SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30153.Seq
         (864 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC109372-1|AAI09373.1|  323|Homo sapiens mitochondrial ribosomal...   116   1e-25
BC063515-1|AAH63515.1|  321|Homo sapiens MRPS35 protein protein.      116   1e-25
BC028346-1|AAH28346.2|  319|Homo sapiens MRPS35 protein protein.      116   1e-25
BC015862-1|AAH15862.2|  323|Homo sapiens mitochondrial ribosomal...   116   1e-25
AK075515-1|BAC11664.1|  323|Homo sapiens protein ( Homo sapiens ...   116   1e-25
AK075378-1|BAC11579.1|  194|Homo sapiens protein ( Homo sapiens ...   116   1e-25
AF182422-1|AAG14958.1|  227|Homo sapiens MDS023 protein.               81   4e-15
Z85987-1|CAI42222.1|  961|Homo sapiens FYVE, RhoGEF and PH domai...    36   0.25 
U11690-1|AAA57004.1|  961|Homo sapiens FGD1 protein.                   36   0.25 
BC034530-1|AAH34530.1|  961|Homo sapiens FYVE, RhoGEF and PH dom...    36   0.25 
BC054003-1|AAH54003.1| 1192|Homo sapiens RNASEN protein protein.       33   1.0  
AF189011-1|AAF80558.1| 1374|Homo sapiens ribonuclease III protein.     33   1.0  
AF068296-1|AAF65185.1|  144|Homo sapiens HDCMD11P protein.             33   1.3  

>BC109372-1|AAI09373.1|  323|Homo sapiens mitochondrial ribosomal
           protein S35 protein.
          Length = 323

 Score =  116 bits (278), Expect = 1e-25
 Identities = 50/86 (58%), Positives = 60/86 (69%)
 Frame = +2

Query: 257 NQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPGKKANAELMKIPNFLHLTPPVIKSQ 436
           +Q+W +V+P    F PS+VPLP+R GY  K   P  K+ N EL+KIPNFLHLTP  IK  
Sbjct: 63  DQDWPSVYPVAAPFKPSAVPLPVRMGYPVKKGVPMAKEGNLELLKIPNFLHLTPVAIKKH 122

Query: 437 CEALKQFCTEWPNLLNSEESIEKHIP 514
           CEALK FCTEWP  L+S+E  EKH P
Sbjct: 123 CEALKDFCTEWPAALDSDEKCEKHFP 148



 Score = 75.8 bits (178), Expect = 2e-13
 Identities = 35/66 (53%), Positives = 48/66 (72%)
 Frame = +1

Query: 493 KYREAYPLEIISSDYCHASPSIRNPLARVVILRVQLADLKLDKHATDKFKRLVGDRYDPK 672
           K  + +P+EI S+DY  + PS+RNP ARVV+LRV+L+ L LD HA  K  +LVG+RY   
Sbjct: 142 KCEKHFPIEIDSTDYVSSGPSVRNPRARVVVLRVKLSSLNLDDHAKKKLIKLVGERYCKT 201

Query: 673 TDLVTI 690
           TD++TI
Sbjct: 202 TDVLTI 207


>BC063515-1|AAH63515.1|  321|Homo sapiens MRPS35 protein protein.
          Length = 321

 Score =  116 bits (278), Expect = 1e-25
 Identities = 50/86 (58%), Positives = 60/86 (69%)
 Frame = +2

Query: 257 NQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPGKKANAELMKIPNFLHLTPPVIKSQ 436
           +Q+W +V+P    F PS+VPLP+R GY  K   P  K+ N EL+KIPNFLHLTP  IK  
Sbjct: 61  DQDWPSVYPVAAPFKPSAVPLPVRMGYPVKKGVPMAKEGNLELLKIPNFLHLTPVAIKKH 120

Query: 437 CEALKQFCTEWPNLLNSEESIEKHIP 514
           CEALK FCTEWP  L+S+E  EKH P
Sbjct: 121 CEALKDFCTEWPAALDSDEKCEKHFP 146



 Score = 75.8 bits (178), Expect = 2e-13
 Identities = 35/66 (53%), Positives = 48/66 (72%)
 Frame = +1

Query: 493 KYREAYPLEIISSDYCHASPSIRNPLARVVILRVQLADLKLDKHATDKFKRLVGDRYDPK 672
           K  + +P+EI S+DY  + PS+RNP ARVV+LRV+L+ L LD HA  K  +LVG+RY   
Sbjct: 140 KCEKHFPIEIDSTDYVSSGPSVRNPRARVVVLRVKLSSLNLDDHAKKKLIKLVGERYCKT 199

Query: 673 TDLVTI 690
           TD++TI
Sbjct: 200 TDVLTI 205


>BC028346-1|AAH28346.2|  319|Homo sapiens MRPS35 protein protein.
          Length = 319

 Score =  116 bits (278), Expect = 1e-25
 Identities = 50/86 (58%), Positives = 60/86 (69%)
 Frame = +2

Query: 257 NQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPGKKANAELMKIPNFLHLTPPVIKSQ 436
           +Q+W +V+P    F PS+VPLP+R GY  K   P  K+ N EL+KIPNFLHLTP  IK  
Sbjct: 59  DQDWPSVYPVAAPFKPSAVPLPVRMGYPVKKGVPMAKEGNLELLKIPNFLHLTPVAIKKH 118

Query: 437 CEALKQFCTEWPNLLNSEESIEKHIP 514
           CEALK FCTEWP  L+S+E  EKH P
Sbjct: 119 CEALKDFCTEWPAALDSDEKCEKHFP 144



 Score = 75.8 bits (178), Expect = 2e-13
 Identities = 35/66 (53%), Positives = 48/66 (72%)
 Frame = +1

Query: 493 KYREAYPLEIISSDYCHASPSIRNPLARVVILRVQLADLKLDKHATDKFKRLVGDRYDPK 672
           K  + +P+EI S+DY  + PS+RNP ARVV+LRV+L+ L LD HA  K  +LVG+RY   
Sbjct: 138 KCEKHFPIEIDSTDYVSSGPSVRNPRARVVVLRVKLSSLNLDDHAKKKLIKLVGERYCKT 197

Query: 673 TDLVTI 690
           TD++TI
Sbjct: 198 TDVLTI 203


>BC015862-1|AAH15862.2|  323|Homo sapiens mitochondrial ribosomal
           protein S35 protein.
          Length = 323

 Score =  116 bits (278), Expect = 1e-25
 Identities = 50/86 (58%), Positives = 60/86 (69%)
 Frame = +2

Query: 257 NQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPGKKANAELMKIPNFLHLTPPVIKSQ 436
           +Q+W +V+P    F PS+VPLP+R GY  K   P  K+ N EL+KIPNFLHLTP  IK  
Sbjct: 63  DQDWPSVYPVAAPFKPSAVPLPVRMGYPVKKGVPMAKEGNLELLKIPNFLHLTPVAIKKH 122

Query: 437 CEALKQFCTEWPNLLNSEESIEKHIP 514
           CEALK FCTEWP  L+S+E  EKH P
Sbjct: 123 CEALKDFCTEWPAALDSDEKCEKHFP 148



 Score = 75.8 bits (178), Expect = 2e-13
 Identities = 35/66 (53%), Positives = 48/66 (72%)
 Frame = +1

Query: 493 KYREAYPLEIISSDYCHASPSIRNPLARVVILRVQLADLKLDKHATDKFKRLVGDRYDPK 672
           K  + +P+EI S+DY  + PS+RNP ARVV+LRV+L+ L LD HA  K  +LVG+RY   
Sbjct: 142 KCEKHFPIEIDSTDYVSSGPSVRNPRARVVVLRVKLSSLNLDDHAKKKLIKLVGERYCKT 201

Query: 673 TDLVTI 690
           TD++TI
Sbjct: 202 TDVLTI 207


>AK075515-1|BAC11664.1|  323|Homo sapiens protein ( Homo sapiens
           cDNA PSEC0213 fis, clone HEMBA1004078, highly similar to
           Mitochondrial ribosomal protein S35. ).
          Length = 323

 Score =  116 bits (278), Expect = 1e-25
 Identities = 50/86 (58%), Positives = 60/86 (69%)
 Frame = +2

Query: 257 NQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPGKKANAELMKIPNFLHLTPPVIKSQ 436
           +Q+W +V+P    F PS+VPLP+R GY  K   P  K+ N EL+KIPNFLHLTP  IK  
Sbjct: 63  DQDWPSVYPVAAPFKPSAVPLPVRMGYPVKKGVPMAKEGNLELLKIPNFLHLTPVAIKKH 122

Query: 437 CEALKQFCTEWPNLLNSEESIEKHIP 514
           CEALK FCTEWP  L+S+E  EKH P
Sbjct: 123 CEALKDFCTEWPAALDSDEKCEKHFP 148



 Score = 75.8 bits (178), Expect = 2e-13
 Identities = 35/66 (53%), Positives = 48/66 (72%)
 Frame = +1

Query: 493 KYREAYPLEIISSDYCHASPSIRNPLARVVILRVQLADLKLDKHATDKFKRLVGDRYDPK 672
           K  + +P+EI S+DY  + PS+RNP ARVV+LRV+L+ L LD HA  K  +LVG+RY   
Sbjct: 142 KCEKHFPIEIDSTDYVSSGPSVRNPRARVVVLRVKLSSLNLDDHAKKKLIKLVGERYCKT 201

Query: 673 TDLVTI 690
           TD++TI
Sbjct: 202 TDVLTI 207


>AK075378-1|BAC11579.1|  194|Homo sapiens protein ( Homo sapiens
           cDNA PSEC0068 fis, clone NT2RP2001270. ).
          Length = 194

 Score =  116 bits (278), Expect = 1e-25
 Identities = 50/86 (58%), Positives = 60/86 (69%)
 Frame = +2

Query: 257 NQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPGKKANAELMKIPNFLHLTPPVIKSQ 436
           +Q+W +V+P    F PS+VPLP+R GY  K   P  K+ N EL+KIPNFLHLTP  IK  
Sbjct: 63  DQDWPSVYPVAAPFKPSAVPLPVRMGYPVKKGVPMAKEGNLELLKIPNFLHLTPVAIKKH 122

Query: 437 CEALKQFCTEWPNLLNSEESIEKHIP 514
           CEALK FCTEWP  L+S+E  EKH P
Sbjct: 123 CEALKDFCTEWPAALDSDEKCEKHFP 148



 Score = 46.0 bits (104), Expect = 2e-04
 Identities = 20/41 (48%), Positives = 29/41 (70%)
 Frame = +1

Query: 493 KYREAYPLEIISSDYCHASPSIRNPLARVVILRVQLADLKL 615
           K  + +P+EI S+DY  + PS+RNP ARVV+LRV   + +L
Sbjct: 142 KCEKHFPIEIDSTDYVSSGPSVRNPRARVVVLRVPFKEAEL 182


>AF182422-1|AAG14958.1|  227|Homo sapiens MDS023 protein.
          Length = 227

 Score = 81.4 bits (192), Expect = 4e-15
 Identities = 34/50 (68%), Positives = 38/50 (76%)
 Frame = +2

Query: 365 KKANAELMKIPNFLHLTPPVIKSQCEALKQFCTEWPNLLNSEESIEKHIP 514
           K+ N EL+KIPNFLHLTP  IK  CEALK FCTEWP  L+S+E  EKH P
Sbjct: 3   KEGNLELLKIPNFLHLTPVAIKKHCEALKDFCTEWPAALDSDEKCEKHFP 52



 Score = 75.8 bits (178), Expect = 2e-13
 Identities = 35/66 (53%), Positives = 48/66 (72%)
 Frame = +1

Query: 493 KYREAYPLEIISSDYCHASPSIRNPLARVVILRVQLADLKLDKHATDKFKRLVGDRYDPK 672
           K  + +P+EI S+DY  + PS+RNP ARVV+LRV+L+ L LD HA  K  +LVG+RY   
Sbjct: 46  KCEKHFPIEIDSTDYVSSGPSVRNPRARVVVLRVKLSSLNLDDHAKKKLIKLVGERYCKT 105

Query: 673 TDLVTI 690
           TD++TI
Sbjct: 106 TDVLTI 111


>Z85987-1|CAI42222.1|  961|Homo sapiens FYVE, RhoGEF and PH domain
           containing 1 (faciogenital dysplasia) protein.
          Length = 961

 Score = 35.5 bits (78), Expect = 0.25
 Identities = 18/47 (38%), Positives = 26/47 (55%)
 Frame = +2

Query: 281 PGPKTFHPSSVPLPIRQGYVPKGQAPPGKKANAELMKIPNFLHLTPP 421
           PGP T  PS  P P+++   PK Q PP K +  ++ ++P  L   PP
Sbjct: 137 PGPPTETPSQRPSPLKRAPGPKPQVPP-KPSYLQMPRMPPPLEPIPP 182


>U11690-1|AAA57004.1|  961|Homo sapiens FGD1 protein.
          Length = 961

 Score = 35.5 bits (78), Expect = 0.25
 Identities = 18/47 (38%), Positives = 26/47 (55%)
 Frame = +2

Query: 281 PGPKTFHPSSVPLPIRQGYVPKGQAPPGKKANAELMKIPNFLHLTPP 421
           PGP T  PS  P P+++   PK Q PP K +  ++ ++P  L   PP
Sbjct: 137 PGPPTETPSQRPSPLKRAPGPKPQVPP-KPSYLQMPRMPPPLEPIPP 182


>BC034530-1|AAH34530.1|  961|Homo sapiens FYVE, RhoGEF and PH domain
           containing 1 (faciogenital dysplasia) protein.
          Length = 961

 Score = 35.5 bits (78), Expect = 0.25
 Identities = 18/47 (38%), Positives = 26/47 (55%)
 Frame = +2

Query: 281 PGPKTFHPSSVPLPIRQGYVPKGQAPPGKKANAELMKIPNFLHLTPP 421
           PGP T  PS  P P+++   PK Q PP K +  ++ ++P  L   PP
Sbjct: 137 PGPPTETPSQRPSPLKRAPGPKPQVPP-KPSYLQMPRMPPPLEPIPP 182


>BC054003-1|AAH54003.1| 1192|Homo sapiens RNASEN protein protein.
          Length = 1192

 Score = 33.5 bits (73), Expect = 1.0
 Identities = 19/61 (31%), Positives = 26/61 (42%)
 Frame = +2

Query: 254 PNQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPGKKANAELMKIPNFLHLTPPVIKS 433
           PN    + +P P  F P   P+P      P   APPG+     +M  P+  H  PP +  
Sbjct: 103 PNHQMRHPFPVPPCFPPMPPPMPCPNN-PPVPGAPPGQGTFPFMMPPPSMPHPPPPPVMP 161

Query: 434 Q 436
           Q
Sbjct: 162 Q 162


>AF189011-1|AAF80558.1| 1374|Homo sapiens ribonuclease III protein.
          Length = 1374

 Score = 33.5 bits (73), Expect = 1.0
 Identities = 19/61 (31%), Positives = 26/61 (42%)
 Frame = +2

Query: 254 PNQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPGKKANAELMKIPNFLHLTPPVIKS 433
           PN    + +P P  F P   P+P      P   APPG+     +M  P+  H  PP +  
Sbjct: 103 PNHQMRHPFPVPPCFPPMPPPMPCPNN-PPVPGAPPGQGTFPFMMPPPSMPHPPPPPVMP 161

Query: 434 Q 436
           Q
Sbjct: 162 Q 162


>AF068296-1|AAF65185.1|  144|Homo sapiens HDCMD11P protein.
          Length = 144

 Score = 33.1 bits (72), Expect = 1.3
 Identities = 15/28 (53%), Positives = 19/28 (67%)
 Frame = +1

Query: 607 LKLDKHATDKFKRLVGDRYDPKTDLVTI 690
           L LD HA  K  +LVG+RY   TD++TI
Sbjct: 1   LNLDDHAKKKLIKLVGERYCKTTDVLTI 28


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 125,525,427
Number of Sequences: 237096
Number of extensions: 2823597
Number of successful extensions: 6161
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 5757
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6156
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 11039988564
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -