SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30155.Seq
         (883 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB196633-1|BAE53435.1| 1857|Homo sapiens C8orfK23 protein protein.     31   7.3  
U66146-1|AAC51165.1|  592|Homo sapiens CD6e protein.                   30   9.7  
L78838-2|AAL40085.1|  592|Homo sapiens T cell surface glycoprote...    30   9.7  

>AB196633-1|BAE53435.1| 1857|Homo sapiens C8orfK23 protein protein.
          Length = 1857

 Score = 30.7 bits (66), Expect = 7.3
 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 2/55 (3%)
 Frame = +2

Query: 20   VTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPN--SCAXEWRMANCKR*YFV 178
            +TGK  A  +L+  +    +P G   K P P+A PN    +  W M+  K  Y++
Sbjct: 1762 LTGKVEAEFHLVTAEEAEKNPVGKARKEPEPLAKPNRPDTSFSWFMSPFKCLYYL 1816


>U66146-1|AAC51165.1|  592|Homo sapiens CD6e protein.
          Length = 592

 Score = 30.3 bits (65), Expect = 9.7
 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 1/47 (2%)
 Frame = +2

Query: 20  VTGKTLALPNLIALQHIPLS-PAGVIAKRPAPIALPNSCAXEWRMAN 157
           + GK  ALP ++  QH+P + PAG  + +P PI +P   +   R+ +
Sbjct: 426 IKGK-YALPVMVNHQHLPTTIPAGSNSYQPVPITIPKEDSQRHRVTD 471


>L78838-2|AAL40085.1|  592|Homo sapiens T cell surface glycoprotein
           CD6 isoform e protein.
          Length = 592

 Score = 30.3 bits (65), Expect = 9.7
 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 1/47 (2%)
 Frame = +2

Query: 20  VTGKTLALPNLIALQHIPLS-PAGVIAKRPAPIALPNSCAXEWRMAN 157
           + GK  ALP ++  QH+P + PAG  + +P PI +P   +   R+ +
Sbjct: 426 IKGK-YALPVMVNHQHLPTTIPAGSNSYQPVPITIPKEDSQRHRVTD 471


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 126,090,531
Number of Sequences: 237096
Number of extensions: 2744889
Number of successful extensions: 12069
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 11886
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12069
length of database: 76,859,062
effective HSP length: 90
effective length of database: 55,520,422
effective search space used: 11270645666
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -