaps = 3/150 (2%)
 Frame = +2

Query: 161 KEDQKEWVPVTKLGRLVREGKIDKLESIYLFFYQSKNSRSL---ISSSARP*MMRFLRSC 331
           K + KEW+PVTKLGRLV++ KI  LE IYLF    K S  +   + +S +  +++ +   
Sbjct: 54  KAEDKEWMPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMP-- 111

Query: 332 LYRNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCQF*PVRRSYG 511
           + +             +        + + V   +++        + L      PVRR Y 
Sbjct: 112 VQKQTRAGQRTRFKAFVAIGDYNGHVGLGV-KCSKEVATAIRGAIILAKLSIVPVRRGYW 170

Query: 512 VTR*ESHTTVPCKVXGQXWFPKQFRLIPAP 601
             +     TVPCKV G+       RLIPAP
Sbjct: 171 GNKIGKPHTVPCKVTGRCG-SVLVRLIPAP 199


>BC018993-1|AAH18993.1|  293|Homo sapiens ribosomal protein S2
           protein.
          Length = 293

 Score =  165 bits (400), Expect = 3e-40
 Identities = 83/108 (76%), Positives = 88/108 (81%)
 Frame = +1

Query: 220 KNRQTREHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDN 399
           K +   E  L  LPIKE EIIDFFLG SL DEVLKIMPVQKQTRAGQRTRFKAFVAIGD 
Sbjct: 74  KIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDY 133

Query: 400 NGHIGLGVKCSKEVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRP 543
           NGH+GLGVKCSKEVATAIRGAIILAKLS++   +   GNKIGKPH  P
Sbjct: 134 NGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVP 181



 Score = 54.8 bits (126), Expect = 4e-07
 Identities = 44/150 (29%), Positives = 67/150 (44%), Gaps = 3/150 (2%)
 Frame = +2

Query: 161 KEDQKEWVPVTKLGRLVREGKIDKLESIYLFFYQSKNSRSL---ISSSARP*MMRFLRSC 331
           K + KEW+PVTKLGRLV++ KI  LE IYLF    K S  +   + +S +  +++ +   
Sbjct: 54  KAEDKEWMPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMP-- 111

Query: 332 LYRNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCQF*PVRRSYG 511
           + +             +        + + V   +++        + L      PVRR Y 
Sbjct: 112 VQKQTRAGQRTRFKAFVAIGDYNGHVGLGV-KCSKEVATAIRGAIILAKLSIVPVRRGYW 170

Query: 512 VTR*ESHTTVPCKVXGQXWFPKQFRLIPAP 601
             +     TVPCKV G+       RLIPAP
Sbjct: 171 GNKIGKPHTVPCKVTGRCG-SVLVRLIPAP 199


>BC016951-1|AAH16951.1|  293|Homo sapiens ribosomal protein S2
           protein.
          Length = 293

 Score =  165 bits (400), Expect = 3e-40
 Identities = 83/108 (76%), Positives = 88/108 (81%)
 Frame = +1

Query: 220 KNRQTREHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDN 399
           K +   E  L  LPIKE EIIDFFLG SL DEVLKIMPVQKQTRAGQRTRFKAFVAIGD 
Sbjct: 74  KIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDY 133

Query: 400 NGHIGLGVKCSKEVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRP 543
           NGH+GLGVKCSKEVATAIRGAIILAKLS++   +   GNKIGKPH  P
Sbjct: 134 NGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVP 181



 Score = 54.8 bits (126), Expect = 4e-07
 Identities = 44/150 (29%), Positives = 67/150 (44%), Gaps = 3/150 (2%)
 Frame = +2

Query: 161 KEDQKEWVPVTKLGRLVREGKIDKLESIYLFFYQSKNSRSL---ISSSARP*MMRFLRSC 331
           K + KEW+PVTKLGRLV++ KI  LE IYLF    K S  +   + +S +  +++ +   
Sbjct: 54  KAEDKEWMPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMP-- 111

Query: 332 LYRNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCQF*PVRRSYG 511
           + +             +        + + V   +++        + L      PVRR Y 
Sbjct: 112 VQKQTRAGQRTRFKAFVAIGDYNGHVGLGV-KCSKEVATAIRGAIILAKLSIVPVRRGYW 170

Query: 512 VTR*ESHTTVPCKVXGQXWFPKQFRLIPAP 601
             +     TVPCKV G+       RLIPAP
Sbjct: 171 GNKIGKPHTVPCKVTGRCG-SVLVRLIPAP 199


>BC016178-1|AAH16178.1|  293|Homo sapiens ribosomal protein S2
           protein.
          Length = 293

 Score =  165 bits (400), Expect = 3e-40
 Identities = 83/108 (76%), Positives = 88/108 (81%)
 Frame = +1

Query: 220 KNRQTREHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDN 399
           K +   E  L  LPIKE EIIDFFLG SL DEVLKIMPVQKQTRAGQRTRFKAFVAIGD 
Sbjct: 74  KIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDY 133

Query: 400 NGHIGLGVKCSKEVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRP 543
           NGH+GLGVKCSKEVATAIRGAIILAKLS++   +   GNKIGKPH  P
Sbjct: 134 NGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVP 181



 Score = 54.8 bits (126), Expect = 4e-07
 Identities = 44/150 (29%), Positives = 67/150 (44%), Gaps = 3/150 (2%)
 Frame = +2

Query: 161 KEDQKEWVPVTKLGRLVREGKIDKLESIYLFFYQSKNSRSL---ISSSARP*MMRFLRSC 331
           K + KEW+PVTKLGRLV++ KI  LE IYLF    K S  +   + +S +  +++ +   
Sbjct: 54  KAEDKEWMPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMP-- 111

Query: 332 LYRNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCQF*PVRRSYG 511
           + +             +        + + V   +++        + L      PVRR Y 
Sbjct: 112 VQKQTRAGQRTRFKAFVAIGDYNGHVGLGV-KCSKEVATAIRGAIILAKLSIVPVRRGYW 170

Query: 512 VTR*ESHTTVPCKVXGQXWFPKQFRLIPAP 601
             +     TVPCKV G+       RLIPAP
Sbjct: 171 GNKIGKPHTVPCKVTGRCG-SVLVRLIPAP 199


>BC012354-1|AAH12354.1|  293|Homo sapiens ribosomal protein S2
           protein.
          Length = 293

 Score =  165 bits (400), Expect = 3e-40
 Identities = 83/108 (76%), Positives = 88/108 (81%)
 Frame = +1

Query: 220 KNRQTREHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDN 399
           K +   E  L  LPIKE EIIDFFLG SL DEVLKIMPVQKQTRAGQRTRFKAFVAIGD 
Sbjct: 74  KIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDY 133

Query: 400 NGHIGLGVKCSKEVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRP 543
           NGH+GLGVKCSKEVATAIRGAIILAKLS++   +   GNKIGKPH  P
Sbjct: 134 NGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVP 181



 Score = 54.8 bits (126), Expect = 4e-07
 Identities = 44/150 (29%), Positives = 67/150 (44%), Gaps = 3/150 (2%)
 Frame = +2

Query: 161 KEDQKEWVPVTKLGRLVREGKIDKLESIYLFFYQSKNSRSL---ISSSARP*MMRFLRSC 331
           K + KEW+PVTKLGRLV++ KI  LE IYLF    K S  +   + +S +  +++ +   
Sbjct: 54  KAEDKEWMPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMP-- 111

Query: 332 LYRNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCQF*PVRRSYG 511
           + +             +        + + V   +++        + L      PVRR Y 
Sbjct: 112 VQKQTRAGQRTRFKAFVAIGDYNGHVGLGV-KCSKEVATAIRGAIILAKLSIVPVRRGYW 170

Query: 512 VTR*ESHTTVPCKVXGQXWFPKQFRLIPAP 601
             +     TVPCKV G+       RLIPAP
Sbjct: 171 GNKIGKPHTVPCKVTGRCG-SVLVRLIPAP 199


>BC010165-1|AAH10165.1|  293|Homo sapiens ribosomal protein S2
           protein.
          Length = 293

 Score =  165 bits (400), Expect = 3e-40
 Identities = 83/108 (76%), Positives = 88/108 (81%)
 Frame = +1

Query: 220 KNRQTREHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDN 399
           K +   E  L  LPIKE EIIDFFLG SL DEVLKIMPVQKQTRAGQRTRFKAFVAIGD 
Sbjct: 74  KIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDY 133

Query: 400 NGHIGLGVKCSKEVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRP 543
           NGH+GLGVKCSKEVATAIRGAIILAKLS++   +   GNKIGKPH  P
Sbjct: 134 NGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVP 181



 Score = 54.8 bits (126), Expect = 4e-07
 Identities = 44/150 (29%), Positives = 67/150 (44%), Gaps = 3/150 (2%)
 Frame = +2

Query: 161 KEDQKEWVPVTKLGRLVREGKIDKLESIYLFFYQSKNSRSL---ISSSARP*MMRFLRSC 331
           K + KEW+PVTKLGRLV++ KI  LE IYLF    K S  +   + +S +  +++ +   
Sbjct: 54  KAEDKEWMPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMP-- 111

Query: 332 LYRNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCQF*PVRRSYG 511
           + +             +        + + V   +++        + L      PVRR Y 
Sbjct: 112 VQKQTRAGQRTRFKAFVAIGDYNGHVGLGV-KCSKEVATAIRGAIILAKLSIVPVRRGYW 170

Query: 512 VTR*ESHTTVPCKVXGQXWFPKQFRLIPAP 601
             +     TVPCKV G+       RLIPAP
Sbjct: 171 GNKIGKPHTVPCKVTGRCG-SVLVRLIPAP 199


>BC008862-1|AAH08862.1|  293|Homo sapiens ribosomal protein S2
           protein.
          Length = 293

 Score =  165 bits (400), Expect = 3e-40
 Identities = 83/108 (76%), Positives = 88/108 (81%)
 Frame = +1

Query: 220 KNRQTREHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDN 399
           K +   E  L  LPIKE EIIDFFLG SL DEVLKIMPVQKQTRAGQRTRFKAFVAIGD 
Sbjct: 74  KIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDY 133

Query: 400 NGHIGLGVKCSKEVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRP 543
           NGH+GLGVKCSKEVATAIRGAIILAKLS++   +   GNKIGKPH  P
Sbjct: 134 NGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVP 181



 Score = 54.8 bits (126), Expect = 4e-07
 Identities = 44/150 (29%), Positives = 67/150 (44%), Gaps = 3/150 (2%)
 Frame = +2

Query: 161 KEDQKEWVPVTKLGRLVREGKIDKLESIYLFFYQSKNSRSL---ISSSARP*MMRFLRSC 331
           K + KEW+PVTKLGRLV++ KI  LE IYLF    K S  +   + +S +  +++ +   
Sbjct: 54  KAEDKEWMPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMP-- 111

Query: 332 LYRNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCQF*PVRRSYG 511
           + +             +        + + V   +++        + L      PVRR Y 
Sbjct: 112 VQKQTRAGQRTRFKAFVAIGDYNGHVGLGV-KCSKEVATAIRGAIILAKLSIVPVRRGYW 170

Query: 512 VTR*ESHTTVPCKVXGQXWFPKQFRLIPAP 601
             +     TVPCKV G+       RLIPAP
Sbjct: 171 GNKIGKPHTVPCKVTGRCG-SVLVRLIPAP 199


>BC006559-1|AAH06559.1|  293|Homo sapiens ribosomal protein S2
           protein.
          Length = 293

 Score =  165 bits (400), Expect = 3e-40
 Identities = 83/108 (76%), Positives = 88/108 (81%)
 Frame = +1

Query: 220 KNRQTREHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDN 399
           K +   E  L  LPIKE EIIDFFLG SL DEVLKIMPVQKQTRAGQRTRFKAFVAIGD 
Sbjct: 74  KIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDY 133

Query: 400 NGHIGLGVKCSKEVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRP 543
           NGH+GLGVKCSKEVATAIRGAIILAKLS++   +   GNKIGKPH  P
Sbjct: 134 NGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVP 181



 Score = 54.8 bits (126), Expect = 4e-07
 Identities = 44/150 (29%), Positives = 67/150 (44%), Gaps = 3/150 (2%)
 Frame = +2

Query: 161 KEDQKEWVPVTKLGRLVREGKIDKLESIYLFFYQSKNSRSL---ISSSARP*MMRFLRSC 331
           K + KEW+PVTKLGRLV++ KI  LE IYLF    K S  +   + +S +  +++ +   
Sbjct: 54  KAEDKEWMPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMP-- 111

Query: 332 LYRNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCQF*PVRRSYG 511
           + +             +        + + V   +++        + L      PVRR Y 
Sbjct: 112 VQKQTRAGQRTRFKAFVAIGDYNGHVGLGV-KCSKEVATAIRGAIILAKLSIVPVRRGYW 170

Query: 512 VTR*ESHTTVPCKVXGQXWFPKQFRLIPAP 601
             +     TVPCKV G+       RLIPAP
Sbjct: 171 GNKIGKPHTVPCKVTGRCG-SVLVRLIPAP 199


>BC001795-1|AAH01795.1|  293|Homo sapiens ribosomal protein S2
           protein.
          Length = 293

 Score =  165 bits (400), Expect = 3e-40
 Identities = 83/108 (76%), Positives = 88/108 (81%)
 Frame = +1

Query: 220 KNRQTREHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDN 399
           K +   E  L  LPIKE EIIDFFLG SL DEVLKIMPVQKQTRAGQRTRFKAFVAIGD 
Sbjct: 74  KIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDY 133

Query: 400 NGHIGLGVKCSKEVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRP 543
           NGH+GLGVKCSKEVATAIRGAIILAKLS++   +   GNKIGKPH  P
Sbjct: 134 NGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVP 181



 Score = 54.8 bits (126), Expect = 4e-07
 Identities = 44/150 (29%), Positives = 67/150 (44%), Gaps = 3/150 (2%)
 Frame = +2

Query: 161 KEDQKEWVPVTKLGRLVREGKIDKLESIYLFFYQSKNSRSL---ISSSARP*MMRFLRSC 331
           K + KEW+PVTKLGRLV++ KI  LE IYLF    K S  +   + +S +  +++ +   
Sbjct: 54  KAEDKEWMPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMP-- 111

Query: 332 LYRNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCQF*PVRRSYG 511
           + +             +        + + V   +++        + L      PVRR Y 
Sbjct: 112 VQKQTRAGQRTRFKAFVAIGDYNGHVGLGV-KCSKEVATAIRGAIILAKLSIVPVRRGYW 170

Query: 512 VTR*ESHTTVPCKVXGQXWFPKQFRLIPAP 601
             +     TVPCKV G+       RLIPAP
Sbjct: 171 GNKIGKPHTVPCKVTGRCG-SVLVRLIPAP 199


>AB082925-1|BAC16801.1|  233|Homo sapiens ribosomal protein S2
           protein.
          Length = 233

 Score =  165 bits (400), Expect = 3e-40
 Identities = 83/108 (76%), Positives = 88/108 (81%)
 Frame = +1

Query: 220 KNRQTREHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDN 399
           K +   E  L  LPIKE EIIDFFLG SL DEVLKIMPVQKQTRAGQRTRFKAFVAIGD 
Sbjct: 14  KIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDY 73

Query: 400 NGHIGLGVKCSKEVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRP 543
           NGH+GLGVKCSKEVATAIRGAIILAKLS++   +   GNKIGKPH  P
Sbjct: 74  NGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVP 121



 Score = 44.0 bits (99), Expect = 8e-04
 Identities = 40/143 (27%), Positives = 62/143 (43%), Gaps = 3/143 (2%)
 Frame = +2

Query: 182 VPVTKLGRLVREGKIDKLESIYLFFYQSKNSRSL---ISSSARP*MMRFLRSCLYRNKHV 352
           +PVTKLGRLV++ KI  LE IYLF    K S  +   + +S +  +++ +   + +    
Sbjct: 1   MPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMP--VQKQTRA 58

Query: 353 PDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCQF*PVRRSYGVTR*ESH 532
                    +        + + V   +++        + L      PVRR Y   +    
Sbjct: 59  GQRTRFKAFVAIGDYNGHVGLGV-KCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKP 117

Query: 533 TTVPCKVXGQXWFPKQFRLIPAP 601
            TVPCKV G+       RLIPAP
Sbjct: 118 HTVPCKVTGRCG-SVLVRLIPAP 139


>AB065089-1|BAB93526.1|  203|Homo sapiens ribosomal protein S2
           protein.
          Length = 203

 Score =  165 bits (400), Expect = 3e-40
 Identities = 83/108 (76%), Positives = 88/108 (81%)
 Frame = +1

Query: 220 KNRQTREHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDN 399
           K +   E  L  LPIKE EIIDFFLG SL DEVLKIMPVQKQTRAGQRTRFKAFVAIGD 
Sbjct: 74  KIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDY 133

Query: 400 NGHIGLGVKCSKEVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRP 543
           NGH+GLGVKCSKEVATAIRGAIILAKLS++   +   GNKIGKPH  P
Sbjct: 134 NGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVP 181



 Score = 50.0 bits (114), Expect = 1e-05
 Identities = 23/38 (60%), Positives = 27/38 (71%)
 Frame = +2

Query: 161 KEDQKEWVPVTKLGRLVREGKIDKLESIYLFFYQSKNS 274
           K + KEW+PVTKLGRLV++ KI  LE IYLF    K S
Sbjct: 54  KAEDKEWMPVTKLGRLVKDMKIKSLEEIYLFSLPIKES 91


>BC026177-1|AAH26177.1|  172|Homo sapiens MGC27348 protein protein.
          Length = 172

 Score = 93.5 bits (222), Expect = 1e-18
 Identities = 47/65 (72%), Positives = 51/65 (78%)
 Frame = +1

Query: 220 KNRQTREHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDN 399
           K +   E  L  LPIKE EIIDFFLG SL DEVLKIMPV+K+TRAGQRTRFKAFVAI D 
Sbjct: 2   KIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVRKETRAGQRTRFKAFVAIRDY 61

Query: 400 NGHIG 414
           NG+ G
Sbjct: 62  NGYAG 66


>BC030267-1|AAH30267.1| 1158|Homo sapiens ATP13A2 protein protein.
          Length = 1158

 Score = 35.1 bits (77), Expect = 0.38
 Identities = 19/53 (35%), Positives = 26/53 (49%)
 Frame = -3

Query: 254 KTSKCSRVCRFFLREQDGRVW*QEPTLSGLPCRAHDHGRDHDRVHEDRHGLYL 96
           K+ +  RV R++L +    +W  E   +       DHGR  D VH  RHGL L
Sbjct: 150 KSEEAKRVLRYYLFQGQRYIW-IETQQAFYQVSLLDHGRSCDDVHRSRHGLSL 201


>AY461712-1|AAR23423.1| 1175|Homo sapiens putative N-ATPase protein.
          Length = 1175

 Score = 35.1 bits (77), Expect = 0.38
 Identities = 19/53 (35%), Positives = 26/53 (49%)
 Frame = -3

Query: 254 KTSKCSRVCRFFLREQDGRVW*QEPTLSGLPCRAHDHGRDHDRVHEDRHGLYL 96
           K+ +  RV R++L +    +W  E   +       DHGR  D VH  RHGL L
Sbjct: 150 KSEEAKRVLRYYLFQGQRYIW-IETQQAFYQVSLLDHGRSCDDVHRSRHGLSL 201


>AL049569-7|CAI20367.1| 1158|Homo sapiens ATPase type 13A2 protein.
          Length = 1158

 Score = 35.1 bits (77), Expect = 0.38
 Identities = 19/53 (35%), Positives = 26/53 (49%)
 Frame = -3

Query: 254 KTSKCSRVCRFFLREQDGRVW*QEPTLSGLPCRAHDHGRDHDRVHEDRHGLYL 96
           K+ +  RV R++L +    +W  E   +       DHGR  D VH  RHGL L
Sbjct: 150 KSEEAKRVLRYYLFQGQRYIW-IETQQAFYQVSLLDHGRSCDDVHRSRHGLSL 201


>BC034575-1|AAH34575.1| 1088|Homo sapiens ATP13A2 protein protein.
          Length = 1088

 Score = 32.3 bits (70), Expect = 2.7
 Identities = 18/47 (38%), Positives = 23/47 (48%)
 Frame = -3

Query: 236 RVCRFFLREQDGRVW*QEPTLSGLPCRAHDHGRDHDRVHEDRHGLYL 96
           RV R++L +    +W  E   +       DHGR  D VH  RHGL L
Sbjct: 69  RVLRYYLFQGQRYIW-IETQQAFYQVSLLDHGRSCDDVHRSRHGLSL 114


>AL354615-1|CAB89728.1| 1180|Homo sapiens hypothetical protein
           protein.
          Length = 1180

 Score = 32.3 bits (70), Expect = 2.7
 Identities = 18/47 (38%), Positives = 23/47 (48%)
 Frame = -3

Query: 236 RVCRFFLREQDGRVW*QEPTLSGLPCRAHDHGRDHDRVHEDRHGLYL 96
           RV R++L +    +W  E   +       DHGR  D VH  RHGL L
Sbjct: 161 RVLRYYLFQGQRYIW-IETQQAFYQVSLLDHGRSCDDVHRSRHGLSL 206


>AL049569-6|CAI20366.1| 1180|Homo sapiens ATPase type 13A2 protein.
          Length = 1180

 Score = 32.3 bits (70), Expect = 2.7
 Identities = 18/47 (38%), Positives = 23/47 (48%)
 Frame = -3

Query: 236 RVCRFFLREQDGRVW*QEPTLSGLPCRAHDHGRDHDRVHEDRHGLYL 96
           RV R++L +    +W  E   +       DHGR  D VH  RHGL L
Sbjct: 161 RVLRYYLFQGQRYIW-IETQQAFYQVSLLDHGRSCDDVHRSRHGLSL 206


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 121,552,442
Number of Sequences: 237096
Number of extensions: 2529978
Number of successful extensions: 4206
Number of sequences better than 10.0: 33
Number of HSP's better than 10.0 without gapping: 4008
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4199
length of database: 76,859,062
effective HSP length: 90
effective length of database: 55,520,422
effective search space used: 12714176638
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -