SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30152.Seq
         (877 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BX537953-1|CAD97920.1|  579|Homo sapiens hypothetical protein pr...    62   2e-09
BC032620-1|AAH32620.1|  509|Homo sapiens KLHL18 protein protein.       62   2e-09
AY423763-1|AAR03710.1|  642|Homo sapiens actinfilin protein.           62   2e-09
AL645608-7|CAI15569.1|  642|Homo sapiens kelch-like 17 (Drosophi...    62   2e-09
AB062478-1|BAB93503.1|  509|Homo sapiens OK/SW-CL.74 protein.          62   2e-09
AB018338-1|BAA34515.1|  465|Homo sapiens KIAA0795 protein protein.     62   2e-09
BC045768-1|AAH45768.1|  187|Homo sapiens KLHL17 protein protein.       59   2e-08
BC034035-1|AAH34035.1|  301|Homo sapiens KLHL3 protein protein.        57   7e-08
AF208070-1|AAF20995.1|  555|Homo sapiens kelch-like protein KLHL...    57   7e-08
AF208069-1|AAF20939.1|  505|Homo sapiens kelch-like protein KLHL...    57   7e-08
AF208068-1|AAF20938.1|  587|Homo sapiens kelch-like protein KLHL...    57   7e-08
AC004021-1|AAB97127.1|  497|Homo sapiens WUGSC:H_DJ0186K10.1 pro...    57   7e-08
AB032955-1|BAA86443.1|  625|Homo sapiens KIAA1129 protein protein.     57   7e-08
BC022460-1|AAH22460.1|  748|Homo sapiens kelch-like 1 (Drosophil...    57   1e-07
AL356384-1|CAH73834.2|  748|Homo sapiens kelch-like 1 (Drosophil...    57   1e-07
AL353738-1|CAH71287.2|  748|Homo sapiens kelch-like 1 (Drosophil...    57   1e-07
AL162378-1|CAH73330.2|  748|Homo sapiens kelch-like 1 (Drosophil...    57   1e-07
AL160391-1|CAH70258.2|  748|Homo sapiens kelch-like 1 (Drosophil...    57   1e-07
AF393973-1|AAK69769.1|  582|Homo sapiens Kelch-like protein 1 pr...    57   1e-07
AF252283-1|AAF81719.1|  748|Homo sapiens Kelch-like 1 protein pr...    57   1e-07
AB040923-1|BAA96014.1|  749|Homo sapiens KIAA1490 protein protein.     57   1e-07
BC010437-1|AAH10437.2|  558|Homo sapiens KLHL23 protein protein.       56   1e-07
AY495339-1|AAS91792.1|  608|Homo sapiens KLHL10 protein.               56   1e-07
AK090653-1|BAC03497.1|  558|Homo sapiens protein ( Homo sapiens ...    56   1e-07
AK057224-1|BAB71387.1|  614|Homo sapiens protein ( Homo sapiens ...    56   1e-07
CR589949-2|CAM12888.1|  584|Homo sapiens intracisternal A partic...    56   2e-07
CR589949-1|CAM12887.1|  582|Homo sapiens intracisternal A partic...    56   2e-07
BX664740-2|CAM12889.1|  584|Homo sapiens intracisternal A partic...    56   2e-07
BX664740-1|CAI23599.2|  582|Homo sapiens intracisternal A partic...    56   2e-07
BC032544-1|AAH32544.1|  582|Homo sapiens IPP protein protein.          56   2e-07
AL604028-4|CAM12886.1|  584|Homo sapiens intracisternal A partic...    56   2e-07
AL604028-3|CAM12885.1|  582|Homo sapiens intracisternal A partic...    56   2e-07
AF156857-1|AAD39007.1|  584|Homo sapiens actin-binding protein p...    56   2e-07
BC036468-1|AAH36468.1|  593|Homo sapiens kelch-like 2, Mayven (D...    55   3e-07
BC022503-1|AAH22503.1|  593|Homo sapiens kelch-like 2, Mayven (D...    55   3e-07
AF059569-1|AAC67502.1|  593|Homo sapiens actin binding protein M...    55   3e-07
AB209727-1|BAD92964.1|  460|Homo sapiens Kelch-like protein 2 va...    55   3e-07
BC032348-1|AAH32348.1|  610|Homo sapiens KLHL6 protein protein.        55   4e-07
AK097125-1|BAC04957.1|  621|Homo sapiens protein ( Homo sapiens ...    55   4e-07
AF441792-1|AAL35594.1|  610|Homo sapiens kelch-like protein KLHL...    55   4e-07
BC053860-1|AAH53860.1|  762|Homo sapiens KLHL5 protein protein.        54   5e-07
BC004175-1|AAH04175.1|  568|Homo sapiens kelch-like 12 (Drosophi...    54   5e-07
BC003183-1|AAH03183.1|  568|Homo sapiens kelch-like 12 (Drosophi...    54   5e-07
AK027656-1|BAB55271.1|  568|Homo sapiens protein ( Homo sapiens ...    54   5e-07
AK002174-1|BAA92121.1|  508|Homo sapiens protein ( Homo sapiens ...    54   5e-07
AF272976-1|AAL08584.1|  734|Homo sapiens kelch-like 5 protein pr...    54   5e-07
AF190900-1|AAG17175.1|  568|Homo sapiens kelch-like protein C3IP...    54   5e-07
AB208820-1|BAD92057.1|  593|Homo sapiens kelch-like 5 isoform 2 ...    54   5e-07
D50922-1|BAA09481.2|  637|Homo sapiens KIAA0132 protein.               54   7e-07
BC015945-1|AAH15945.1|  624|Homo sapiens kelch-like ECH-associat...    54   7e-07
BC002930-1|AAH02930.1|  624|Homo sapiens kelch-like ECH-associat...    54   7e-07
BC002417-1|AAH02417.1|  624|Homo sapiens kelch-like ECH-associat...    54   7e-07
AY172948-1|AAO39710.1|  694|Homo sapiens KLHL5b protein protein.       54   7e-07
AF361892-1|AAK43722.1|  624|Homo sapiens cytosolic inhibitor of ...    54   7e-07
AF361886-1|AAK51082.1|  624|Homo sapiens cytosolic inhibitor of ...    54   7e-07
BX248409-2|CAH73000.1|  609|Homo sapiens kelch-like 20 (Drosophi...    54   9e-07
BC063418-1|AAH63418.1|  609|Homo sapiens kelch-like 20 (Drosophi...    54   9e-07
AL109921-1|CAI20377.1|  609|Homo sapiens kelch-like 20 (Drosophi...    54   9e-07
AJ844466-1|CAH59617.1|  609|Homo sapiens KLEIP (kelch-like ECT2 ...    54   9e-07
AB026190-1|BAA77027.1|  609|Homo sapiens Kelch motif containing ...    54   9e-07
Z95400-2|CAI42741.1|  720|Homo sapiens kelch-like 4 (Drosophila)...    53   2e-06
Z95400-1|CAI42740.1|  718|Homo sapiens kelch-like 4 (Drosophila)...    53   2e-06
BC146677-1|AAI46678.1|  718|Homo sapiens kelch-like 4 (Drosophil...    53   2e-06
BC142652-1|AAI42653.1|  718|Homo sapiens kelch-like 4 (Drosophil...    53   2e-06
AL035424-2|CAI42085.1|  720|Homo sapiens kelch-like 4 (Drosophil...    53   2e-06
AL035424-1|CAI42084.1|  718|Homo sapiens kelch-like 4 (Drosophil...    53   2e-06
AK022715-1|BAB14199.1|  569|Homo sapiens protein ( Homo sapiens ...    53   2e-06
AF284766-1|AAK49442.1|  720|Homo sapiens kelch-like protein KLHL...    53   2e-06
AF284765-1|AAK49441.1|  718|Homo sapiens kelch-like protein KLHL...    53   2e-06
AB051474-1|BAB21778.1|  728|Homo sapiens KIAA1687 protein protein.     53   2e-06
AK223072-1|BAD96792.1|  568|Homo sapiens kelch-like 12 variant p...    52   2e-06
BC121010-1|AAI21011.1|  571|Homo sapiens kelch-like 28 (Drosophi...    52   4e-06
BC121009-1|AAI21010.1|  571|Homo sapiens kelch-like 28 (Drosophi...    52   4e-06
AK001698-1|BAA91845.1|  508|Homo sapiens protein ( Homo sapiens ...    52   4e-06
AK000088-1|BAA90937.1|  300|Homo sapiens protein ( Homo sapiens ...    52   4e-06
BC117487-1|AAI17488.1|  575|Homo sapiens kelch repeat and BTB (P...    51   6e-06
AF385438-1|AAM43839.1|  575|Homo sapiens T-cell activation kelch...    51   6e-06
BC091648-1|AAH91648.1|  597|Homo sapiens kelch-like 21 (Drosophi...    50   8e-06
BC034039-1|AAH34039.3|  597|Homo sapiens kelch-like 21 (Drosophi...    50   8e-06
AL591866-13|CAI16082.1|  539|Homo sapiens kelch-like 21 (Drosoph...    50   8e-06
AL591866-12|CAI16080.1|  597|Homo sapiens kelch-like 21 (Drosoph...    50   8e-06
AB007938-1|BAA32314.2|  559|Homo sapiens KIAA0469 protein protein.     50   8e-06
AK056390-1|BAB71175.1|  564|Homo sapiens protein ( Homo sapiens ...    48   4e-05
EF560731-1|ABQ59041.1|  564|Homo sapiens KLHL7 protein protein.        47   1e-04
BC109059-1|AAI09060.1|  604|Homo sapiens kelch-like 15 (Drosophi...    47   1e-04
BC109058-1|AAI09059.1|  604|Homo sapiens kelch-like 15 (Drosophi...    47   1e-04
BC105696-1|AAI05697.1|  376|Homo sapiens KLHL30 protein protein.       47   1e-04
BC039585-1|AAH39585.1|  586|Homo sapiens kelch-like 7 (Drosophil...    47   1e-04
BC006534-1|AAH06534.1|  606|Homo sapiens kelch repeat and BTB (P...    47   1e-04
BC005253-1|AAH05253.1|  230|Homo sapiens KLHL20 protein protein.       47   1e-04
AY028802-1|AAK29099.1|  538|Homo sapiens kelch/BTB protein protein.    47   1e-04
AK057298-1|BAB71415.1|  604|Homo sapiens protein ( Homo sapiens ...    47   1e-04
AF333387-1|AAG52886.1|  606|Homo sapiens Kel-like protein 23 pro...    47   1e-04
AF056929-1|AAC13686.1|  596|Homo sapiens sarcosin protein.             47   1e-04
AC093899-2|AAY24117.1|  596|Homo sapiens unknown protein.              47   1e-04
AK125364-1|BAC86148.1|  298|Homo sapiens protein ( Homo sapiens ...    46   2e-04
AB058745-1|BAB47471.1|  526|Homo sapiens KIAA1842 protein protein.     46   2e-04
BC110491-1|AAI10492.1|  621|Homo sapiens kelch repeat and BTB (P...    46   2e-04
AY177390-1|AAO06908.1|  621|Homo sapiens sarcosynapsin protein.        46   2e-04
AY176040-1|AAO22141.1|  621|Homo sapiens sarcosynapsin protein.        46   2e-04
AK056577-1|BAB71222.1|  472|Homo sapiens protein ( Homo sapiens ...    46   2e-04
DQ925701-1|ABI96896.1|  600|Homo sapiens fibroblast-related prot...    45   4e-04
BT007392-1|AAP36056.1|  589|Homo sapiens ectodermal-neural corte...    45   4e-04
BC142993-1|AAI42994.1|  600|Homo sapiens kelch-like 24 (Drosophi...    45   4e-04
BC047107-1|AAH47107.1|  623|Homo sapiens kelch repeat and BTB (P...    45   4e-04
BC000418-1|AAH00418.1|  589|Homo sapiens ectodermal-neural corte...    45   4e-04
AY422472-1|AAR13703.1|  600|Homo sapiens DRE1 protein protein.         45   4e-04
AK026326-1|BAB15447.1|  403|Homo sapiens protein ( Homo sapiens ...    45   4e-04
AK000066-1|BAA90921.1|  421|Homo sapiens protein ( Homo sapiens ...    45   4e-04
AF059611-1|AAC26109.1|  589|Homo sapiens nuclear matrix protein ...    45   4e-04
AF010314-1|AAC39532.1|  516|Homo sapiens Pig10 protein.                45   4e-04
AF005381-1|AAC64498.1|  589|Homo sapiens ectoderm-neural cortex-...    45   4e-04
AB040922-1|BAA96013.1|  511|Homo sapiens KIAA1489 protein protein.     45   4e-04
BC127886-1|AAI27887.1|  581|Homo sapiens C8ORFK36 protein protein.     44   5e-04
AB196636-1|BAE53438.1|  581|Homo sapiens C8orfK36 protein protein.     44   5e-04
BC113513-1|AAI13514.1|  617|Homo sapiens kelch-like 9 (Drosophil...    44   7e-04
BC113511-1|AAI13512.1|  584|Homo sapiens zinc finger and BTB dom...    44   7e-04
BC105008-1|AAI05009.1|  617|Homo sapiens kelch-like 9 (Drosophil...    44   7e-04
BC084568-1|AAH84568.1|  584|Homo sapiens ZBTB7A protein protein.       44   7e-04
BC039133-1|AAH39133.1|  617|Homo sapiens kelch-like 9 (Drosophil...    44   7e-04
BC037887-1|AAH37887.1|  623|Homo sapiens kelch repeat and BTB (P...    44   7e-04
AL162420-7|CAH73191.1|  617|Homo sapiens kelch-like 9 (Drosophil...    44   7e-04
AF151831-1|AAD34068.1|  335|Homo sapiens CGI-73 protein protein.       44   7e-04
AF097916-1|AAC72973.1|  584|Homo sapiens HIV-1 inducer of short ...    44   7e-04
AF000561-1|AAB58414.1|  590|Homo sapiens TTF-I interacting pepti...    44   7e-04
AB037775-1|BAA92592.1|  632|Homo sapiens KIAA1354 protein protein.     44   7e-04
EF633513-1|ABR23528.1|  634|Homo sapiens kelch-like 31 protein.        44   0.001
AY172949-1|AAO39718.1|  617|Homo sapiens KLHL9 protein protein.        44   0.001
AL157773-1|CAC16284.1|  634|Homo sapiens kelch-like 31 (Drosophi...    44   0.001
CR456613-1|CAG30499.1|  641|Homo sapiens ZNF278 protein.               43   0.002
BC021091-1|AAH21091.1|  537|Homo sapiens POZ (BTB) and AT hook c...    43   0.002
BC013922-1|AAH13922.1|  378|Homo sapiens BTB (POZ) domain contai...    43   0.002
AY028384-1|AAK19024.1|  641|Homo sapiens BTB-POZ domain zinc fin...    43   0.002
AL096880-1|CAB51404.1|  616|Homo sapiens hypothetical protein pr...    43   0.002
AF254085-1|AAG09034.1|  687|Homo sapiens zinc finger sarcoma gen...    43   0.002
AF254084-1|AAG09033.1|  537|Homo sapiens zinc finger sarcoma gen...    43   0.002
AF254083-1|AAG09032.1|  641|Homo sapiens zinc finger sarcoma gen...    43   0.002
AF254082-1|AAG09031.1|  537|Homo sapiens zinc finger sarcoma gen...    43   0.002
AF242522-1|AAF99602.1|  424|Homo sapiens krueppel-related zinc f...    43   0.002
AC005003-1|AAF01349.1|  641|Homo sapiens WUGSC:H_DJ400N23.1 prot...    43   0.002
AB208787-1|BAD92024.1|  651|Homo sapiens zinc finger protein 278...    43   0.002
CR456352-1|CAG30238.1|  634|Homo sapiens Em:AC005500.4 protein.        42   0.002
BC028100-1|AAH28100.1|  589|Homo sapiens KLHL25 protein protein.       42   0.002
BC015923-1|AAH15923.1|  634|Homo sapiens kelch-like 22 (Drosophi...    42   0.002
AY764034-1|AAV51405.1|  589|Homo sapiens ENC2 protein.                 42   0.002
AL136796-1|CAB66730.1|  589|Homo sapiens hypothetical protein pr...    42   0.002
AK222850-1|BAD96570.1|  634|Homo sapiens kelch-like variant prot...    42   0.002
AK027266-1|BAB55007.1|  525|Homo sapiens protein ( Homo sapiens ...    42   0.002
BC015667-1|AAH15667.1|  503|Homo sapiens KLHL29 protein protein.       42   0.003
BC013982-1|AAH13982.1|  707|Homo sapiens KLHL29 protein protein.       42   0.003
AY049781-1|AAL15438.1|  589|Homo sapiens ectodermal-neural corte...    42   0.003
AC009242-1|AAY24259.1|  388|Homo sapiens unknown protein.              42   0.003
AB067508-1|BAB67814.1|  545|Homo sapiens KIAA1921 protein protein.     42   0.003
BC117466-1|AAI17467.1|  612|Homo sapiens kelch repeat and BTB (P...    42   0.004
BC107691-1|AAI07692.1|  161|Homo sapiens KBTBD3 protein protein.       42   0.004
BC064576-1|AAH64576.2|  655|Homo sapiens kelch-like 13 (Drosophi...    42   0.004
AL591986-1|CAC41335.1|  604|Homo sapiens hypothetical protein pr...    42   0.004
AK092993-1|BAC04012.1|  608|Homo sapiens protein ( Homo sapiens ...    42   0.004
AK090472-1|BAC03453.1|  547|Homo sapiens FLJ00393 protein protein.     42   0.004
AF119256-1|AAF32518.1|  537|Homo sapiens PATZ protein.                 42   0.004
AC006963-1|AAF03529.1|  622|Homo sapiens WUGSC:H_DJ0278D01.1 pro...    42   0.004
AB037730-1|BAA92547.1|  639|Homo sapiens KIAA1309 protein protein.     42   0.004
BC044840-1|AAH44840.1|  597|Homo sapiens giant axonal neuropathy...    41   0.005
AF291673-1|AAG35311.1|  597|Homo sapiens gigaxonin protein.            41   0.005
AF147727-1|AAF67471.1|   73|Homo sapiens unknown protein.              41   0.005
BC071627-1|AAH71627.1|  470|Homo sapiens KLHL32 protein protein.       40   0.012
BC051349-1|AAH51349.1|  674|Homo sapiens kelch repeat and BTB (P...    40   0.012
BC033821-1|AAH33821.1|  616|Homo sapiens chromosome 16 open read...    40   0.012
BC032400-1|AAH32400.1|  553|Homo sapiens C16orf44 protein protein.     40   0.012
BC026319-1|AAH26319.1|  615|Homo sapiens kelch-like 26 (Drosophi...    40   0.012
BC000560-1|AAH00560.1|  674|Homo sapiens kelch repeat and BTB (P...    40   0.012
AL833839-1|CAD38699.1|  654|Homo sapiens hypothetical protein pr...    40   0.012
AL356958-1|CAI21654.1|  620|Homo sapiens kelch-like 32 (Drosophi...    40   0.012
AL354696-1|CAI16611.1|  674|Homo sapiens kelch repeat and BTB (P...    40   0.012
AL033375-2|CAI19824.1|  620|Homo sapiens kelch-like 32 (Drosophi...    40   0.012
AL023656-3|CAI20428.1|  620|Homo sapiens kelch-like 32 (Drosophi...    40   0.012
AK222656-1|BAD96376.1|  615|Homo sapiens hypothetical protein FL...    40   0.012
AK056633-1|BAB71238.1|  674|Homo sapiens protein ( Homo sapiens ...    40   0.012
AK055292-1|BAB70899.1|  620|Homo sapiens protein ( Homo sapiens ...    40   0.012
AK022605-1|BAB14124.1|  616|Homo sapiens protein ( Homo sapiens ...    40   0.012
AK001940-1|BAA91990.1|  615|Homo sapiens protein ( Homo sapiens ...    40   0.012
AB067487-1|BAB67793.1|  582|Homo sapiens KIAA1900 protein protein.     40   0.012
BC009555-1|AAH09555.1|  144|Homo sapiens KLHL7 protein protein.        39   0.021
BC031830-1|AAH31830.1|  139|Homo sapiens KLHL32 protein protein.       39   0.027
AL033375-1|CAI19823.1|  139|Homo sapiens kelch-like 32 (Drosophi...    39   0.027
AL023656-2|CAI20427.1|  139|Homo sapiens kelch-like 32 (Drosophi...    39   0.027
BC050719-1|AAH50719.1|  713|Homo sapiens ZBTB1 protein protein.        37   0.083
AY598321-1|AAT06732.1|  644|Homo sapiens L2 protein.                   37   0.083
AB023214-1|BAA76841.2|  646|Homo sapiens KIAA0997 protein protein.     37   0.083
BC022033-1|AAH22033.1|  684|Homo sapiens kelch repeat and BTB (P...    37   0.11 
BC012070-1|AAH12070.1|  539|Homo sapiens ZBTB7B protein protein.       37   0.11 
AY346333-1|AAQ24383.1|  305|Homo sapiens double BTB/POZ domain c...    37   0.11 
AL451085-29|CAI13266.1|  539|Homo sapiens zinc finger and BTB do...    37   0.11 
AL354696-3|CAI16613.1|  684|Homo sapiens kelch repeat and BTB (P...    37   0.11 
AK091344-1|BAC03641.1|  684|Homo sapiens protein ( Homo sapiens ...    37   0.11 
AF007833-1|AAC51847.1|  539|Homo sapiens kruppel-related zinc fi...    37   0.11 
AF111113-1|AAF27196.1|  166|Homo sapiens SBBI26 protein.               36   0.15 
AC006039-2|AAO21916.1|  166|Homo sapiens unknown protein.              36   0.15 
X95072-1|CAA64468.1|  522|Homo sapiens Translin Associated Zinc ...    35   0.34 
U38896-1|AAA81368.1|  484|Homo sapiens zinc finger protein C2H2-...    35   0.34 
BX640744-1|CAE45855.1|  544|Homo sapiens hypothetical protein pr...    35   0.34 
BX640727-1|CAE45843.1|  620|Homo sapiens hypothetical protein pr...    35   0.34 
BX538173-1|CAD98048.1|  620|Homo sapiens hypothetical protein pr...    35   0.34 
BC109031-1|AAI09032.1|  644|Homo sapiens kelch-like 34 (Drosophi...    35   0.34 
BC041384-1|AAH41384.1|  620|Homo sapiens kelch-like 8 (Drosophil...    35   0.34 
BC036677-1|AAH36677.2|  531|Homo sapiens zinc finger protein 238...    35   0.34 
AL772392-1|CAI40764.1|  644|Homo sapiens novel protein protein.        35   0.34 
AL590483-1|CAH71954.1|  522|Homo sapiens zinc finger protein 238...    35   0.34 
AK092279-1|BAC03848.1|  644|Homo sapiens protein ( Homo sapiens ...    35   0.34 
AJ223321-1|CAA11262.1|  522|Homo sapiens RP58 protein protein.         35   0.34 
AJ001388-1|CAA04718.1|  522|Homo sapiens RP58 protein.                 35   0.34 
AB037799-1|BAA92616.2|  628|Homo sapiens KIAA1378 protein protein.     35   0.34 
Y09723-1|CAA70889.1|  803|Homo sapiens Miz-1 protein protein.          34   0.78 
BC126163-1|AAI26164.1|  803|Homo sapiens zinc finger and BTB dom...    34   0.78 
BC021267-1|AAH21267.1|  388|Homo sapiens KLHL14 protein protein.       34   0.78 
AL034555-3|CAB85445.1|  803|Homo sapiens zinc finger and BTB dom...    34   0.78 
AK223618-1|BAD97338.1|  803|Homo sapiens zinc finger and BTB dom...    34   0.78 
AB037805-1|BAA92622.1|  652|Homo sapiens KIAA1384 protein protein.     34   0.78 
X53578-1|CAA37641.1|  361|Homo sapiens protein ( Human Lewis blo...    33   1.0  
U27328-1|AAC50187.1|  361|Homo sapiens alpha (1,3/1,4) fucosyltr...    33   1.0  
U27327-1|AAC50186.1|  361|Homo sapiens alpha (1,3/1,4) fucosyltr...    33   1.0  
U27326-1|AAC50185.1|  361|Homo sapiens alpha (1,3/1,4) fucosyltr...    33   1.0  
D89325-1|BAA13942.1|  361|Homo sapiens alpha (1,3/1,4) fucosyltr...    33   1.0  
D89324-1|BAA13941.1|  361|Homo sapiens alpha (1,3/1,4) fucosyltr...    33   1.0  
CR533558-1|CAG38589.1|  684|Homo sapiens KBTBD7 protein.               33   1.0  
BC108675-1|AAI08676.1|  361|Homo sapiens fucosyltransferase 3 (g...    33   1.0  
BC074837-1|AAH74837.1|  361|Homo sapiens fucosyltransferase 3 (g...    33   1.0  
BC074836-1|AAH74836.1|  361|Homo sapiens fucosyltransferase 3 (g...    33   1.0  
AY870341-1|AAW34365.1|  361|Homo sapiens fucosyltransferase 3 (g...    33   1.0  
AF131913-1|AAD33514.1|  361|Homo sapiens alpha-(1,3/1,4)-fucosyl...    33   1.0  
AB043998-1|BAA96390.1|  361|Homo sapiens alpha-(1,3/1,4)-fucosyl...    33   1.0  
DQ443529-1|ABE03890.1|  531|Homo sapiens aryl hydrocarbon recept...    33   1.4  
DQ443528-1|ABE03889.1|  642|Homo sapiens aryl hydrocarbon recept...    33   1.4  
DQ005634-1|AAY55907.1| 1196|Homo sapiens inhibitor of Bruton's t...    33   1.4  
DQ005633-1|AAY55906.1| 1353|Homo sapiens inhibitor of Bruton's t...    33   1.4  
BC113698-1|AAI13699.1| 1353|Homo sapiens inhibitor of Bruton aga...    33   1.4  
BC113696-1|AAI13697.1| 1353|Homo sapiens inhibitor of Bruton aga...    33   1.4  
BC067739-1|AAH67739.1|  642|Homo sapiens IVNS1ABP protein protein.     33   1.4  
AL356273-2|CAI22094.1|  642|Homo sapiens influenza virus NS1A bi...    33   1.4  
AL078644-3|CAB72329.1|  642|Homo sapiens influenza virus NS1A bi...    33   1.4  
AL050333-2|CAI23416.1| 1187|Homo sapiens RP1-93K22.1 protein.          33   1.4  
AF205218-1|AAG43485.1|  642|Homo sapiens NS1-binding protein-lik...    33   1.4  
AB037838-1|BAA92655.2| 1379|Homo sapiens KIAA1417 protein protein.     33   1.4  
AB020657-1|BAA74873.2|  644|Homo sapiens KIAA0850 protein protein.     33   1.4  
Z97184-1|CAB09990.1|  634|Homo sapiens zinc finger protein 297 p...    33   1.8  
Y12726-1|CAA73258.1|  449|Homo sapiens zinc finger protein ZFP16...    33   1.8  
EF120357-1|ABL98073.1|  619|Homo sapiens zinc finger and BTB dom...    33   1.8  
D89859-1|BAA20131.1|  449|Homo sapiens zinc finger 5 protein pro...    33   1.8  
BX248088-6|CAM25704.1|  149|Homo sapiens zinc finger and BTB dom...    33   1.8  
BX248088-5|CAI41787.2|  634|Homo sapiens zinc finger and BTB dom...    33   1.8  
BC110519-1|AAI10520.1|  449|Homo sapiens zinc finger protein 161...    33   1.8  
BC018541-1|AAH18541.1|  634|Homo sapiens zinc finger and BTB dom...    33   1.8  
AL662827-13|CAM24890.1|  149|Homo sapiens zinc finger and BTB do...    33   1.8  
AL662827-12|CAI17526.1|  634|Homo sapiens zinc finger and BTB do...    33   1.8  
AL662820-13|CAM25474.1|  149|Homo sapiens zinc finger and BTB do...    33   1.8  
AL662820-12|CAI18123.1|  634|Homo sapiens zinc finger and BTB do...    33   1.8  
AK222589-1|BAD96309.1|  374|Homo sapiens speckle-type POZ protei...    33   1.8  
BC010007-1|AAH10007.1|  677|Homo sapiens zinc finger and BTB dom...    32   2.4  
AL158155-5|CAI13852.1|  677|Homo sapiens zinc finger and BTB dom...    32   2.4  
AK127065-1|BAC86810.1|  645|Homo sapiens protein ( Homo sapiens ...    32   2.4  
AB002352-1|BAA20811.2|  730|Homo sapiens KIAA0354 protein.             32   2.4  
BC131774-1|AAI31775.1|  100|Homo sapiens ZBTB4 protein protein.        32   3.1  
BC043352-1|AAH43352.1| 1013|Homo sapiens zinc finger and BTB dom...    32   3.1  
AY714879-1|AAU21222.1|  242|Homo sapiens Kelch-like 18 protein.        32   3.1  
AY302699-1|AAP59447.1| 1013|Homo sapiens KAISO-like zinc finger ...    32   3.1  
AK023765-1|BAB14670.1|  237|Homo sapiens protein ( Homo sapiens ...    32   3.1  
AJ012449-1|CAA10029.1|  619|Homo sapiens NS1-binding protein pro...    32   3.1  
AB040971-1|BAA96062.2| 1029|Homo sapiens KIAA1538 protein protein.     32   3.1  
CR457270-1|CAG33551.1|  518|Homo sapiens KBTBD4 protein.               31   4.1  
BC003385-1|AAH03385.1|  374|Homo sapiens speckle-type POZ protei...    31   4.1  
BC002736-1|AAH02736.1|  518|Homo sapiens kelch repeat and BTB (P...    31   4.1  
BC001269-1|AAH01269.1|  374|Homo sapiens speckle-type POZ protei...    31   4.1  
AK222550-1|BAD96270.1|  518|Homo sapiens kelch repeat and BTB (P...    31   4.1  
AK001749-1|BAA91880.1|  518|Homo sapiens protein ( Homo sapiens ...    31   4.1  
AK001312-1|BAA91616.1|  518|Homo sapiens protein ( Homo sapiens ...    31   4.1  
AJ000644-1|CAA04199.1|  374|Homo sapiens SPOP protein.                 31   4.1  
DQ227306-1|ABA86591.1|  504|Homo sapiens zinc finger and BTB dom...    31   5.5  
AL354944-1|CAH69994.1|  504|Homo sapiens zinc finger and BTB dom...    31   5.5  
AB082524-1|BAC02702.1|  532|Homo sapiens KIAA1993 protein protein.     31   5.5  
U27331-1|AAC50190.1|  364|Homo sapiens alpha (1,3) fucosyltransf...    31   7.2  
D38496-1|BAA07508.1|  552|Homo sapiens LZTR-1 protein.                 31   7.2  
CT841521-1|CAJ86451.1|  840|Homo sapiens LZTR1 protein.                31   7.2  
BC026214-1|AAH26214.2|  840|Homo sapiens leucine-zipper-like tra...    31   7.2  
AK127080-1|BAC86816.1|  799|Homo sapiens protein ( Homo sapiens ...    31   7.2  
U27337-1|AAC50196.1|  359|Homo sapiens alpha (1,3) fucosyltransf...    30   9.6  
U27336-1|AAC50195.1|  359|Homo sapiens alpha (1,3) fucosyltransf...    30   9.6  
U27335-1|AAC50194.1|  359|Homo sapiens alpha (1,3) fucosyltransf...    30   9.6  
U27334-1|AAC50193.1|  359|Homo sapiens alpha (1,3) fucosyltransf...    30   9.6  
U27333-1|AAC50192.1|  359|Homo sapiens alpha (1,3) fucosyltransf...    30   9.6  
U27330-1|AAC50189.1|  374|Homo sapiens alpha (1,3) fucosyltransf...    30   9.6  
U27329-1|AAC50188.1|  374|Homo sapiens alpha (1,3) fucosyltransf...    30   9.6  
M98825-1|AAA99222.1|  359|Homo sapiens alpha-1,3 fucosyltransfer...    30   9.6  
M81485-1|AAA98117.1|  374|Homo sapiens alpha(1,3)-fucosyltransfe...    30   9.6  
L01698-1|AAB03078.1|  359|Homo sapiens galactoside 3-fucosyltran...    30   9.6  
BC061700-1|AAH61700.1|  359|Homo sapiens fucosyltransferase 6 (a...    30   9.6  
AL078644-1|CAI17866.1|  117|Homo sapiens influenza virus NS1A bi...    30   9.6  
AF131211-1|AAD33509.1|  359|Homo sapiens alpha-(1,3)-fucosyltran...    30   9.6  

>BX537953-1|CAD97920.1|  579|Homo sapiens hypothetical protein
           protein.
          Length = 579

 Score = 62.5 bits (145), Expect = 2e-09
 Identities = 29/68 (42%), Positives = 43/68 (63%)
 Frame = +2

Query: 524 CCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPLDELN 703
           CC  LR  L+PKNCLG+  FA  + C  L   A  ++ ++FV V + S+EFL LPL+++ 
Sbjct: 132 CCTFLRERLHPKNCLGVRQFAETMMCAVLYDAANSFIHQHFVEV-SMSEEFLALPLEDVL 190

Query: 704 SIILEDEL 727
            ++  DEL
Sbjct: 191 ELVSRDEL 198



 Score = 45.2 bits (102), Expect = 3e-04
 Identities = 24/87 (27%), Positives = 39/87 (44%)
 Frame = +3

Query: 240 RVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXX 419
           R    CD  ++  D   F  HR +L+A  PYF A+FT  +   +Q ++++ G+       
Sbjct: 38  RQGKLCDVTLKIGDH-KFSAHRIVLAASIPYFHAMFTNDMMECKQDEIVMQGMDPSALEA 96

Query: 420 XXXXXXXXXIDVTDTNVHELLMTADYL 500
                    + +   NV  LLM A +L
Sbjct: 97  LINFAYNGNLAIDQQNVQSLLMGASFL 123


>BC032620-1|AAH32620.1|  509|Homo sapiens KLHL18 protein protein.
          Length = 509

 Score = 62.5 bits (145), Expect = 2e-09
 Identities = 29/68 (42%), Positives = 43/68 (63%)
 Frame = +2

Query: 524 CCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPLDELN 703
           CC  LR  L+PKNCLG+  FA  + C  L   A  ++ ++FV V + S+EFL LPL+++ 
Sbjct: 62  CCTFLRERLHPKNCLGVRQFAETMMCAVLYDAANSFIHQHFVEV-SMSEEFLALPLEDVL 120

Query: 704 SIILEDEL 727
            ++  DEL
Sbjct: 121 ELVSRDEL 128


>AY423763-1|AAR03710.1|  642|Homo sapiens actinfilin protein.
          Length = 642

 Score = 62.5 bits (145), Expect = 2e-09
 Identities = 33/78 (42%), Positives = 46/78 (58%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L +  GV   CC  L S L+P NCLGI  FA    C  L   A RY+L++FV VA +++E
Sbjct: 171 LLQLNGVRDACCKFLLSQLDPSNCLGIRGFADAHSCSDLLKAAHRYVLQHFVDVA-KTEE 229

Query: 674 FLHLPLDELNSIILEDEL 727
           F+ LPL ++  ++  D L
Sbjct: 230 FMLLPLKQVLELVSSDSL 247



 Score = 38.7 bits (86), Expect = 0.027
 Identities = 22/82 (26%), Positives = 34/82 (41%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++          H+ +L++CSPYF A+FT  +    Q+ V +  +            
Sbjct: 92  CDIVLHVA-AKEIRAHKVVLASCSPYFHAMFTNEMSESRQTHVTLHDIDPQALDQLVQFA 150

Query: 435 XXXXIDVTDTNVHELLMTADYL 500
               I V + NV  LL  A  L
Sbjct: 151 YTAEIVVGEGNVQTLLPAASLL 172


>AL645608-7|CAI15569.1|  642|Homo sapiens kelch-like 17 (Drosophila)
           protein.
          Length = 642

 Score = 62.5 bits (145), Expect = 2e-09
 Identities = 33/78 (42%), Positives = 46/78 (58%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L +  GV   CC  L S L+P NCLGI  FA    C  L   A RY+L++FV VA +++E
Sbjct: 171 LLQLNGVRDACCKFLLSQLDPSNCLGIRGFADAHSCSDLLKAAHRYVLQHFVDVA-KTEE 229

Query: 674 FLHLPLDELNSIILEDEL 727
           F+ LPL ++  ++  D L
Sbjct: 230 FMLLPLKQVLELVSSDSL 247



 Score = 38.7 bits (86), Expect = 0.027
 Identities = 22/82 (26%), Positives = 34/82 (41%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++          H+ +L++CSPYF A+FT  +    Q+ V +  +            
Sbjct: 92  CDIVLHVA-AKEIRAHKVVLASCSPYFHAMFTNEMSESRQTHVTLHDIDPQALDQLVQFA 150

Query: 435 XXXXIDVTDTNVHELLMTADYL 500
               I V + NV  LL  A  L
Sbjct: 151 YTAEIVVGEGNVQTLLPAASLL 172


>AB062478-1|BAB93503.1|  509|Homo sapiens OK/SW-CL.74 protein.
          Length = 509

 Score = 62.5 bits (145), Expect = 2e-09
 Identities = 29/68 (42%), Positives = 43/68 (63%)
 Frame = +2

Query: 524 CCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPLDELN 703
           CC  LR  L+PKNCLG+  FA  + C  L   A  ++ ++FV V + S+EFL LPL+++ 
Sbjct: 62  CCTFLRERLHPKNCLGVRQFAETMMCAVLYDAANSFIHQHFVEV-SMSEEFLALPLEDVL 120

Query: 704 SIILEDEL 727
            ++  DEL
Sbjct: 121 ELVSRDEL 128


>AB018338-1|BAA34515.1|  465|Homo sapiens KIAA0795 protein protein.
          Length = 465

 Score = 62.5 bits (145), Expect = 2e-09
 Identities = 29/68 (42%), Positives = 43/68 (63%)
 Frame = +2

Query: 524 CCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPLDELN 703
           CC  LR  L+PKNCLG+  FA  + C  L   A  ++ ++FV V + S+EFL LPL+++ 
Sbjct: 18  CCTFLRERLHPKNCLGVRQFAETMMCAVLYDAANSFIHQHFVEV-SMSEEFLALPLEDVL 76

Query: 704 SIILEDEL 727
            ++  DEL
Sbjct: 77  ELVSRDEL 84


>BC045768-1|AAH45768.1|  187|Homo sapiens KLHL17 protein protein.
          Length = 187

 Score = 58.8 bits (136), Expect = 2e-08
 Identities = 31/71 (43%), Positives = 43/71 (60%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L +  GV   CC  L S L+P NCLGI  FA    C  L   A RY+L++FV VA +++E
Sbjct: 47  LLQLNGVRDACCKFLLSQLDPSNCLGIRGFADAHSCSDLLKAAHRYVLQHFVDVA-KTEE 105

Query: 674 FLHLPLDELNS 706
           F+ LPL ++ +
Sbjct: 106 FMLLPLKQVTA 116


>BC034035-1|AAH34035.1|  301|Homo sapiens KLHL3 protein protein.
          Length = 301

 Score = 57.2 bits (132), Expect = 7e-08
 Identities = 32/72 (44%), Positives = 41/72 (56%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V Q CCD L+S L+P NCLGI  FA    C  L   A  Y  ++F  V    +EFL L L
Sbjct: 135 VRQNCCDFLQSQLHPTNCLGIRAFADVHTCTDLLQQANAYAEQHFPEVML-GEEFLSLSL 193

Query: 692 DELNSIILEDEL 727
           D++ S+I  D+L
Sbjct: 194 DQVCSLISSDKL 205



 Score = 51.2 bits (117), Expect = 5e-06
 Identities = 27/86 (31%), Positives = 40/86 (46%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++ A+D      HR +L+ACSPYF A+FT  +   +   + I  V            
Sbjct: 50  CDVMIVAED-VEIEAHRVVLAACSPYFCAMFTGDMSESKAKKIEIKDVDGQTLSKLIDYI 108

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLE 512
               I+VT+ NV  LL  A  L  ++
Sbjct: 109 YTAEIEVTEENVQVLLPAASLLQLMD 134


>AF208070-1|AAF20995.1|  555|Homo sapiens kelch-like protein KLHL3b
           protein.
          Length = 555

 Score = 57.2 bits (132), Expect = 7e-08
 Identities = 32/72 (44%), Positives = 41/72 (56%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V Q CCD L+S L+P NCLGI  FA    C  L   A  Y  ++F  V    +EFL L L
Sbjct: 103 VRQNCCDFLQSQLHPTNCLGIRAFADVHTCTDLLQQANAYAEQHFPEVML-GEEFLSLSL 161

Query: 692 DELNSIILEDEL 727
           D++ S+I  D+L
Sbjct: 162 DQVCSLISSDKL 173



 Score = 51.2 bits (117), Expect = 5e-06
 Identities = 27/86 (31%), Positives = 40/86 (46%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++ A+D      HR +L+ACSPYF A+FT  +   +   + I  V            
Sbjct: 18  CDVMIVAED-VEIEAHRVVLAACSPYFCAMFTGDMSESKAKKIEIKDVDGQTLSKLIDYI 76

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLE 512
               I+VT+ NV  LL  A  L  ++
Sbjct: 77  YTAEIEVTEENVQVLLPAASLLQLMD 102


>AF208069-1|AAF20939.1|  505|Homo sapiens kelch-like protein KLHL3c
           protein.
          Length = 505

 Score = 57.2 bits (132), Expect = 7e-08
 Identities = 32/72 (44%), Positives = 41/72 (56%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V Q CCD L+S L+P NCLGI  FA    C  L   A  Y  ++F  V    +EFL L L
Sbjct: 53  VRQNCCDFLQSQLHPTNCLGIRAFADVHTCTDLLQQANAYAEQHFPEVML-GEEFLSLSL 111

Query: 692 DELNSIILEDEL 727
           D++ S+I  D+L
Sbjct: 112 DQVCSLISSDKL 123


>AF208068-1|AAF20938.1|  587|Homo sapiens kelch-like protein KLHL3a
           protein.
          Length = 587

 Score = 57.2 bits (132), Expect = 7e-08
 Identities = 32/72 (44%), Positives = 41/72 (56%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V Q CCD L+S L+P NCLGI  FA    C  L   A  Y  ++F  V    +EFL L L
Sbjct: 135 VRQNCCDFLQSQLHPTNCLGIRAFADVHTCTDLLQQANAYAEQHFPEVML-GEEFLSLSL 193

Query: 692 DELNSIILEDEL 727
           D++ S+I  D+L
Sbjct: 194 DQVCSLISSDKL 205



 Score = 51.2 bits (117), Expect = 5e-06
 Identities = 27/86 (31%), Positives = 40/86 (46%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++ A+D      HR +L+ACSPYF A+FT  +   +   + I  V            
Sbjct: 50  CDVMIVAED-VEIEAHRVVLAACSPYFCAMFTGDMSESKAKKIEIKDVDGQTLSKLIDYI 108

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLE 512
               I+VT+ NV  LL  A  L  ++
Sbjct: 109 YTAEIEVTEENVQVLLPAASLLQLMD 134


>AC004021-1|AAB97127.1|  497|Homo sapiens WUGSC:H_DJ0186K10.1
           protein.
          Length = 497

 Score = 57.2 bits (132), Expect = 7e-08
 Identities = 32/72 (44%), Positives = 41/72 (56%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V Q CCD L+S L+P NCLGI  FA    C  L   A  Y  ++F  V    +EFL L L
Sbjct: 54  VRQNCCDFLQSQLHPTNCLGIRAFADVHTCTDLLQQANAYAEQHFPEVML-GEEFLSLSL 112

Query: 692 DELNSIILEDEL 727
           D++ S+I  D+L
Sbjct: 113 DQVCSLISSDKL 124


>AB032955-1|BAA86443.1|  625|Homo sapiens KIAA1129 protein protein.
          Length = 625

 Score = 57.2 bits (132), Expect = 7e-08
 Identities = 32/72 (44%), Positives = 41/72 (56%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V Q CCD L+S L+P NCLGI  FA    C  L   A  Y  ++F  V    +EFL L L
Sbjct: 173 VRQNCCDFLQSQLHPTNCLGIRAFADVHTCTDLLQQANAYAEQHFPEVML-GEEFLSLSL 231

Query: 692 DELNSIILEDEL 727
           D++ S+I  D+L
Sbjct: 232 DQVCSLISSDKL 243



 Score = 51.2 bits (117), Expect = 5e-06
 Identities = 27/86 (31%), Positives = 40/86 (46%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++ A+D      HR +L+ACSPYF A+FT  +   +   + I  V            
Sbjct: 88  CDVMIVAED-VEIEAHRVVLAACSPYFCAMFTGDMSESKAKKIEIKDVDGQTLSKLIDYI 146

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLE 512
               I+VT+ NV  LL  A  L  ++
Sbjct: 147 YTAEIEVTEENVQVLLPAASLLQLMD 172


>BC022460-1|AAH22460.1|  748|Homo sapiens kelch-like 1 (Drosophila)
           protein.
          Length = 748

 Score = 56.8 bits (131), Expect = 1e-07
 Identities = 28/78 (35%), Positives = 44/78 (56%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L + P V+++CC  L   L+P NCLGI  FA    C +L   A  Y +   + V  ++ E
Sbjct: 291 LLQLPQVVEVCCHFLMKLLHPSNCLGIRAFADAQGCIELMKVAHSYTMENIMEV-IRNQE 349

Query: 674 FLHLPLDELNSIILEDEL 727
           FL LP +EL+ ++  D++
Sbjct: 350 FLLLPAEELHKLLASDDV 367



 Score = 38.3 bits (85), Expect = 0.036
 Identities = 19/79 (24%), Positives = 36/79 (45%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD I+   +    P HR +LS+ S YF A+FT+ +   +Q ++ + G+            
Sbjct: 212 CDVILIVGN-RKIPAHRLVLSSVSDYFAAMFTSDVCEAKQEEIKMEGIDPNALWDLVQFA 270

Query: 435 XXXXIDVTDTNVHELLMTA 491
               +++ +  +  LL  A
Sbjct: 271 YTGCLELKEDTIENLLAAA 289


>AL356384-1|CAH73834.2|  748|Homo sapiens kelch-like 1 (Drosophila)
           protein.
          Length = 748

 Score = 56.8 bits (131), Expect = 1e-07
 Identities = 28/78 (35%), Positives = 44/78 (56%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L + P V+++CC  L   L+P NCLGI  FA    C +L   A  Y +   + V  ++ E
Sbjct: 291 LLQLPQVVEVCCHFLMKLLHPSNCLGIRAFADAQGCIELMKVAHSYTMENIMEV-IRNQE 349

Query: 674 FLHLPLDELNSIILEDEL 727
           FL LP +EL+ ++  D++
Sbjct: 350 FLLLPAEELHKLLASDDV 367



 Score = 38.3 bits (85), Expect = 0.036
 Identities = 19/79 (24%), Positives = 36/79 (45%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD I+   +    P HR +LS+ S YF A+FT+ +   +Q ++ + G+            
Sbjct: 212 CDVILIVGN-RKIPAHRLVLSSVSDYFAAMFTSDVCEAKQEEIKMEGIDPNALWDLVQFA 270

Query: 435 XXXXIDVTDTNVHELLMTA 491
               +++ +  +  LL  A
Sbjct: 271 YTGCLELKEDTIENLLAAA 289


>AL353738-1|CAH71287.2|  748|Homo sapiens kelch-like 1 (Drosophila)
           protein.
          Length = 748

 Score = 56.8 bits (131), Expect = 1e-07
 Identities = 28/78 (35%), Positives = 44/78 (56%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L + P V+++CC  L   L+P NCLGI  FA    C +L   A  Y +   + V  ++ E
Sbjct: 291 LLQLPQVVEVCCHFLMKLLHPSNCLGIRAFADAQGCIELMKVAHSYTMENIMEV-IRNQE 349

Query: 674 FLHLPLDELNSIILEDEL 727
           FL LP +EL+ ++  D++
Sbjct: 350 FLLLPAEELHKLLASDDV 367



 Score = 38.3 bits (85), Expect = 0.036
 Identities = 19/79 (24%), Positives = 36/79 (45%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD I+   +    P HR +LS+ S YF A+FT+ +   +Q ++ + G+            
Sbjct: 212 CDVILIVGN-RKIPAHRLVLSSVSDYFAAMFTSDVCEAKQEEIKMEGIDPNALWDLVQFA 270

Query: 435 XXXXIDVTDTNVHELLMTA 491
               +++ +  +  LL  A
Sbjct: 271 YTGCLELKEDTIENLLAAA 289


>AL162378-1|CAH73330.2|  748|Homo sapiens kelch-like 1 (Drosophila)
           protein.
          Length = 748

 Score = 56.8 bits (131), Expect = 1e-07
 Identities = 28/78 (35%), Positives = 44/78 (56%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L + P V+++CC  L   L+P NCLGI  FA    C +L   A  Y +   + V  ++ E
Sbjct: 291 LLQLPQVVEVCCHFLMKLLHPSNCLGIRAFADAQGCIELMKVAHSYTMENIMEV-IRNQE 349

Query: 674 FLHLPLDELNSIILEDEL 727
           FL LP +EL+ ++  D++
Sbjct: 350 FLLLPAEELHKLLASDDV 367



 Score = 38.3 bits (85), Expect = 0.036
 Identities = 19/79 (24%), Positives = 36/79 (45%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD I+   +    P HR +LS+ S YF A+FT+ +   +Q ++ + G+            
Sbjct: 212 CDVILIVGN-RKIPAHRLVLSSVSDYFAAMFTSDVCEAKQEEIKMEGIDPNALWDLVQFA 270

Query: 435 XXXXIDVTDTNVHELLMTA 491
               +++ +  +  LL  A
Sbjct: 271 YTGCLELKEDTIENLLAAA 289


>AL160391-1|CAH70258.2|  748|Homo sapiens kelch-like 1 (Drosophila)
           protein.
          Length = 748

 Score = 56.8 bits (131), Expect = 1e-07
 Identities = 28/78 (35%), Positives = 44/78 (56%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L + P V+++CC  L   L+P NCLGI  FA    C +L   A  Y +   + V  ++ E
Sbjct: 291 LLQLPQVVEVCCHFLMKLLHPSNCLGIRAFADAQGCIELMKVAHSYTMENIMEV-IRNQE 349

Query: 674 FLHLPLDELNSIILEDEL 727
           FL LP +EL+ ++  D++
Sbjct: 350 FLLLPAEELHKLLASDDV 367



 Score = 38.3 bits (85), Expect = 0.036
 Identities = 19/79 (24%), Positives = 36/79 (45%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD I+   +    P HR +LS+ S YF A+FT+ +   +Q ++ + G+            
Sbjct: 212 CDVILIVGN-RKIPAHRLVLSSVSDYFAAMFTSDVCEAKQEEIKMEGIDPNALWDLVQFA 270

Query: 435 XXXXIDVTDTNVHELLMTA 491
               +++ +  +  LL  A
Sbjct: 271 YTGCLELKEDTIENLLAAA 289


>AF393973-1|AAK69769.1|  582|Homo sapiens Kelch-like protein 1
           protein.
          Length = 582

 Score = 56.8 bits (131), Expect = 1e-07
 Identities = 28/78 (35%), Positives = 44/78 (56%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L + P V+++CC  L   L+P NCLGI  FA    C +L   A  Y +   + V  ++ E
Sbjct: 125 LLQLPQVVEVCCHFLMKLLHPSNCLGIRAFADAQGCIELMKVAHSYTMENIMEV-IRNQE 183

Query: 674 FLHLPLDELNSIILEDEL 727
           FL LP +EL+ ++  D++
Sbjct: 184 FLLLPAEELHKLLASDDV 201



 Score = 38.3 bits (85), Expect = 0.036
 Identities = 19/79 (24%), Positives = 36/79 (45%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD I+   +    P HR +LS+ S YF A+FT+ +   +Q ++ + G+            
Sbjct: 46  CDVILIVGN-RKIPAHRLVLSSVSDYFAAMFTSDVCEAKQEEIKMEGIDPNALWDLVQFA 104

Query: 435 XXXXIDVTDTNVHELLMTA 491
               +++ +  +  LL  A
Sbjct: 105 YTGCLELKEDTIENLLAAA 123


>AF252283-1|AAF81719.1|  748|Homo sapiens Kelch-like 1 protein
           protein.
          Length = 748

 Score = 56.8 bits (131), Expect = 1e-07
 Identities = 28/78 (35%), Positives = 44/78 (56%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L + P V+++CC  L   L+P NCLGI  FA    C +L   A  Y +   + V  ++ E
Sbjct: 291 LLQLPQVVEVCCHFLMKLLHPSNCLGIRAFADAQGCIELMKVAHSYTMENIMEV-IRNQE 349

Query: 674 FLHLPLDELNSIILEDEL 727
           FL LP +EL+ ++  D++
Sbjct: 350 FLLLPAEELHKLLASDDV 367



 Score = 38.3 bits (85), Expect = 0.036
 Identities = 19/79 (24%), Positives = 36/79 (45%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD I+   +    P HR +LS+ S YF A+FT+ +   +Q ++ + G+            
Sbjct: 212 CDVILIVGN-RKIPAHRLVLSSVSDYFAAMFTSDVCEAKQEEIKMEGIDPNALWDLVQFA 270

Query: 435 XXXXIDVTDTNVHELLMTA 491
               +++ +  +  LL  A
Sbjct: 271 YTGCLELKEDTIENLLAAA 289


>AB040923-1|BAA96014.1|  749|Homo sapiens KIAA1490 protein protein.
          Length = 749

 Score = 56.8 bits (131), Expect = 1e-07
 Identities = 28/78 (35%), Positives = 44/78 (56%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L + P V+++CC  L   L+P NCLGI  FA    C +L   A  Y +   + V  ++ E
Sbjct: 292 LLQLPQVVEVCCHFLMKLLHPSNCLGIRAFADAQGCIELMKVAHSYTMENIMEV-IRNQE 350

Query: 674 FLHLPLDELNSIILEDEL 727
           FL LP +EL+ ++  D++
Sbjct: 351 FLLLPAEELHKLLASDDV 368



 Score = 38.3 bits (85), Expect = 0.036
 Identities = 19/79 (24%), Positives = 36/79 (45%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD I+   +    P HR +LS+ S YF A+FT+ +   +Q ++ + G+            
Sbjct: 213 CDVILIVGN-RKIPAHRLVLSSVSDYFAAMFTSDVCEAKQEEIKMEGIDPNALWDLVQFA 271

Query: 435 XXXXIDVTDTNVHELLMTA 491
               +++ +  +  LL  A
Sbjct: 272 YTGCLELKEDTIENLLAAA 290


>BC010437-1|AAH10437.2|  558|Homo sapiens KLHL23 protein protein.
          Length = 558

 Score = 56.4 bits (130), Expect = 1e-07
 Identities = 28/84 (33%), Positives = 42/84 (50%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXX 437
           D  ++   G  F  HRA+L+ACS YF A+FT  +  + ++ + +SG+             
Sbjct: 37  DITLQCPSGIIFHCHRAVLAACSNYFKAMFTADMKEKFKNKIKLSGIHHDILEGLVNYAY 96

Query: 438 XXXIDVTDTNVHELLMTADYLAFL 509
              I++T  NV  LL  AD L FL
Sbjct: 97  TSQIEITKRNVQSLLEAADLLQFL 120


>AY495339-1|AAS91792.1|  608|Homo sapiens KLHL10 protein.
          Length = 608

 Score = 56.4 bits (130), Expect = 1e-07
 Identities = 28/73 (38%), Positives = 41/73 (56%)
 Frame = +2

Query: 509 GVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLP 688
           G+++ CC+ L+S L   NC+GI  F    +C +L   A  ++L  F  +   S EFL L 
Sbjct: 123 GIVRGCCEFLKSELCLDNCIGICKFTDYYYCPELRQKAYMFILHNFEEMVKVSAEFLELS 182

Query: 689 LDELNSIILEDEL 727
           + EL  II +DEL
Sbjct: 183 VTELKDIIEKDEL 195



 Score = 48.0 bits (109), Expect = 4e-05
 Identities = 25/80 (31%), Positives = 39/80 (48%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD +++ + G  F  H+ IL +CS YF ALFT+  ++ E+    I G+            
Sbjct: 39  CDVVIKVN-GFEFSAHKNILCSCSSYFRALFTSGWNNTEKKVYNIPGISPDMMKLIIEYA 97

Query: 435 XXXXIDVTDTNVHELLMTAD 494
               + +T  NV +LL  AD
Sbjct: 98  YTRTVPITPDNVEKLLAAAD 117


>AK090653-1|BAC03497.1|  558|Homo sapiens protein ( Homo sapiens
           cDNA FLJ33334 fis, clone BRACE2000733, weakly similar to
           RING CANAL PROTEIN. ).
          Length = 558

 Score = 56.4 bits (130), Expect = 1e-07
 Identities = 28/84 (33%), Positives = 42/84 (50%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXX 437
           D  ++   G  F  HRA+L+ACS YF A+FT  +  + ++ + +SG+             
Sbjct: 37  DITLQCPSGIIFHCHRAVLAACSNYFKAMFTADMKEKFKNKIKLSGIHHDILEGLVNYAY 96

Query: 438 XXXIDVTDTNVHELLMTADYLAFL 509
              I++T  NV  LL  AD L FL
Sbjct: 97  TSQIEITKRNVQSLLEAADLLQFL 120


>AK057224-1|BAB71387.1|  614|Homo sapiens protein ( Homo sapiens
           cDNA FLJ32662 fis, clone TESTI1000064, weakly similar to
           Fugu rubripes sex comb on midleg-like 2 protein (SCML2)
           gene. ).
          Length = 614

 Score = 56.4 bits (130), Expect = 1e-07
 Identities = 28/73 (38%), Positives = 41/73 (56%)
 Frame = +2

Query: 509 GVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLP 688
           G+++ CC+ L+S L   NC+GI  F    +C +L   A  ++L  F  +   S EFL L 
Sbjct: 123 GIVRGCCEFLKSELCLDNCIGICKFTDYYYCPELRQKAYMFILHNFEEMVKVSAEFLELS 182

Query: 689 LDELNSIILEDEL 727
           + EL  II +DEL
Sbjct: 183 VTELKDIIEKDEL 195



 Score = 48.0 bits (109), Expect = 4e-05
 Identities = 25/80 (31%), Positives = 39/80 (48%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD +++ + G  F  H+ IL +CS YF ALFT+  ++ E+    I G+            
Sbjct: 39  CDVVIKVN-GFEFSAHKNILCSCSSYFRALFTSGWNNTEKKVYNIPGISPDMMKLIIEYA 97

Query: 435 XXXXIDVTDTNVHELLMTAD 494
               + +T  NV +LL  AD
Sbjct: 98  YTRTVPITPDNVEKLLAAAD 117


>CR589949-2|CAM12888.1|  584|Homo sapiens intracisternal A
           particle-promoted polypeptide protein.
          Length = 584

 Score = 55.6 bits (128), Expect = 2e-07
 Identities = 25/72 (34%), Positives = 44/72 (61%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V+ LCC+ L+  ++P NC+GI  F+ ++ C+ L   +  Y+  +F+ V +  +EFL L  
Sbjct: 122 VVHLCCEFLKGQIDPLNCIGIFQFSEQIACHDLLEFSENYIHVHFLEVHS-GEEFLALTK 180

Query: 692 DELNSIILEDEL 727
           D+L  I+  +EL
Sbjct: 181 DQLIKILRSEEL 192



 Score = 47.6 bits (108), Expect = 6e-05
 Identities = 27/86 (31%), Positives = 40/86 (46%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  ++     SF  HR +L+A SPYF ALFT  +    +  V I G+ +          
Sbjct: 37  CDVQLQVGQ-ESFKAHRLVLAASSPYFAALFTGGMKESSKDVVPILGIEAGIFQILLDFI 95

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLE 512
               +++   NV EL++ AD L   E
Sbjct: 96  YTGIVNIGVNNVQELIIAADMLQLTE 121


>CR589949-1|CAM12887.1|  582|Homo sapiens intracisternal A
           particle-promoted polypeptide protein.
          Length = 582

 Score = 55.6 bits (128), Expect = 2e-07
 Identities = 25/72 (34%), Positives = 44/72 (61%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V+ LCC+ L+  ++P NC+GI  F+ ++ C+ L   +  Y+  +F+ V +  +EFL L  
Sbjct: 122 VVHLCCEFLKGQIDPLNCIGIFQFSEQIACHDLLEFSENYIHVHFLEVHS-GEEFLALTK 180

Query: 692 DELNSIILEDEL 727
           D+L  I+  +EL
Sbjct: 181 DQLIKILRSEEL 192



 Score = 47.6 bits (108), Expect = 6e-05
 Identities = 27/86 (31%), Positives = 40/86 (46%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  ++     SF  HR +L+A SPYF ALFT  +    +  V I G+ +          
Sbjct: 37  CDVQLQVGQ-ESFKAHRLVLAASSPYFAALFTGGMKESSKDVVPILGIEAGIFQILLDFI 95

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLE 512
               +++   NV EL++ AD L   E
Sbjct: 96  YTGIVNIGVNNVQELIIAADMLQLTE 121


>BX664740-2|CAM12889.1|  584|Homo sapiens intracisternal A
           particle-promoted polypeptide protein.
          Length = 584

 Score = 55.6 bits (128), Expect = 2e-07
 Identities = 25/72 (34%), Positives = 44/72 (61%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V+ LCC+ L+  ++P NC+GI  F+ ++ C+ L   +  Y+  +F+ V +  +EFL L  
Sbjct: 122 VVHLCCEFLKGQIDPLNCIGIFQFSEQIACHDLLEFSENYIHVHFLEVHS-GEEFLALTK 180

Query: 692 DELNSIILEDEL 727
           D+L  I+  +EL
Sbjct: 181 DQLIKILRSEEL 192



 Score = 47.6 bits (108), Expect = 6e-05
 Identities = 27/86 (31%), Positives = 40/86 (46%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  ++     SF  HR +L+A SPYF ALFT  +    +  V I G+ +          
Sbjct: 37  CDVQLQVGQ-ESFKAHRLVLAASSPYFAALFTGGMKESSKDVVPILGIEAGIFQILLDFI 95

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLE 512
               +++   NV EL++ AD L   E
Sbjct: 96  YTGIVNIGVNNVQELIIAADMLQLTE 121


>BX664740-1|CAI23599.2|  582|Homo sapiens intracisternal A
           particle-promoted polypeptide protein.
          Length = 582

 Score = 55.6 bits (128), Expect = 2e-07
 Identities = 25/72 (34%), Positives = 44/72 (61%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V+ LCC+ L+  ++P NC+GI  F+ ++ C+ L   +  Y+  +F+ V +  +EFL L  
Sbjct: 122 VVHLCCEFLKGQIDPLNCIGIFQFSEQIACHDLLEFSENYIHVHFLEVHS-GEEFLALTK 180

Query: 692 DELNSIILEDEL 727
           D+L  I+  +EL
Sbjct: 181 DQLIKILRSEEL 192



 Score = 47.6 bits (108), Expect = 6e-05
 Identities = 27/86 (31%), Positives = 40/86 (46%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  ++     SF  HR +L+A SPYF ALFT  +    +  V I G+ +          
Sbjct: 37  CDVQLQVGQ-ESFKAHRLVLAASSPYFAALFTGGMKESSKDVVPILGIEAGIFQILLDFI 95

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLE 512
               +++   NV EL++ AD L   E
Sbjct: 96  YTGIVNIGVNNVQELIIAADMLQLTE 121


>BC032544-1|AAH32544.1|  582|Homo sapiens IPP protein protein.
          Length = 582

 Score = 55.6 bits (128), Expect = 2e-07
 Identities = 25/72 (34%), Positives = 44/72 (61%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V+ LCC+ L+  ++P NC+GI  F+ ++ C+ L   +  Y+  +F+ V +  +EFL L  
Sbjct: 122 VVHLCCEFLKGQIDPLNCIGIFQFSEQIACHDLLEFSENYIHVHFLEVHS-GEEFLALTK 180

Query: 692 DELNSIILEDEL 727
           D+L  I+  +EL
Sbjct: 181 DQLIKILRSEEL 192



 Score = 47.6 bits (108), Expect = 6e-05
 Identities = 27/86 (31%), Positives = 40/86 (46%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  ++     SF  HR +L+A SPYF ALFT  +    +  V I G+ +          
Sbjct: 37  CDVQLQVGQ-ESFKAHRLVLAASSPYFAALFTGGMKESSKDVVPILGIEAGIFQILLDFI 95

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLE 512
               +++   NV EL++ AD L   E
Sbjct: 96  YTGIVNIGVNNVQELIIAADMLQLTE 121


>AL604028-4|CAM12886.1|  584|Homo sapiens intracisternal A
           particle-promoted polypeptide protein.
          Length = 584

 Score = 55.6 bits (128), Expect = 2e-07
 Identities = 25/72 (34%), Positives = 44/72 (61%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V+ LCC+ L+  ++P NC+GI  F+ ++ C+ L   +  Y+  +F+ V +  +EFL L  
Sbjct: 122 VVHLCCEFLKGQIDPLNCIGIFQFSEQIACHDLLEFSENYIHVHFLEVHS-GEEFLALTK 180

Query: 692 DELNSIILEDEL 727
           D+L  I+  +EL
Sbjct: 181 DQLIKILRSEEL 192



 Score = 47.6 bits (108), Expect = 6e-05
 Identities = 27/86 (31%), Positives = 40/86 (46%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  ++     SF  HR +L+A SPYF ALFT  +    +  V I G+ +          
Sbjct: 37  CDVQLQVGQ-ESFKAHRLVLAASSPYFAALFTGGMKESSKDVVPILGIEAGIFQILLDFI 95

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLE 512
               +++   NV EL++ AD L   E
Sbjct: 96  YTGIVNIGVNNVQELIIAADMLQLTE 121


>AL604028-3|CAM12885.1|  582|Homo sapiens intracisternal A
           particle-promoted polypeptide protein.
          Length = 582

 Score = 55.6 bits (128), Expect = 2e-07
 Identities = 25/72 (34%), Positives = 44/72 (61%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V+ LCC+ L+  ++P NC+GI  F+ ++ C+ L   +  Y+  +F+ V +  +EFL L  
Sbjct: 122 VVHLCCEFLKGQIDPLNCIGIFQFSEQIACHDLLEFSENYIHVHFLEVHS-GEEFLALTK 180

Query: 692 DELNSIILEDEL 727
           D+L  I+  +EL
Sbjct: 181 DQLIKILRSEEL 192



 Score = 47.6 bits (108), Expect = 6e-05
 Identities = 27/86 (31%), Positives = 40/86 (46%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  ++     SF  HR +L+A SPYF ALFT  +    +  V I G+ +          
Sbjct: 37  CDVQLQVGQ-ESFKAHRLVLAASSPYFAALFTGGMKESSKDVVPILGIEAGIFQILLDFI 95

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLE 512
               +++   NV EL++ AD L   E
Sbjct: 96  YTGIVNIGVNNVQELIIAADMLQLTE 121


>AF156857-1|AAD39007.1|  584|Homo sapiens actin-binding protein
           protein.
          Length = 584

 Score = 55.6 bits (128), Expect = 2e-07
 Identities = 25/72 (34%), Positives = 44/72 (61%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V+ LCC+ L+  ++P NC+GI  F+ ++ C+ L   +  Y+  +F+ V +  +EFL L  
Sbjct: 122 VVHLCCEFLKGQIDPLNCIGIFQFSEQIACHDLLEFSENYIHVHFLEVHS-GEEFLALTK 180

Query: 692 DELNSIILEDEL 727
           D+L  I+  +EL
Sbjct: 181 DQLIKILRSEEL 192



 Score = 47.6 bits (108), Expect = 6e-05
 Identities = 27/86 (31%), Positives = 40/86 (46%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  ++     SF  HR +L+A SPYF ALFT  +    +  V I G+ +          
Sbjct: 37  CDVQLQVGQ-ESFKAHRLVLAASSPYFAALFTGGMKESSKDVVPILGIEAGIFQILLDFI 95

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLE 512
               +++   NV EL++ AD L   E
Sbjct: 96  YTGIVNIGVNNVQELIIAADMLQLTE 121


>BC036468-1|AAH36468.1|  593|Homo sapiens kelch-like 2, Mayven
           (Drosophila) protein.
          Length = 593

 Score = 55.2 bits (127), Expect = 3e-07
 Identities = 30/78 (38%), Positives = 44/78 (56%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L +   V + CC+ L S L+P NCLGI  FA    C  L   A  Y  ++F  V   S+E
Sbjct: 135 LLQLQDVKKTCCEFLESQLHPVNCLGIRAFADMHACTDLLNKANTYAEQHFADVVL-SEE 193

Query: 674 FLHLPLDELNSIILEDEL 727
           FL+L ++++ S+I  D+L
Sbjct: 194 FLNLGIEQVCSLISSDKL 211



 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 28/82 (34%), Positives = 35/82 (42%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  + A+D      HR +L+ACSPYF A+FT  +       V I  V            
Sbjct: 56  CDVTIVAED-MEISAHRVVLAACSPYFHAMFTGEMSESRAKRVRIKEVDGWTLRMLIDYV 114

Query: 435 XXXXIDVTDTNVHELLMTADYL 500
               I VT+ NV  LL  A  L
Sbjct: 115 YTAEIQVTEENVQVLLPAAGLL 136


>BC022503-1|AAH22503.1|  593|Homo sapiens kelch-like 2, Mayven
           (Drosophila) protein.
          Length = 593

 Score = 55.2 bits (127), Expect = 3e-07
 Identities = 30/78 (38%), Positives = 44/78 (56%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L +   V + CC+ L S L+P NCLGI  FA    C  L   A  Y  ++F  V   S+E
Sbjct: 135 LLQLQDVKKTCCEFLESQLHPVNCLGIRAFADMHACTDLLNKANTYAEQHFADVVL-SEE 193

Query: 674 FLHLPLDELNSIILEDEL 727
           FL+L ++++ S+I  D+L
Sbjct: 194 FLNLGIEQVCSLISSDKL 211



 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 28/82 (34%), Positives = 35/82 (42%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  + A+D      HR +L+ACSPYF A+FT  +       V I  V            
Sbjct: 56  CDVTIVAED-MEISAHRVVLAACSPYFHAMFTGEMSESRAKRVRIKEVDGWTLRMLIDYV 114

Query: 435 XXXXIDVTDTNVHELLMTADYL 500
               I VT+ NV  LL  A  L
Sbjct: 115 YTAEIQVTEENVQVLLPAAGLL 136


>AF059569-1|AAC67502.1|  593|Homo sapiens actin binding protein
           MAYVEN protein.
          Length = 593

 Score = 55.2 bits (127), Expect = 3e-07
 Identities = 30/78 (38%), Positives = 44/78 (56%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L +   V + CC+ L S L+P NCLGI  FA    C  L   A  Y  ++F  V   S+E
Sbjct: 135 LLQLQDVKKTCCEFLESQLHPVNCLGIRAFADMHACTDLLNKANTYAEQHFADVVL-SEE 193

Query: 674 FLHLPLDELNSIILEDEL 727
           FL+L ++++ S+I  D+L
Sbjct: 194 FLNLGIEQVCSLISSDKL 211



 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 28/82 (34%), Positives = 35/82 (42%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  + A+D      HR +L+ACSPYF A+FT  +       V I  V            
Sbjct: 56  CDVTIVAED-MEISAHRVVLAACSPYFHAMFTGEMSESRAKRVRIKEVDGWTLRMLIDYV 114

Query: 435 XXXXIDVTDTNVHELLMTADYL 500
               I VT+ NV  LL  A  L
Sbjct: 115 YTAEIQVTEENVQVLLPAAGLL 136


>AB209727-1|BAD92964.1|  460|Homo sapiens Kelch-like protein 2
           variant protein.
          Length = 460

 Score = 55.2 bits (127), Expect = 3e-07
 Identities = 30/78 (38%), Positives = 44/78 (56%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L +   V + CC+ L S L+P NCLGI  FA    C  L   A  Y  ++F  V   S+E
Sbjct: 2   LLQLQDVKKTCCEFLESQLHPVNCLGIRAFADMHACTDLLNKANTYAEQHFADVVL-SEE 60

Query: 674 FLHLPLDELNSIILEDEL 727
           FL+L ++++ S+I  D+L
Sbjct: 61  FLNLGIEQVCSLISSDKL 78


>BC032348-1|AAH32348.1|  610|Homo sapiens KLHL6 protein protein.
          Length = 610

 Score = 54.8 bits (126), Expect = 4e-07
 Identities = 27/80 (33%), Positives = 46/80 (57%)
 Frame = +2

Query: 488 SRLSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQS 667
           + L +F  ++  C   L  +LNP+NC+GI+  A       L+   + Y+++ FV +   S
Sbjct: 138 ANLFQFLRMVDACASFLTEALNPENCVGILRLADTHSLDSLKKQVQSYIIQNFVQI-LNS 196

Query: 668 DEFLHLPLDELNSIILEDEL 727
           +EFL LP+D L+ I+  D+L
Sbjct: 197 EEFLDLPVDTLHHILKSDDL 216



 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 28/102 (27%), Positives = 44/102 (43%), Gaps = 4/102 (3%)
 Frame = +3

Query: 234 TARVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXX 413
           T R+ +A   ++   D   F  HR +L+A S YF A+F   L  + +  ++I GV +   
Sbjct: 53  TLRMENALTDVILCVDIQEFSCHRVVLAAASNYFRAMFCNDLKEKYEKRIIIKGVDAETM 112

Query: 414 XXXXXXXXXXXIDVTDTNVHELLMTADYLAFLE----CFSFV 527
                        +T  NV  +L  A+   FL     C SF+
Sbjct: 113 HTLLDYTYTSKALITKQNVQRVLEAANLFQFLRMVDACASFL 154


>AK097125-1|BAC04957.1|  621|Homo sapiens protein ( Homo sapiens
           cDNA FLJ39806 fis, clone SPLEN2008460. ).
          Length = 621

 Score = 54.8 bits (126), Expect = 4e-07
 Identities = 27/80 (33%), Positives = 46/80 (57%)
 Frame = +2

Query: 488 SRLSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQS 667
           + L +F  ++  C   L  +LNP+NC+GI+  A       L+   + Y+++ FV +   S
Sbjct: 149 ANLFQFLRMVDACASFLTEALNPENCVGILRLADTHSLDSLKKQVQSYIIQNFVQI-LNS 207

Query: 668 DEFLHLPLDELNSIILEDEL 727
           +EFL LP+D L+ I+  D+L
Sbjct: 208 EEFLDLPVDTLHHILKSDDL 227



 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 28/102 (27%), Positives = 44/102 (43%), Gaps = 4/102 (3%)
 Frame = +3

Query: 234 TARVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXX 413
           T R+ +A   ++   D   F  HR +L+A S YF A+F   L  + +  ++I GV +   
Sbjct: 64  TLRMENALTDVILCVDIQEFSCHRVVLAAASNYFRAMFCNDLKEKYEKRIIIKGVDAETM 123

Query: 414 XXXXXXXXXXXIDVTDTNVHELLMTADYLAFLE----CFSFV 527
                        +T  NV  +L  A+   FL     C SF+
Sbjct: 124 HTLLDYTYTSKALITKQNVQRVLEAANLFQFLRMVDACASFL 165


>AF441792-1|AAL35594.1|  610|Homo sapiens kelch-like protein KLHL6
           protein.
          Length = 610

 Score = 54.8 bits (126), Expect = 4e-07
 Identities = 27/80 (33%), Positives = 46/80 (57%)
 Frame = +2

Query: 488 SRLSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQS 667
           + L +F  ++  C   L  +LNP+NC+GI+  A       L+   + Y+++ FV +   S
Sbjct: 138 ANLFQFLRMVDACASFLTEALNPENCVGILRLADTHSLDSLKKQVQSYIIQNFVQI-LNS 196

Query: 668 DEFLHLPLDELNSIILEDEL 727
           +EFL LP+D L+ I+  D+L
Sbjct: 197 EEFLDLPVDTLHHILKSDDL 216



 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 28/102 (27%), Positives = 44/102 (43%), Gaps = 4/102 (3%)
 Frame = +3

Query: 234 TARVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXX 413
           T R+ +A   ++   D   F  HR +L+A S YF A+F   L  + +  ++I GV +   
Sbjct: 53  TLRMENALTDVILCVDIQEFSCHRVVLAAASNYFRAMFCNDLKEKYEKRIIIKGVDAETM 112

Query: 414 XXXXXXXXXXXIDVTDTNVHELLMTADYLAFLE----CFSFV 527
                        +T  NV  +L  A+   FL     C SF+
Sbjct: 113 HTLLDYTYTSKALITKQNVQRVLEAANLFQFLRMVDACASFL 154


>BC053860-1|AAH53860.1|  762|Homo sapiens KLHL5 protein protein.
          Length = 762

 Score = 54.4 bits (125), Expect = 5e-07
 Identities = 25/72 (34%), Positives = 40/72 (55%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V++ CC  L   L+P NCLGI +FA    C  L   A  Y + +F+ V  ++ EF+ LP 
Sbjct: 312 VVEACCKFLMKQLHPSNCLGIRSFADAQGCTDLHKVAHNYTMEHFMEV-IRNQEFVLLPA 370

Query: 692 DELNSIILEDEL 727
            E+  ++  D++
Sbjct: 371 SEIAKLLASDDM 382



 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 25/84 (29%), Positives = 38/84 (45%)
 Frame = +3

Query: 240 RVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXX 419
           R    CD I+ A D    P HR +LS+ S YF A+FT  +    Q ++ + GV       
Sbjct: 222 RHKQLCDVILVAGD-RRIPAHRLVLSSVSDYFAAMFTNDVREARQEEIKMEGVEPNSLWS 280

Query: 420 XXXXXXXXXIDVTDTNVHELLMTA 491
                    +++ + N+  LL TA
Sbjct: 281 LIQYAYTGRLELKEDNIECLLSTA 304


>BC004175-1|AAH04175.1|  568|Homo sapiens kelch-like 12 (Drosophila)
           protein.
          Length = 568

 Score = 54.4 bits (125), Expect = 5e-07
 Identities = 30/79 (37%), Positives = 42/79 (53%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L +  GV Q CC+ L S L+P NCLGI  FA    C  L   A  +  ++F  V  Q +E
Sbjct: 112 LLQLKGVKQACCEFLESQLDPSNCLGIRDFAETHNCVDLMQAAEVFSQKHFPEV-VQHEE 170

Query: 674 FLHLPLDELNSIILEDELK 730
           F+ L   E+  +I  DE++
Sbjct: 171 FILLSQGEVEKLIKCDEIQ 189



 Score = 52.4 bits (120), Expect = 2e-06
 Identities = 29/87 (33%), Positives = 43/87 (49%)
 Frame = +3

Query: 231 STARVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXX 410
           S  + ++ CD  +R +    FP HR +L+ACS YF A+FT+ L  + +  V I G+ +  
Sbjct: 25  SLRKSNTLCDVTLRVEQ-KDFPAHRIVLAACSDYFCAMFTSELSEKGKPYVDIQGLTAST 83

Query: 411 XXXXXXXXXXXXIDVTDTNVHELLMTA 491
                       + VT  NV ELL  A
Sbjct: 84  MEILLDFVYTETVHVTVENVQELLPAA 110


>BC003183-1|AAH03183.1|  568|Homo sapiens kelch-like 12 (Drosophila)
           protein.
          Length = 568

 Score = 54.4 bits (125), Expect = 5e-07
 Identities = 30/79 (37%), Positives = 42/79 (53%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L +  GV Q CC+ L S L+P NCLGI  FA    C  L   A  +  ++F  V  Q +E
Sbjct: 112 LLQLKGVKQACCEFLESQLDPSNCLGIRDFAETHNCVDLMQAAEVFSQKHFPEV-VQHEE 170

Query: 674 FLHLPLDELNSIILEDELK 730
           F+ L   E+  +I  DE++
Sbjct: 171 FILLSQGEVEKLIKCDEIQ 189



 Score = 52.4 bits (120), Expect = 2e-06
 Identities = 29/87 (33%), Positives = 43/87 (49%)
 Frame = +3

Query: 231 STARVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXX 410
           S  + ++ CD  +R +    FP HR +L+ACS YF A+FT+ L  + +  V I G+ +  
Sbjct: 25  SLRKSNTLCDVTLRVEQ-KDFPAHRIVLAACSDYFCAMFTSELSEKGKPYVDIQGLTAST 83

Query: 411 XXXXXXXXXXXXIDVTDTNVHELLMTA 491
                       + VT  NV ELL  A
Sbjct: 84  MEILLDFVYTETVHVTVENVQELLPAA 110


>AK027656-1|BAB55271.1|  568|Homo sapiens protein ( Homo sapiens
           cDNA FLJ14750 fis, clone NT2RP3002948, weakly similar to
           RING CANAL PROTEIN. ).
          Length = 568

 Score = 54.4 bits (125), Expect = 5e-07
 Identities = 30/79 (37%), Positives = 42/79 (53%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L +  GV Q CC+ L S L+P NCLGI  FA    C  L   A  +  ++F  V  Q +E
Sbjct: 112 LLQLKGVKQACCEFLESQLDPSNCLGIRDFAETHNCVDLMQAAEVFSQKHFPEV-VQHEE 170

Query: 674 FLHLPLDELNSIILEDELK 730
           F+ L   E+  +I  DE++
Sbjct: 171 FILLSQGEVEKLIKCDEIQ 189



 Score = 52.4 bits (120), Expect = 2e-06
 Identities = 29/87 (33%), Positives = 43/87 (49%)
 Frame = +3

Query: 231 STARVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXX 410
           S  + ++ CD  +R +    FP HR +L+ACS YF A+FT+ L  + +  V I G+ +  
Sbjct: 25  SLRKSNTLCDVTLRVEQ-KDFPAHRIVLAACSDYFCAMFTSELSEKGKPYVDIQGLTAST 83

Query: 411 XXXXXXXXXXXXIDVTDTNVHELLMTA 491
                       + VT  NV ELL  A
Sbjct: 84  MEILLDFVYTETVHVTVENVQELLPAA 110


>AK002174-1|BAA92121.1|  508|Homo sapiens protein ( Homo sapiens
           cDNA FLJ11312 fis, clone PLACE1010105, weakly similar to
           RING CANAL PROTEIN. ).
          Length = 508

 Score = 54.4 bits (125), Expect = 5e-07
 Identities = 25/72 (34%), Positives = 40/72 (55%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V++ CC  L   L+P NCLGI +FA    C  L   A  Y + +F+ V  ++ EF+ LP 
Sbjct: 58  VVEACCKFLMKQLHPSNCLGIRSFADAQGCTDLHKVAHNYTMEHFMEV-IRNQEFVLLPA 116

Query: 692 DELNSIILEDEL 727
            E+  ++  D++
Sbjct: 117 SEIAKLLASDDM 128


>AF272976-1|AAL08584.1|  734|Homo sapiens kelch-like 5 protein
           protein.
          Length = 734

 Score = 54.4 bits (125), Expect = 5e-07
 Identities = 25/72 (34%), Positives = 40/72 (55%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V++ CC  L   L+P NCLGI +FA    C  L   A  Y + +F+ V  ++ EF+ LP 
Sbjct: 305 VVEACCKFLMKQLHPSNCLGIRSFADAQGCTDLHKVAHNYTMEHFMEV-IRNQEFVLLPA 363

Query: 692 DELNSIILEDEL 727
            E+  ++  D++
Sbjct: 364 SEIAKLLASDDM 375



 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 25/84 (29%), Positives = 38/84 (45%)
 Frame = +3

Query: 240 RVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXX 419
           R    CD I+ A D    P HR +LS+ S YF A+FT  +    Q ++ + GV       
Sbjct: 215 RHKQLCDVILVAGD-RRIPAHRLVLSSVSDYFAAMFTNDVREARQEEIKMEGVEPNSLWS 273

Query: 420 XXXXXXXXXIDVTDTNVHELLMTA 491
                    +++ + N+  LL TA
Sbjct: 274 LIQYAYTGRLELKEDNIECLLSTA 297


>AF190900-1|AAG17175.1|  568|Homo sapiens kelch-like protein C3IP1
           protein.
          Length = 568

 Score = 54.4 bits (125), Expect = 5e-07
 Identities = 30/79 (37%), Positives = 42/79 (53%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L +  GV Q CC+ L S L+P NCLGI  FA    C  L   A  +  ++F  V  Q +E
Sbjct: 112 LLQLKGVKQACCEFLESQLDPSNCLGIRDFAETHNCVDLMQAAEVFSQKHFPEV-VQHEE 170

Query: 674 FLHLPLDELNSIILEDELK 730
           F+ L   E+  +I  DE++
Sbjct: 171 FILLSQGEVEKLIKCDEIQ 189



 Score = 52.4 bits (120), Expect = 2e-06
 Identities = 29/87 (33%), Positives = 43/87 (49%)
 Frame = +3

Query: 231 STARVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXX 410
           S  + ++ CD  +R +    FP HR +L+ACS YF A+FT+ L  + +  V I G+ +  
Sbjct: 25  SLRKSNTLCDVTLRVEQ-KDFPAHRIVLAACSDYFCAMFTSELSEKGKPYVDIQGLTAST 83

Query: 411 XXXXXXXXXXXXIDVTDTNVHELLMTA 491
                       + VT  NV ELL  A
Sbjct: 84  MEILLDFVYTETVHVTVENVQELLPAA 110


>AB208820-1|BAD92057.1|  593|Homo sapiens kelch-like 5 isoform 2
           variant protein.
          Length = 593

 Score = 54.4 bits (125), Expect = 5e-07
 Identities = 25/72 (34%), Positives = 40/72 (55%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V++ CC  L   L+P NCLGI +FA    C  L   A  Y + +F+ V  ++ EF+ LP 
Sbjct: 143 VVEACCKFLMKQLHPSNCLGIRSFADAQGCTDLHKVAHNYTMEHFMEV-IRNQEFVLLPA 201

Query: 692 DELNSIILEDEL 727
            E+  ++  D++
Sbjct: 202 SEIAKLLASDDM 213



 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 25/84 (29%), Positives = 38/84 (45%)
 Frame = +3

Query: 240 RVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXX 419
           R    CD I+ A D    P HR +LS+ S YF A+FT  +    Q ++ + GV       
Sbjct: 53  RHKQLCDVILVAGD-RRIPAHRLVLSSVSDYFAAMFTNDVREARQEEIKMEGVEPNSLWS 111

Query: 420 XXXXXXXXXIDVTDTNVHELLMTA 491
                    +++ + N+  LL TA
Sbjct: 112 LIQYAYTGRLELKEDNIECLLSTA 135


>D50922-1|BAA09481.2|  637|Homo sapiens KIAA0132 protein.
          Length = 637

 Score = 54.0 bits (124), Expect = 7e-07
 Identities = 28/82 (34%), Positives = 46/82 (56%)
 Frame = +2

Query: 482 NDSRLSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVAT 661
           N + + +   V++ C D L   L+P N +GI  FA ++ C +L   AR Y+  +F  VA 
Sbjct: 170 NGAVMYQIDSVVRACSDFLVQQLDPSNAIGIANFAEQIGCVELHQRAREYIYMHFGEVAK 229

Query: 662 QSDEFLHLPLDELNSIILEDEL 727
           Q +EF +L   +L ++I  D+L
Sbjct: 230 Q-EEFFNLSHCQLVTLISRDDL 250



 Score = 32.3 bits (70), Expect = 2.4
 Identities = 14/38 (36%), Positives = 21/38 (55%)
 Frame = +3

Query: 285 ASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGV 398
           A F  H+ +L++ SP F A+FT  L  +    V I G+
Sbjct: 104 AQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVSIEGI 141


>BC015945-1|AAH15945.1|  624|Homo sapiens kelch-like ECH-associated
           protein 1 protein.
          Length = 624

 Score = 54.0 bits (124), Expect = 7e-07
 Identities = 28/82 (34%), Positives = 46/82 (56%)
 Frame = +2

Query: 482 NDSRLSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVAT 661
           N + + +   V++ C D L   L+P N +GI  FA ++ C +L   AR Y+  +F  VA 
Sbjct: 157 NGAVMYQIDSVVRACSDFLVQQLDPSNAIGIANFAEQIGCVELHQRAREYIYMHFGEVAK 216

Query: 662 QSDEFLHLPLDELNSIILEDEL 727
           Q +EF +L   +L ++I  D+L
Sbjct: 217 Q-EEFFNLSHCQLVTLISRDDL 237



 Score = 32.3 bits (70), Expect = 2.4
 Identities = 14/38 (36%), Positives = 21/38 (55%)
 Frame = +3

Query: 285 ASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGV 398
           A F  H+ +L++ SP F A+FT  L  +    V I G+
Sbjct: 91  AQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVSIEGI 128


>BC002930-1|AAH02930.1|  624|Homo sapiens kelch-like ECH-associated
           protein 1 protein.
          Length = 624

 Score = 54.0 bits (124), Expect = 7e-07
 Identities = 28/82 (34%), Positives = 46/82 (56%)
 Frame = +2

Query: 482 NDSRLSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVAT 661
           N + + +   V++ C D L   L+P N +GI  FA ++ C +L   AR Y+  +F  VA 
Sbjct: 157 NGAVMYQIDSVVRACSDFLVQQLDPSNAIGIANFAEQIGCVELHQRAREYIYMHFGEVAK 216

Query: 662 QSDEFLHLPLDELNSIILEDEL 727
           Q +EF +L   +L ++I  D+L
Sbjct: 217 Q-EEFFNLSHCQLVTLISRDDL 237



 Score = 32.3 bits (70), Expect = 2.4
 Identities = 14/38 (36%), Positives = 21/38 (55%)
 Frame = +3

Query: 285 ASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGV 398
           A F  H+ +L++ SP F A+FT  L  +    V I G+
Sbjct: 91  AQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVSIEGI 128


>BC002417-1|AAH02417.1|  624|Homo sapiens kelch-like ECH-associated
           protein 1 protein.
          Length = 624

 Score = 54.0 bits (124), Expect = 7e-07
 Identities = 28/82 (34%), Positives = 46/82 (56%)
 Frame = +2

Query: 482 NDSRLSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVAT 661
           N + + +   V++ C D L   L+P N +GI  FA ++ C +L   AR Y+  +F  VA 
Sbjct: 157 NGAVMYQIDSVVRACSDFLVQQLDPSNAIGIANFAEQIGCVELHQRAREYIYMHFGEVAK 216

Query: 662 QSDEFLHLPLDELNSIILEDEL 727
           Q +EF +L   +L ++I  D+L
Sbjct: 217 Q-EEFFNLSHCQLVTLISRDDL 237



 Score = 32.3 bits (70), Expect = 2.4
 Identities = 14/38 (36%), Positives = 21/38 (55%)
 Frame = +3

Query: 285 ASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGV 398
           A F  H+ +L++ SP F A+FT  L  +    V I G+
Sbjct: 91  AQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVSIEGI 128


>AY172948-1|AAO39710.1|  694|Homo sapiens KLHL5b protein protein.
          Length = 694

 Score = 54.0 bits (124), Expect = 7e-07
 Identities = 25/72 (34%), Positives = 40/72 (55%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V++ CC  L   L+P NCLGI +FA    C  L   A  Y + +F+ V  ++ EF+ LP 
Sbjct: 244 VVEACCKFLMKQLHPSNCLGIRSFADAQGCTDLHKVAHNYTMEHFMGV-IRNQEFVLLPA 302

Query: 692 DELNSIILEDEL 727
            E+  ++  D++
Sbjct: 303 SEIAKLLASDDM 314



 Score = 34.7 bits (76), Expect = 0.44
 Identities = 17/63 (26%), Positives = 29/63 (46%)
 Frame = +3

Query: 303 RAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTDTNVHELL 482
           R +LS+ S YF A+FT  +    Q ++ + GV                +++ + N+  LL
Sbjct: 174 RLVLSSVSDYFAAMFTNDVREARQEEIKMEGVEPNSLWSLIQYAYTGRLELKEDNIECLL 233

Query: 483 MTA 491
            TA
Sbjct: 234 STA 236


>AF361892-1|AAK43722.1|  624|Homo sapiens cytosolic inhibitor of
           Nrf2 protein.
          Length = 624

 Score = 54.0 bits (124), Expect = 7e-07
 Identities = 28/82 (34%), Positives = 46/82 (56%)
 Frame = +2

Query: 482 NDSRLSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVAT 661
           N + + +   V++ C D L   L+P N +GI  FA ++ C +L   AR Y+  +F  VA 
Sbjct: 157 NGAVMYQIDSVVRACSDFLVQQLDPSNAIGIANFAEQIGCVELHQRAREYIYMHFGEVAK 216

Query: 662 QSDEFLHLPLDELNSIILEDEL 727
           Q +EF +L   +L ++I  D+L
Sbjct: 217 Q-EEFFNLSHCQLVTLISRDDL 237



 Score = 32.3 bits (70), Expect = 2.4
 Identities = 14/38 (36%), Positives = 21/38 (55%)
 Frame = +3

Query: 285 ASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGV 398
           A F  H+ +L++ SP F A+FT  L  +    V I G+
Sbjct: 91  AQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVSIEGI 128


>AF361886-1|AAK51082.1|  624|Homo sapiens cytosolic inhibitor of
           NRF2 protein.
          Length = 624

 Score = 54.0 bits (124), Expect = 7e-07
 Identities = 28/82 (34%), Positives = 46/82 (56%)
 Frame = +2

Query: 482 NDSRLSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVAT 661
           N + + +   V++ C D L   L+P N +GI  FA ++ C +L   AR Y+  +F  VA 
Sbjct: 157 NGAVMYQIDSVVRACSDFLVQQLDPSNAIGIANFAEQIGCVELHQRAREYIYMHFGEVAK 216

Query: 662 QSDEFLHLPLDELNSIILEDEL 727
           Q +EF +L   +L ++I  D+L
Sbjct: 217 Q-EEFFNLSHCQLVTLISRDDL 237



 Score = 32.3 bits (70), Expect = 2.4
 Identities = 14/38 (36%), Positives = 21/38 (55%)
 Frame = +3

Query: 285 ASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGV 398
           A F  H+ +L++ SP F A+FT  L  +    V I G+
Sbjct: 91  AQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVSIEGI 128


>BX248409-2|CAH73000.1|  609|Homo sapiens kelch-like 20 (Drosophila)
           protein.
          Length = 609

 Score = 53.6 bits (123), Expect = 9e-07
 Identities = 28/72 (38%), Positives = 41/72 (56%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           + + CC+ L+  L+P NCLGI  FA    C +L   A ++    F  V  +S+EF+ LP 
Sbjct: 153 IQEACCEFLKRQLDPSNCLGIRAFADTHSCRELLRIADKFTQHNFQEV-MESEEFMLLPA 211

Query: 692 DELNSIILEDEL 727
           ++L  II  DEL
Sbjct: 212 NQLIDIISSDEL 223



 Score = 46.8 bits (106), Expect = 1e-04
 Identities = 30/86 (34%), Positives = 37/86 (43%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD +V          HR ILSACSPYF A+FT  L    Q++V+I  +            
Sbjct: 68  CD-VVLVVGAKKIYAHRVILSACSPYFRAMFTGELAESRQTEVVIRDIDERAMELLIDFA 126

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLE 512
               I V + NV  LL  A  L   E
Sbjct: 127 YTSQITVEEGNVQTLLPAACLLQLAE 152


>BC063418-1|AAH63418.1|  609|Homo sapiens kelch-like 20 (Drosophila)
           protein.
          Length = 609

 Score = 53.6 bits (123), Expect = 9e-07
 Identities = 28/72 (38%), Positives = 41/72 (56%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           + + CC+ L+  L+P NCLGI  FA    C +L   A ++    F  V  +S+EF+ LP 
Sbjct: 153 IQEACCEFLKRQLDPSNCLGIRAFADTHSCRELLRIADKFTQHNFQEV-MESEEFMLLPA 211

Query: 692 DELNSIILEDEL 727
           ++L  II  DEL
Sbjct: 212 NQLIDIISSDEL 223



 Score = 46.8 bits (106), Expect = 1e-04
 Identities = 30/86 (34%), Positives = 37/86 (43%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD +V          HR ILSACSPYF A+FT  L    Q++V+I  +            
Sbjct: 68  CD-VVLVVGAKKIYAHRVILSACSPYFRAMFTGELAESRQTEVVIRDIDERAMELLIDFA 126

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLE 512
               I V + NV  LL  A  L   E
Sbjct: 127 YTSQITVEEGNVQTLLPAACLLQLAE 152


>AL109921-1|CAI20377.1|  609|Homo sapiens kelch-like 20 (Drosophila)
           protein.
          Length = 609

 Score = 53.6 bits (123), Expect = 9e-07
 Identities = 28/72 (38%), Positives = 41/72 (56%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           + + CC+ L+  L+P NCLGI  FA    C +L   A ++    F  V  +S+EF+ LP 
Sbjct: 153 IQEACCEFLKRQLDPSNCLGIRAFADTHSCRELLRIADKFTQHNFQEV-MESEEFMLLPA 211

Query: 692 DELNSIILEDEL 727
           ++L  II  DEL
Sbjct: 212 NQLIDIISSDEL 223



 Score = 46.8 bits (106), Expect = 1e-04
 Identities = 30/86 (34%), Positives = 37/86 (43%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD +V          HR ILSACSPYF A+FT  L    Q++V+I  +            
Sbjct: 68  CD-VVLVVGAKKIYAHRVILSACSPYFRAMFTGELAESRQTEVVIRDIDERAMELLIDFA 126

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLE 512
               I V + NV  LL  A  L   E
Sbjct: 127 YTSQITVEEGNVQTLLPAACLLQLAE 152


>AJ844466-1|CAH59617.1|  609|Homo sapiens KLEIP (kelch-like ECT2
           interacting protein) protein.
          Length = 609

 Score = 53.6 bits (123), Expect = 9e-07
 Identities = 28/72 (38%), Positives = 41/72 (56%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           + + CC+ L+  L+P NCLGI  FA    C +L   A ++    F  V  +S+EF+ LP 
Sbjct: 153 IQEACCEFLKRQLDPSNCLGIRAFADTHSCRELLRIADKFTQHNFQEV-MESEEFMLLPA 211

Query: 692 DELNSIILEDEL 727
           ++L  II  DEL
Sbjct: 212 NQLIDIISSDEL 223



 Score = 46.8 bits (106), Expect = 1e-04
 Identities = 30/86 (34%), Positives = 37/86 (43%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD +V          HR ILSACSPYF A+FT  L    Q++V+I  +            
Sbjct: 68  CD-VVLVVGAKKIYAHRVILSACSPYFRAMFTGELAESRQTEVVIRDIDERAMELLIDFA 126

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLE 512
               I V + NV  LL  A  L   E
Sbjct: 127 YTSQITVEEGNVQTLLPAACLLQLAE 152


>AB026190-1|BAA77027.1|  609|Homo sapiens Kelch motif containing
           protein protein.
          Length = 609

 Score = 53.6 bits (123), Expect = 9e-07
 Identities = 28/72 (38%), Positives = 41/72 (56%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           + + CC+ L+  L+P NCLGI  FA    C +L   A ++    F  V  +S+EF+ LP 
Sbjct: 153 IQEACCEFLKRQLDPSNCLGIRAFADTHSCRELLRIADKFTQHNFQEV-MESEEFMLLPA 211

Query: 692 DELNSIILEDEL 727
           ++L  II  DEL
Sbjct: 212 NQLIDIISSDEL 223



 Score = 46.8 bits (106), Expect = 1e-04
 Identities = 30/86 (34%), Positives = 37/86 (43%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD +V          HR ILSACSPYF A+FT  L    Q++V+I  +            
Sbjct: 68  CD-VVLVVGAKKIYAHRVILSACSPYFRAMFTGELAESRQTEVVIRDIDERAMELLIDFA 126

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLE 512
               I V + NV  LL  A  L   E
Sbjct: 127 YTSQITVEEGNVQTLLPAACLLQLAE 152


>Z95400-2|CAI42741.1|  720|Homo sapiens kelch-like 4 (Drosophila)
           protein.
          Length = 720

 Score = 52.8 bits (121), Expect = 2e-06
 Identities = 24/72 (33%), Positives = 43/72 (59%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V+ +C + L   L+P NCLGI +F     C +L   A +Y + +F+ V  ++ EFL LP 
Sbjct: 267 VIDVCSNFLIKQLHPSNCLGIRSFGDAQGCTELLNVAHKYTMEHFIEV-IKNQEFLLLPA 325

Query: 692 DELNSIILEDEL 727
           +E++ ++  D++
Sbjct: 326 NEISKLLCSDDI 337



 Score = 39.5 bits (88), Expect = 0.016
 Identities = 25/100 (25%), Positives = 42/100 (42%), Gaps = 2/100 (2%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++ A      P HR +LSA S YF A+FT  +   +Q +V + GV            
Sbjct: 182 CDVLLIAGH-LRIPAHRLVLSAVSDYFAAMFTNDVLEAKQEEVRMEGVDPNALNSLVQYA 240

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLECFSFVA--IISEVH 548
               + + +  +  LL  A  L   +     +  +I ++H
Sbjct: 241 YTGVLQLKEDTIESLLAAACLLQLTQVIDVCSNFLIKQLH 280


>Z95400-1|CAI42740.1|  718|Homo sapiens kelch-like 4 (Drosophila)
           protein.
          Length = 718

 Score = 52.8 bits (121), Expect = 2e-06
 Identities = 24/72 (33%), Positives = 43/72 (59%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V+ +C + L   L+P NCLGI +F     C +L   A +Y + +F+ V  ++ EFL LP 
Sbjct: 267 VIDVCSNFLIKQLHPSNCLGIRSFGDAQGCTELLNVAHKYTMEHFIEV-IKNQEFLLLPA 325

Query: 692 DELNSIILEDEL 727
           +E++ ++  D++
Sbjct: 326 NEISKLLCSDDI 337



 Score = 39.5 bits (88), Expect = 0.016
 Identities = 25/100 (25%), Positives = 42/100 (42%), Gaps = 2/100 (2%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++ A      P HR +LSA S YF A+FT  +   +Q +V + GV            
Sbjct: 182 CDVLLIAGH-LRIPAHRLVLSAVSDYFAAMFTNDVLEAKQEEVRMEGVDPNALNSLVQYA 240

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLECFSFVA--IISEVH 548
               + + +  +  LL  A  L   +     +  +I ++H
Sbjct: 241 YTGVLQLKEDTIESLLAAACLLQLTQVIDVCSNFLIKQLH 280


>BC146677-1|AAI46678.1|  718|Homo sapiens kelch-like 4 (Drosophila)
           protein.
          Length = 718

 Score = 52.8 bits (121), Expect = 2e-06
 Identities = 24/72 (33%), Positives = 43/72 (59%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V+ +C + L   L+P NCLGI +F     C +L   A +Y + +F+ V  ++ EFL LP 
Sbjct: 267 VIDVCSNFLIKQLHPSNCLGIRSFGDAQGCTELLNVAHKYTMEHFIEV-IKNQEFLLLPA 325

Query: 692 DELNSIILEDEL 727
           +E++ ++  D++
Sbjct: 326 NEISKLLCSDDI 337



 Score = 39.5 bits (88), Expect = 0.016
 Identities = 25/100 (25%), Positives = 42/100 (42%), Gaps = 2/100 (2%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++ A      P HR +LSA S YF A+FT  +   +Q +V + GV            
Sbjct: 182 CDVLLIAGH-LRIPAHRLVLSAVSDYFAAMFTNDVLEAKQEEVRMEGVDPNALNSLVQYA 240

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLECFSFVA--IISEVH 548
               + + +  +  LL  A  L   +     +  +I ++H
Sbjct: 241 YTGVLQLKEDTIESLLAAACLLQLTQVIDVCSNFLIKQLH 280


>BC142652-1|AAI42653.1|  718|Homo sapiens kelch-like 4 (Drosophila)
           protein.
          Length = 718

 Score = 52.8 bits (121), Expect = 2e-06
 Identities = 24/72 (33%), Positives = 43/72 (59%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V+ +C + L   L+P NCLGI +F     C +L   A +Y + +F+ V  ++ EFL LP 
Sbjct: 267 VIDVCSNFLIKQLHPSNCLGIRSFGDAQGCTELLNVAHKYTMEHFIEV-IKNQEFLLLPA 325

Query: 692 DELNSIILEDEL 727
           +E++ ++  D++
Sbjct: 326 NEISKLLCSDDI 337



 Score = 39.5 bits (88), Expect = 0.016
 Identities = 25/100 (25%), Positives = 42/100 (42%), Gaps = 2/100 (2%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++ A      P HR +LSA S YF A+FT  +   +Q +V + GV            
Sbjct: 182 CDVLLIAGH-LRIPAHRLVLSAVSDYFAAMFTNDVLEAKQEEVRMEGVDPNALNSLVQYA 240

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLECFSFVA--IISEVH 548
               + + +  +  LL  A  L   +     +  +I ++H
Sbjct: 241 YTGVLQLKEDTIESLLAAACLLQLTQVIDVCSNFLIKQLH 280


>AL035424-2|CAI42085.1|  720|Homo sapiens kelch-like 4 (Drosophila)
           protein.
          Length = 720

 Score = 52.8 bits (121), Expect = 2e-06
 Identities = 24/72 (33%), Positives = 43/72 (59%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V+ +C + L   L+P NCLGI +F     C +L   A +Y + +F+ V  ++ EFL LP 
Sbjct: 267 VIDVCSNFLIKQLHPSNCLGIRSFGDAQGCTELLNVAHKYTMEHFIEV-IKNQEFLLLPA 325

Query: 692 DELNSIILEDEL 727
           +E++ ++  D++
Sbjct: 326 NEISKLLCSDDI 337



 Score = 39.5 bits (88), Expect = 0.016
 Identities = 25/100 (25%), Positives = 42/100 (42%), Gaps = 2/100 (2%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++ A      P HR +LSA S YF A+FT  +   +Q +V + GV            
Sbjct: 182 CDVLLIAGH-LRIPAHRLVLSAVSDYFAAMFTNDVLEAKQEEVRMEGVDPNALNSLVQYA 240

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLECFSFVA--IISEVH 548
               + + +  +  LL  A  L   +     +  +I ++H
Sbjct: 241 YTGVLQLKEDTIESLLAAACLLQLTQVIDVCSNFLIKQLH 280


>AL035424-1|CAI42084.1|  718|Homo sapiens kelch-like 4 (Drosophila)
           protein.
          Length = 718

 Score = 52.8 bits (121), Expect = 2e-06
 Identities = 24/72 (33%), Positives = 43/72 (59%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V+ +C + L   L+P NCLGI +F     C +L   A +Y + +F+ V  ++ EFL LP 
Sbjct: 267 VIDVCSNFLIKQLHPSNCLGIRSFGDAQGCTELLNVAHKYTMEHFIEV-IKNQEFLLLPA 325

Query: 692 DELNSIILEDEL 727
           +E++ ++  D++
Sbjct: 326 NEISKLLCSDDI 337



 Score = 39.5 bits (88), Expect = 0.016
 Identities = 25/100 (25%), Positives = 42/100 (42%), Gaps = 2/100 (2%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++ A      P HR +LSA S YF A+FT  +   +Q +V + GV            
Sbjct: 182 CDVLLIAGH-LRIPAHRLVLSAVSDYFAAMFTNDVLEAKQEEVRMEGVDPNALNSLVQYA 240

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLECFSFVA--IISEVH 548
               + + +  +  LL  A  L   +     +  +I ++H
Sbjct: 241 YTGVLQLKEDTIESLLAAACLLQLTQVIDVCSNFLIKQLH 280


>AK022715-1|BAB14199.1|  569|Homo sapiens protein ( Homo sapiens
           cDNA FLJ12653 fis, clone NT2RM4002075, weakly similar to
           RING CANAL PROTEIN. ).
          Length = 569

 Score = 52.8 bits (121), Expect = 2e-06
 Identities = 24/72 (33%), Positives = 43/72 (59%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V+ +C + L   L+P NCLGI +F     C +L   A +Y + +F+ V  ++ EFL LP 
Sbjct: 118 VIDVCSNFLIKQLHPSNCLGIRSFGDAQGCTELLNVAHKYTMEHFIEV-IKNQEFLLLPA 176

Query: 692 DELNSIILEDEL 727
           +E++ ++  D++
Sbjct: 177 NEISKLLCSDDI 188



 Score = 39.5 bits (88), Expect = 0.016
 Identities = 25/100 (25%), Positives = 42/100 (42%), Gaps = 2/100 (2%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++ A      P HR +LSA S YF A+FT  +   +Q +V + GV            
Sbjct: 33  CDVLLIAGH-LRIPAHRLVLSAVSDYFAAMFTNDVLEAKQEEVRMEGVDPNALNSLVQYA 91

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLECFSFVA--IISEVH 548
               + + +  +  LL  A  L   +     +  +I ++H
Sbjct: 92  YTGVLQLKEDTIESLLAAACLLQLTQVIDVCSNFLIKQLH 131


>AF284766-1|AAK49442.1|  720|Homo sapiens kelch-like protein KLHL4c
           protein.
          Length = 720

 Score = 52.8 bits (121), Expect = 2e-06
 Identities = 24/72 (33%), Positives = 43/72 (59%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V+ +C + L   L+P NCLGI +F     C +L   A +Y + +F+ V  ++ EFL LP 
Sbjct: 267 VIDVCSNFLIKQLHPSNCLGIRSFGDAQGCTELLNVAHKYTMEHFIEV-IKNQEFLLLPA 325

Query: 692 DELNSIILEDEL 727
           +E++ ++  D++
Sbjct: 326 NEISKLLCSDDI 337



 Score = 39.5 bits (88), Expect = 0.016
 Identities = 25/100 (25%), Positives = 42/100 (42%), Gaps = 2/100 (2%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++ A      P HR +LSA S YF A+FT  +   +Q +V + GV            
Sbjct: 182 CDVLLIAGH-LRIPAHRLVLSAVSDYFAAMFTNDVLEAKQEEVRMEGVDPNALNSLVQYA 240

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLECFSFVA--IISEVH 548
               + + +  +  LL  A  L   +     +  +I ++H
Sbjct: 241 YTGVLQLKEDTIESLLAAACLLQLTQVIDVCSNFLIKQLH 280


>AF284765-1|AAK49441.1|  718|Homo sapiens kelch-like protein KLHL4
           protein.
          Length = 718

 Score = 52.8 bits (121), Expect = 2e-06
 Identities = 24/72 (33%), Positives = 43/72 (59%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V+ +C + L   L+P NCLGI +F     C +L   A +Y + +F+ V  ++ EFL LP 
Sbjct: 267 VIDVCSNFLIKQLHPSNCLGIRSFGDAQGCTELLNVAHKYTMEHFIEV-IKNQEFLLLPA 325

Query: 692 DELNSIILEDEL 727
           +E++ ++  D++
Sbjct: 326 NEISKLLCSDDI 337



 Score = 39.5 bits (88), Expect = 0.016
 Identities = 25/100 (25%), Positives = 42/100 (42%), Gaps = 2/100 (2%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++ A      P HR +LSA S YF A+FT  +   +Q +V + GV            
Sbjct: 182 CDVLLIAGH-LRIPAHRLVLSAVSDYFAAMFTNDVLEAKQEEVRMEGVDPNALNSLVQYA 240

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLECFSFVA--IISEVH 548
               + + +  +  LL  A  L   +     +  +I ++H
Sbjct: 241 YTGVLQLKEDTIESLLAAACLLQLTQVIDVCSNFLIKQLH 280


>AB051474-1|BAB21778.1|  728|Homo sapiens KIAA1687 protein protein.
          Length = 728

 Score = 52.8 bits (121), Expect = 2e-06
 Identities = 24/72 (33%), Positives = 43/72 (59%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V+ +C + L   L+P NCLGI +F     C +L   A +Y + +F+ V  ++ EFL LP 
Sbjct: 277 VIDVCSNFLIKQLHPSNCLGIRSFGDAQGCTELLNVAHKYTMEHFIEV-IKNQEFLLLPA 335

Query: 692 DELNSIILEDEL 727
           +E++ ++  D++
Sbjct: 336 NEISKLLCSDDI 347



 Score = 39.5 bits (88), Expect = 0.016
 Identities = 25/100 (25%), Positives = 42/100 (42%), Gaps = 2/100 (2%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++ A      P HR +LSA S YF A+FT  +   +Q +V + GV            
Sbjct: 192 CDVLLIAGH-LRIPAHRLVLSAVSDYFAAMFTNDVLEAKQEEVRMEGVDPNALNSLVQYA 250

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLECFSFVA--IISEVH 548
               + + +  +  LL  A  L   +     +  +I ++H
Sbjct: 251 YTGVLQLKEDTIESLLAAACLLQLTQVIDVCSNFLIKQLH 290


>AK223072-1|BAD96792.1|  568|Homo sapiens kelch-like 12 variant
           protein.
          Length = 568

 Score = 52.4 bits (120), Expect = 2e-06
 Identities = 29/87 (33%), Positives = 43/87 (49%)
 Frame = +3

Query: 231 STARVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXX 410
           S  + ++ CD  +R +    FP HR +L+ACS YF A+FT+ L  + +  V I G+ +  
Sbjct: 25  SLRKSNTLCDVTLRVEQ-KDFPAHRIVLAACSDYFCAMFTSELSEKGKPYVDIQGLTAST 83

Query: 411 XXXXXXXXXXXXIDVTDTNVHELLMTA 491
                       + VT  NV ELL  A
Sbjct: 84  MEILLDFVYTETVHVTVENVQELLPAA 110



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 29/79 (36%), Positives = 41/79 (51%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L +  GV Q  C+ L S L+P NCLGI  FA    C  L   A  +  ++F  V  Q +E
Sbjct: 112 LLQLKGVKQARCEFLESQLDPSNCLGIRDFAETHNCVDLMQAAEVFSQKHFPEV-VQHEE 170

Query: 674 FLHLPLDELNSIILEDELK 730
           F+ L   E+  +I  DE++
Sbjct: 171 FILLSQGEVEKLIKCDEIQ 189


>BC121010-1|AAI21011.1|  571|Homo sapiens kelch-like 28 (Drosophila)
           protein.
          Length = 571

 Score = 51.6 bits (118), Expect = 4e-06
 Identities = 27/70 (38%), Positives = 38/70 (54%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           VL+ CC  L S L+P NC+GI  FA    C  L   A +Y+ + F  V  Q++EF  L  
Sbjct: 120 VLKECCAFLESQLDPGNCIGISRFAETYGCRDLYLAATKYICQNFEAVC-QTEEFFELTH 178

Query: 692 DELNSIILED 721
            +L+ I+  D
Sbjct: 179 ADLDEIVSND 188



 Score = 41.9 bits (94), Expect = 0.003
 Identities = 26/95 (27%), Positives = 41/95 (43%), Gaps = 4/95 (4%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD I+R  D      H+ +L++ SPYF A+FT  L  +E S+V    +            
Sbjct: 35  CDIILRVGD-VKIHAHKVVLASVSPYFKAMFTGNLSEKENSEVEFQCIDETALQAIVEYA 93

Query: 435 XXXXIDVTDTNVHELLMTADY----LAFLECFSFV 527
               + ++   V  LL  A+     L   EC +F+
Sbjct: 94  YTGTVFISQDTVESLLPAANLLQIKLVLKECCAFL 128


>BC121009-1|AAI21010.1|  571|Homo sapiens kelch-like 28 (Drosophila)
           protein.
          Length = 571

 Score = 51.6 bits (118), Expect = 4e-06
 Identities = 27/70 (38%), Positives = 38/70 (54%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           VL+ CC  L S L+P NC+GI  FA    C  L   A +Y+ + F  V  Q++EF  L  
Sbjct: 120 VLKECCAFLESQLDPGNCIGISRFAETYGCRDLYLAATKYICQNFEAVC-QTEEFFELTH 178

Query: 692 DELNSIILED 721
            +L+ I+  D
Sbjct: 179 ADLDEIVSND 188



 Score = 41.9 bits (94), Expect = 0.003
 Identities = 26/95 (27%), Positives = 41/95 (43%), Gaps = 4/95 (4%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD I+R  D      H+ +L++ SPYF A+FT  L  +E S+V    +            
Sbjct: 35  CDIILRVGD-VKIHAHKVVLASVSPYFKAMFTGNLSEKENSEVEFQCIDETALQAIVEYA 93

Query: 435 XXXXIDVTDTNVHELLMTADY----LAFLECFSFV 527
               + ++   V  LL  A+     L   EC +F+
Sbjct: 94  YTGTVFISQDTVESLLPAANLLQIKLVLKECCAFL 128


>AK001698-1|BAA91845.1|  508|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10836 fis, clone NT2RP4001228, weakly similar to
           RING CANAL PROTEIN. ).
          Length = 508

 Score = 51.6 bits (118), Expect = 4e-06
 Identities = 24/72 (33%), Positives = 39/72 (54%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V++ CC  L   L+P NC GI +FA    C  L   A  Y + +F+ V  ++ EF+ LP 
Sbjct: 58  VVEACCKFLMKQLHPSNCPGIRSFADAQGCTDLHKVAHNYTMEHFMEV-IRNQEFVLLPA 116

Query: 692 DELNSIILEDEL 727
            E+  ++  D++
Sbjct: 117 SEIAKLLASDDM 128


>AK000088-1|BAA90937.1|  300|Homo sapiens protein ( Homo sapiens
           cDNA FLJ20081 fis, clone COL03242. ).
          Length = 300

 Score = 51.6 bits (118), Expect = 4e-06
 Identities = 27/70 (38%), Positives = 38/70 (54%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           VL+ CC  L S L+P NC+GI  FA    C  L   A +Y+ + F  V  Q++EF  L  
Sbjct: 120 VLKECCAFLESQLDPGNCIGISRFAETYGCRDLYLAATKYICQNFEAVC-QTEEFFELTH 178

Query: 692 DELNSIILED 721
            +L+ I+  D
Sbjct: 179 ADLDEIVSND 188



 Score = 41.9 bits (94), Expect = 0.003
 Identities = 26/95 (27%), Positives = 41/95 (43%), Gaps = 4/95 (4%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD I+R  D      H+ +L++ SPYF A+FT  L  +E S+V    +            
Sbjct: 35  CDIILRVGD-VKIHAHKVVLASVSPYFKAMFTGNLSEKENSEVEFQCIDETALQAFVEYA 93

Query: 435 XXXXIDVTDTNVHELLMTADY----LAFLECFSFV 527
               + ++   V  LL  A+     L   EC +F+
Sbjct: 94  YTGTVFISQDTVESLLPAANLLQIKLVLKECCAFL 128


>BC117487-1|AAI17488.1|  575|Homo sapiens kelch repeat and BTB (POZ)
           domain containing 8 protein.
          Length = 575

 Score = 50.8 bits (116), Expect = 6e-06
 Identities = 26/78 (33%), Positives = 38/78 (48%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXX 437
           D +V  D G +F  HR +L+A SPYF ++FT+ L    Q +V I GV +           
Sbjct: 24  DIVVEVDHGKTFSCHRNVLAAISPYFRSMFTSGLTESTQKEVRIVGVEAESMDLVLNYAY 83

Query: 438 XXXIDVTDTNVHELLMTA 491
              + +T+ NV  L   A
Sbjct: 84  TSRVILTEANVQALFTAA 101



 Score = 46.0 bits (104), Expect = 2e-04
 Identities = 24/76 (31%), Positives = 42/76 (55%)
 Frame = +2

Query: 500 RFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFL 679
           + P +   C  ++ S L+P+N +G+  FA      +L   ++ Y+ + F+ V T+  EFL
Sbjct: 105 QIPSIQDQCAKYMISHLDPQNSIGVFIFADHYGHQELGDRSKEYIRKKFLCV-TKEQEFL 163

Query: 680 HLPLDELNSIILEDEL 727
            L  D+L SI+  D+L
Sbjct: 164 QLTKDQLISILDSDDL 179


>AF385438-1|AAM43839.1|  575|Homo sapiens T-cell activation kelch
           repeat protein protein.
          Length = 575

 Score = 50.8 bits (116), Expect = 6e-06
 Identities = 26/78 (33%), Positives = 38/78 (48%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXX 437
           D +V  D G +F  HR +L+A SPYF ++FT+ L    Q +V I GV +           
Sbjct: 24  DIVVEVDHGKTFSCHRNVLAAISPYFRSMFTSGLTESTQKEVRIVGVEAESMDLVLNYAY 83

Query: 438 XXXIDVTDTNVHELLMTA 491
              + +T+ NV  L   A
Sbjct: 84  TSRVILTEANVQALFTAA 101



 Score = 46.0 bits (104), Expect = 2e-04
 Identities = 24/76 (31%), Positives = 42/76 (55%)
 Frame = +2

Query: 500 RFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFL 679
           + P +   C  ++ S L+P+N +G+  FA      +L   ++ Y+ + F+ V T+  EFL
Sbjct: 105 QIPSIQDQCAKYMISHLDPQNSIGVFIFADHYGHQELGDRSKEYIRKKFLCV-TKEQEFL 163

Query: 680 HLPLDELNSIILEDEL 727
            L  D+L SI+  D+L
Sbjct: 164 QLTKDQLISILDSDDL 179


>BC091648-1|AAH91648.1|  597|Homo sapiens kelch-like 21 (Drosophila)
           protein.
          Length = 597

 Score = 50.4 bits (115), Expect = 8e-06
 Identities = 28/83 (33%), Positives = 35/83 (42%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXX 437
           D  + A  G  FP HRA+L+A SPYF A+F   L       V + GV             
Sbjct: 36  DVTLEAAGGRDFPAHRAVLAAASPYFRAMFAGQLRESRAERVRLHGVPPDMLQLLLDFSY 95

Query: 438 XXXIDVTDTNVHELLMTADYLAF 506
              + V+  N   LL  AD L F
Sbjct: 96  TGRVAVSGDNAEPLLRAADLLQF 118



 Score = 41.5 bits (93), Expect = 0.004
 Identities = 25/78 (32%), Positives = 39/78 (50%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L +FP V + C   L+  L+  NCL +  FA    C  L + A+R++LR+   +  +  E
Sbjct: 115 LLQFPAVKEACGAFLQQQLDLANCLDMQDFAEAFSCSGLASAAQRFILRHVGELGAEQLE 174

Query: 674 FLHLPLDELNSIILEDEL 727
              LPL  L   + +D L
Sbjct: 175 --RLPLARLLRYLRDDGL 190


>BC034039-1|AAH34039.3|  597|Homo sapiens kelch-like 21 (Drosophila)
           protein.
          Length = 597

 Score = 50.4 bits (115), Expect = 8e-06
 Identities = 28/83 (33%), Positives = 35/83 (42%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXX 437
           D  + A  G  FP HRA+L+A SPYF A+F   L       V + GV             
Sbjct: 36  DVTLEAAGGRDFPAHRAVLAAASPYFRAMFAGQLRESRAERVRLHGVPPDMLQLLLDFSY 95

Query: 438 XXXIDVTDTNVHELLMTADYLAF 506
              + V+  N   LL  AD L F
Sbjct: 96  TGRVAVSGDNAEPLLRAADLLQF 118



 Score = 41.5 bits (93), Expect = 0.004
 Identities = 25/78 (32%), Positives = 39/78 (50%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L +FP V + C   L+  L+  NCL +  FA    C  L + A+R++LR+   +  +  E
Sbjct: 115 LLQFPAVKEACGAFLQQQLDLANCLDMQDFAEAFSCSGLASAAQRFILRHVGELGAEQLE 174

Query: 674 FLHLPLDELNSIILEDEL 727
              LPL  L   + +D L
Sbjct: 175 --RLPLARLLRYLRDDGL 190


>AL591866-13|CAI16082.1|  539|Homo sapiens kelch-like 21
           (Drosophila) protein.
          Length = 539

 Score = 50.4 bits (115), Expect = 8e-06
 Identities = 28/83 (33%), Positives = 35/83 (42%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXX 437
           D  + A  G  FP HRA+L+A SPYF A+F   L       V + GV             
Sbjct: 36  DVTLEAAGGRDFPAHRAVLAAASPYFRAMFAGQLRESRAERVRLHGVPPDMLQLLLDFSY 95

Query: 438 XXXIDVTDTNVHELLMTADYLAF 506
              + V+  N   LL  AD L F
Sbjct: 96  TGRVAVSGDNAEPLLRAADLLQF 118



 Score = 41.5 bits (93), Expect = 0.004
 Identities = 25/78 (32%), Positives = 39/78 (50%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L +FP V + C   L+  L+  NCL +  FA    C  L + A+R++LR+   +  +  E
Sbjct: 115 LLQFPAVKEACGAFLQQQLDLANCLDMQDFAEAFSCSGLASAAQRFILRHVGELGAEQLE 174

Query: 674 FLHLPLDELNSIILEDEL 727
              LPL  L   + +D L
Sbjct: 175 --RLPLARLLRYLRDDGL 190


>AL591866-12|CAI16080.1|  597|Homo sapiens kelch-like 21
           (Drosophila) protein.
          Length = 597

 Score = 50.4 bits (115), Expect = 8e-06
 Identities = 28/83 (33%), Positives = 35/83 (42%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXX 437
           D  + A  G  FP HRA+L+A SPYF A+F   L       V + GV             
Sbjct: 36  DVTLEAAGGRDFPAHRAVLAAASPYFRAMFAGQLRESRAERVRLHGVPPDMLQLLLDFSY 95

Query: 438 XXXIDVTDTNVHELLMTADYLAF 506
              + V+  N   LL  AD L F
Sbjct: 96  TGRVAVSGDNAEPLLRAADLLQF 118



 Score = 41.5 bits (93), Expect = 0.004
 Identities = 25/78 (32%), Positives = 39/78 (50%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L +FP V + C   L+  L+  NCL +  FA    C  L + A+R++LR+   +  +  E
Sbjct: 115 LLQFPAVKEACGAFLQQQLDLANCLDMQDFAEAFSCSGLASAAQRFILRHVGELGAEQLE 174

Query: 674 FLHLPLDELNSIILEDEL 727
              LPL  L   + +D L
Sbjct: 175 --RLPLARLLRYLRDDGL 190


>AB007938-1|BAA32314.2|  559|Homo sapiens KIAA0469 protein protein.
          Length = 559

 Score = 50.4 bits (115), Expect = 8e-06
 Identities = 28/83 (33%), Positives = 35/83 (42%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXX 437
           D  + A  G  FP HRA+L+A SPYF A+F   L       V + GV             
Sbjct: 56  DVTLEAAGGRDFPAHRAVLAAASPYFRAMFAGQLRESRAERVRLHGVPPDMLQLLLDFSY 115

Query: 438 XXXIDVTDTNVHELLMTADYLAF 506
              + V+  N   LL  AD L F
Sbjct: 116 TGRVAVSGDNAEPLLRAADLLQF 138



 Score = 41.5 bits (93), Expect = 0.004
 Identities = 25/78 (32%), Positives = 39/78 (50%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L +FP V + C   L+  L+  NCL +  FA    C  L + A+R++LR+   +  +  E
Sbjct: 135 LLQFPAVKEACGAFLQQQLDLANCLDMQDFAEAFSCSGLASAAQRFILRHVGELGAEQLE 194

Query: 674 FLHLPLDELNSIILEDEL 727
              LPL  L   + +D L
Sbjct: 195 --RLPLARLLRYLRDDGL 210


>AK056390-1|BAB71175.1|  564|Homo sapiens protein ( Homo sapiens
           cDNA FLJ31828 fis, clone NT2RP6000109, weakly similar to
           RING CANAL PROTEIN. ).
          Length = 564

 Score = 48.0 bits (109), Expect = 4e-05
 Identities = 24/72 (33%), Positives = 42/72 (58%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V ++C D LR  ++  NCLGI   A  + C +L+A A  ++ ++F T   ++DEFL L +
Sbjct: 107 VKKMCVDFLREQVDASNCLGISVLAECLDCPELKATADDFIHQHF-TEVYKTDEFLQLDV 165

Query: 692 DELNSIILEDEL 727
             +  ++ +D L
Sbjct: 166 KRVTHLLNQDTL 177



 Score = 39.1 bits (87), Expect = 0.021
 Identities = 25/100 (25%), Positives = 42/100 (42%), Gaps = 3/100 (3%)
 Frame = +3

Query: 204 VGGSDAGAPSTARVS---SACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQ 374
           +GG+D     T+ ++   + CD I+   +    P HR +L+A S +F  +FTT +   + 
Sbjct: 2   LGGTDCRTFLTSHINLKKTLCDVILMVQE-RKIPAHRVVLAAASHFFNLMFTTNMLESKS 60

Query: 375 SDVLISGVRSXXXXXXXXXXXXXXIDVTDTNVHELLMTAD 494
            +V +                   I V   NV  LL  A+
Sbjct: 61  FEVELKDAEPDIIEQLVEFAYTARISVNSNNVQSLLDAAN 100


>EF560731-1|ABQ59041.1|  564|Homo sapiens KLHL7 protein protein.
          Length = 564

 Score = 46.8 bits (106), Expect = 1e-04
 Identities = 23/72 (31%), Positives = 42/72 (58%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V ++C D L+  ++  NCLGI   A  + C +L+A A  ++ ++F T   ++DEFL L +
Sbjct: 107 VKKMCVDFLKEQVDASNCLGISVLAECLDCPELKATADDFIHQHF-TEVYKTDEFLQLDV 165

Query: 692 DELNSIILEDEL 727
             +  ++ +D L
Sbjct: 166 KRVTHLLNQDTL 177



 Score = 39.1 bits (87), Expect = 0.021
 Identities = 25/100 (25%), Positives = 42/100 (42%), Gaps = 3/100 (3%)
 Frame = +3

Query: 204 VGGSDAGAPSTARVS---SACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQ 374
           +GG+D     T+ ++   + CD I+   +    P HR +L+A S +F  +FTT +   + 
Sbjct: 2   LGGTDCRTFLTSHINLKKTLCDVILMVQE-RKIPAHRVVLAAASHFFNLMFTTNMLESKS 60

Query: 375 SDVLISGVRSXXXXXXXXXXXXXXIDVTDTNVHELLMTAD 494
            +V +                   I V   NV  LL  A+
Sbjct: 61  FEVELKDAEPDIIEQLVEFAYTARISVNSNNVQSLLDAAN 100


>BC109059-1|AAI09060.1|  604|Homo sapiens kelch-like 15 (Drosophila)
           protein.
          Length = 604

 Score = 46.8 bits (106), Expect = 1e-04
 Identities = 27/110 (24%), Positives = 47/110 (42%)
 Frame = +3

Query: 195 SVHVGGSDAGAPSTARVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQ 374
           S+H     AG  +        D  +  +D   F  H+A+L+  S YF  +FT  +  R+Q
Sbjct: 11  SIHDTSVSAGFRALYEEGLLLDVTLVIEDH-QFQAHKALLATQSDYFRIMFTADMRERDQ 69

Query: 375 SDVLISGVRSXXXXXXXXXXXXXXIDVTDTNVHELLMTADYLAFLECFSF 524
             + + G+ +              I+++   VHE+L  A Y+  +E   F
Sbjct: 70  DKIHLKGLTATGFSHVLQFMYYGTIELSMNTVHEILQAAMYVQLIEVVKF 119


>BC109058-1|AAI09059.1|  604|Homo sapiens kelch-like 15 (Drosophila)
           protein.
          Length = 604

 Score = 46.8 bits (106), Expect = 1e-04
 Identities = 27/110 (24%), Positives = 47/110 (42%)
 Frame = +3

Query: 195 SVHVGGSDAGAPSTARVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQ 374
           S+H     AG  +        D  +  +D   F  H+A+L+  S YF  +FT  +  R+Q
Sbjct: 11  SIHDTSVSAGFRALYEEGLLLDVTLVIEDH-QFQAHKALLATQSDYFRIMFTADMRERDQ 69

Query: 375 SDVLISGVRSXXXXXXXXXXXXXXIDVTDTNVHELLMTADYLAFLECFSF 524
             + + G+ +              I+++   VHE+L  A Y+  +E   F
Sbjct: 70  DKIHLKGLTATGFSHVLQFMYYGTIELSMNTVHEILQAAMYVQLIEVVKF 119


>BC105696-1|AAI05697.1|  376|Homo sapiens KLHL30 protein protein.
          Length = 376

 Score = 46.8 bits (106), Expect = 1e-04
 Identities = 27/76 (35%), Positives = 41/76 (53%)
 Frame = +2

Query: 503 FPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLH 682
           FP V ++C  +L+  L+  NCLGI  F  +     + A A  +L   F  VA + DEFL 
Sbjct: 97  FPSVQKVCGRYLQQQLDAANCLGICEFGEQQGLLGVAAKAWAFLRENFEAVA-REDEFLQ 155

Query: 683 LPLDELNSIILEDELK 730
           LP ++L + +  D L+
Sbjct: 156 LPREQLVTCLAGDLLQ 171



 Score = 33.9 bits (74), Expect = 0.78
 Identities = 21/75 (28%), Positives = 29/75 (38%)
 Frame = +3

Query: 282 GASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTD 461
           G   P HR++L+  SPYF A+F         + V +  V                + +T 
Sbjct: 23  GRELPCHRSLLALSSPYFHAMFAGDFAESFSARVELRDVEPAVVGQLVDFVYTGRLTITQ 82

Query: 462 TNVHELLMTADYLAF 506
            NV  L  TA  L F
Sbjct: 83  GNVEALTRTAARLHF 97


>BC039585-1|AAH39585.1|  586|Homo sapiens kelch-like 7 (Drosophila)
           protein.
          Length = 586

 Score = 46.8 bits (106), Expect = 1e-04
 Identities = 23/72 (31%), Positives = 42/72 (58%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V ++C D L+  ++  NCLGI   A  + C +L+A A  ++ ++F T   ++DEFL L +
Sbjct: 129 VKKMCVDFLKEQVDASNCLGISVLAECLDCPELKATADDFIHQHF-TEVYKTDEFLQLDV 187

Query: 692 DELNSIILEDEL 727
             +  ++ +D L
Sbjct: 188 KRVTHLLNQDTL 199



 Score = 35.1 bits (77), Expect = 0.34
 Identities = 20/80 (25%), Positives = 32/80 (40%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD I+   +    P HR +L+A S +F  +FTT +   +  ++ +               
Sbjct: 44  CDVILMVQE-RKIPAHRVVLAAASHFFNLMFTTNMLESKSFELELKDAEPDIIEQLVEFA 102

Query: 435 XXXXIDVTDTNVHELLMTAD 494
               I V   NV  LL  A+
Sbjct: 103 YTARISVNSNNVQSLLDAAN 122


>BC006534-1|AAH06534.1|  606|Homo sapiens kelch repeat and BTB (POZ)
           domain containing 10 protein.
          Length = 606

 Score = 46.8 bits (106), Expect = 1e-04
 Identities = 25/78 (32%), Positives = 37/78 (47%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXX 437
           D  ++A D  S P HR ILSACSPYF   F + +   ++ +V++  V             
Sbjct: 34  DCTLKAGD-KSLPCHRLILSACSPYFREYFLSEIDEAKKKEVVLDNVDPAILDLIIKYLY 92

Query: 438 XXXIDVTDTNVHELLMTA 491
              ID+ D NV ++   A
Sbjct: 93  SASIDLNDGNVQDIFALA 110


>BC005253-1|AAH05253.1|  230|Homo sapiens KLHL20 protein protein.
          Length = 230

 Score = 46.8 bits (106), Expect = 1e-04
 Identities = 30/86 (34%), Positives = 37/86 (43%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD +V          HR ILSACSPYF A+FT  L    Q++V+I  +            
Sbjct: 68  CD-VVLVVGAKKIYAHRVILSACSPYFRAMFTGELAESRQTEVVIRDIDERAMELLIDFA 126

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLE 512
               I V + NV  LL  A  L   E
Sbjct: 127 YTSQITVEEGNVQTLLPAACLLQLAE 152



 Score = 37.5 bits (83), Expect = 0.063
 Identities = 17/49 (34%), Positives = 26/49 (53%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVA 658
           + + CC+ L+  L+P NCLGI  FA    C +L   A ++    F  V+
Sbjct: 153 IQEACCEFLKRQLDPSNCLGIRAFADTHSCRELLRIADKFTQHNFQEVS 201


>AY028802-1|AAK29099.1|  538|Homo sapiens kelch/BTB protein protein.
          Length = 538

 Score = 46.8 bits (106), Expect = 1e-04
 Identities = 23/72 (31%), Positives = 42/72 (58%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V ++C D L+  ++  NCLGI   A  + C +L+A A  ++ ++F T   ++DEFL L +
Sbjct: 81  VKKMCVDFLKEQVDASNCLGISVLAECLDCPELKATADDFIHQHF-TEVYKTDEFLQLDV 139

Query: 692 DELNSIILEDEL 727
             +  ++ +D L
Sbjct: 140 KRVTHLLNQDTL 151



 Score = 32.7 bits (71), Expect = 1.8
 Identities = 18/67 (26%), Positives = 27/67 (40%)
 Frame = +3

Query: 294 PVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTDTNVH 473
           P HR +L+A S +F  +FTT +   +  +V +                   I V   NV 
Sbjct: 8   PAHRVVLAAASHFFNLMFTTNMLESKSFEVELKDAEPDIIEQLVEFAYTARISVNSNNVQ 67

Query: 474 ELLMTAD 494
            LL  A+
Sbjct: 68  SLLDAAN 74


>AK057298-1|BAB71415.1|  604|Homo sapiens protein ( Homo sapiens
           cDNA FLJ32736 fis, clone TESTI2001237, weakly similar to
           RING CANAL PROTEIN. ).
          Length = 604

 Score = 46.8 bits (106), Expect = 1e-04
 Identities = 27/110 (24%), Positives = 47/110 (42%)
 Frame = +3

Query: 195 SVHVGGSDAGAPSTARVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQ 374
           S+H     AG  +        D  +  +D   F  H+A+L+  S YF  +FT  +  R+Q
Sbjct: 11  SIHDTSVSAGFRALYEEGLLLDVTLVIEDH-QFQAHKALLATQSDYFRIMFTADMRERDQ 69

Query: 375 SDVLISGVRSXXXXXXXXXXXXXXIDVTDTNVHELLMTADYLAFLECFSF 524
             + + G+ +              I+++   VHE+L  A Y+  +E   F
Sbjct: 70  DKIHLKGLTATGFSHVLQFMYYGTIELSMNTVHEILQAAMYVQLIEVVKF 119


>AF333387-1|AAG52886.1|  606|Homo sapiens Kel-like protein 23
           protein.
          Length = 606

 Score = 46.8 bits (106), Expect = 1e-04
 Identities = 25/78 (32%), Positives = 37/78 (47%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXX 437
           D  ++A D  S P HR ILSACSPYF   F + +   ++ +V++  V             
Sbjct: 34  DCTLKAGD-KSLPCHRLILSACSPYFREYFLSEIDEAKKKEVVLDNVDPAILDLIIKYLY 92

Query: 438 XXXIDVTDTNVHELLMTA 491
              ID+ D NV ++   A
Sbjct: 93  SASIDLNDGNVQDIFALA 110


>AF056929-1|AAC13686.1|  596|Homo sapiens sarcosin protein.
          Length = 596

 Score = 46.8 bits (106), Expect = 1e-04
 Identities = 25/78 (32%), Positives = 37/78 (47%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXX 437
           D  ++A D  S P HR ILSACSPYF   F + +   ++ +V++  V             
Sbjct: 24  DCTLKAGD-KSLPCHRLILSACSPYFREYFLSEIDEAKKKEVVLDNVDPAILDLIIKYLY 82

Query: 438 XXXIDVTDTNVHELLMTA 491
              ID+ D NV ++   A
Sbjct: 83  SASIDLNDGNVQDIFALA 100


>AC093899-2|AAY24117.1|  596|Homo sapiens unknown protein.
          Length = 596

 Score = 46.8 bits (106), Expect = 1e-04
 Identities = 25/78 (32%), Positives = 37/78 (47%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXX 437
           D  ++A D  S P HR ILSACSPYF   F + +   ++ +V++  V             
Sbjct: 24  DCTLKAGD-KSLPCHRLILSACSPYFREYFLSEIDEAKKKEVVLDNVDPAILDLIIKYLY 82

Query: 438 XXXIDVTDTNVHELLMTA 491
              ID+ D NV ++   A
Sbjct: 83  SASIDLNDGNVQDIFALA 100


>AK125364-1|BAC86148.1|  298|Homo sapiens protein ( Homo sapiens
           cDNA FLJ43374 fis, clone NTONG2007517, weakly  similar
           to RING CANAL PROTEIN. ).
          Length = 298

 Score = 46.0 bits (104), Expect = 2e-04
 Identities = 27/76 (35%), Positives = 40/76 (52%)
 Frame = +2

Query: 503 FPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLH 682
           FP V ++C  +L+  L+  NCLGI  F  +     + A A  +L   F  VA + DEFL 
Sbjct: 97  FPSVQKVCGRYLQQQLDAANCLGICEFGEQQGLLGVAAKAWAFLRENFEAVA-REDEFLQ 155

Query: 683 LPLDELNSIILEDELK 730
           LP + L + +  D L+
Sbjct: 156 LPRERLVTCLAGDLLQ 171



 Score = 33.5 bits (73), Expect = 1.0
 Identities = 21/75 (28%), Positives = 28/75 (37%)
 Frame = +3

Query: 282 GASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTD 461
           G   P HR +L+  SPYF A+F         + V +  V                + +T 
Sbjct: 23  GRELPCHRGLLALSSPYFHAMFAGDFAESFSARVELRDVEPAVVGQLVDFVYTGRLTITQ 82

Query: 462 TNVHELLMTADYLAF 506
            NV  L  TA  L F
Sbjct: 83  GNVEALTRTAARLHF 97


>AB058745-1|BAB47471.1|  526|Homo sapiens KIAA1842 protein protein.
          Length = 526

 Score = 46.0 bits (104), Expect = 2e-04
 Identities = 24/76 (31%), Positives = 42/76 (55%)
 Frame = +2

Query: 500 RFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFL 679
           + P +   C  ++ S L+P+N +G+  FA      +L   ++ Y+ + F+ V T+  EFL
Sbjct: 56  QIPSIQDQCAKYMISHLDPQNSIGVFIFADHYGHQELGDRSKEYIRKKFLCV-TKEQEFL 114

Query: 680 HLPLDELNSIILEDEL 727
            L  D+L SI+  D+L
Sbjct: 115 QLTKDQLISILDSDDL 130


>BC110491-1|AAI10492.1|  621|Homo sapiens kelch repeat and BTB (POZ)
           domain containing 5 protein.
          Length = 621

 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 25/76 (32%), Positives = 37/76 (48%)
 Frame = +2

Query: 500 RFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFL 679
           + P +  +C   L+  L   NCL +      + C +L   AR ++  +F  VA  +D FL
Sbjct: 112 QIPSIFTICVSFLQKRLCLSNCLAVFRLGLLLDCARLAVAARDFICAHFTLVARDAD-FL 170

Query: 680 HLPLDELNSIILEDEL 727
            L  DEL +II  D L
Sbjct: 171 GLSADELIAIISSDGL 186



 Score = 38.7 bits (86), Expect = 0.027
 Identities = 17/30 (56%), Positives = 21/30 (70%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALF 347
           D +VRA +   FP HR +L+ACSPYF A F
Sbjct: 34  DCVVRAGE-REFPCHRLVLAACSPYFRARF 62


>AY177390-1|AAO06908.1|  621|Homo sapiens sarcosynapsin protein.
          Length = 621

 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 25/76 (32%), Positives = 37/76 (48%)
 Frame = +2

Query: 500 RFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFL 679
           + P +  +C   L+  L   NCL +      + C +L   AR ++  +F  VA  +D FL
Sbjct: 112 QIPSIFTICVSFLQKRLCLSNCLAVFRLGLLLDCARLAVAARDFICAHFTLVARDAD-FL 170

Query: 680 HLPLDELNSIILEDEL 727
            L  DEL +II  D L
Sbjct: 171 GLSADELIAIISSDGL 186



 Score = 38.7 bits (86), Expect = 0.027
 Identities = 17/30 (56%), Positives = 21/30 (70%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALF 347
           D +VRA +   FP HR +L+ACSPYF A F
Sbjct: 34  DCVVRAGE-REFPCHRLVLAACSPYFRARF 62


>AY176040-1|AAO22141.1|  621|Homo sapiens sarcosynapsin protein.
          Length = 621

 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 25/76 (32%), Positives = 37/76 (48%)
 Frame = +2

Query: 500 RFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFL 679
           + P +  +C   L+  L   NCL +      + C +L   AR ++  +F  VA  +D FL
Sbjct: 112 QIPSIFTICVSFLQKRLCLSNCLAVFRLGLLLDCARLAVAARDFICAHFTLVARDAD-FL 170

Query: 680 HLPLDELNSIILEDEL 727
            L  DEL +II  D L
Sbjct: 171 GLSADELIAIISSDGL 186



 Score = 38.7 bits (86), Expect = 0.027
 Identities = 17/30 (56%), Positives = 21/30 (70%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALF 347
           D +VRA +   FP HR +L+ACSPYF A F
Sbjct: 34  DCVVRAGE-REFPCHRLVLAACSPYFRARF 62


>AK056577-1|BAB71222.1|  472|Homo sapiens protein ( Homo sapiens
           cDNA FLJ32015 fis, clone NTONG1000052, weakly similar to
           Rattus norvegicus mRNA for Kelch related protein 1. ).
          Length = 472

 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 25/76 (32%), Positives = 37/76 (48%)
 Frame = +2

Query: 500 RFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFL 679
           + P +  +C   L+  L   NCL +      + C +L   AR ++  +F  VA  +D FL
Sbjct: 112 QIPSIFTICVSFLQKRLCLSNCLAVFRLGLLLDCARLAVAARDFICAHFTLVARDAD-FL 170

Query: 680 HLPLDELNSIILEDEL 727
            L  DEL +II  D L
Sbjct: 171 GLSADELIAIISSDGL 186



 Score = 38.7 bits (86), Expect = 0.027
 Identities = 17/30 (56%), Positives = 21/30 (70%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALF 347
           D +VRA +   FP HR +L+ACSPYF A F
Sbjct: 34  DCVVRAGE-REFPCHRLVLAACSPYFRARF 62


>DQ925701-1|ABI96896.1|  600|Homo sapiens fibroblast-related protein
           protein.
          Length = 600

 Score = 44.8 bits (101), Expect = 4e-04
 Identities = 23/71 (32%), Positives = 33/71 (46%)
 Frame = +3

Query: 279 DGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVT 458
           +G  FP HRA+LSACS YF A+F        +  V I+G+ +              + +T
Sbjct: 73  EGKEFPCHRAVLSACSSYFRAMFCNDHRESREMLVEINGILAEAMECFLQYVYTGKVKIT 132

Query: 459 DTNVHELLMTA 491
             NV  L  T+
Sbjct: 133 TENVQYLFETS 143



 Score = 44.8 bits (101), Expect = 4e-04
 Identities = 27/68 (39%), Positives = 33/68 (48%)
 Frame = +2

Query: 524 CCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPLDELN 703
           C   L   L+P NCLGI  FA       L    + + L+ F  V +Q +EFL L  DEL 
Sbjct: 155 CAKFLEEQLDPCNCLGIQRFADTHSLKTLFTKCKNFALQTFEDV-SQHEEFLELDKDELI 213

Query: 704 SIILEDEL 727
             I  DEL
Sbjct: 214 DYICSDEL 221


>BT007392-1|AAP36056.1|  589|Homo sapiens ectodermal-neural cortex
           (with BTB-like domain) protein.
          Length = 589

 Score = 44.8 bits (101), Expect = 4e-04
 Identities = 23/76 (30%), Positives = 41/76 (53%)
 Frame = +2

Query: 503 FPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLH 682
           F  +   C + L  +L+P NCLG++  +    C KL   + R  L  F T+  ++++FL 
Sbjct: 129 FQDIRDACAEFLEKNLHPTNCLGMLLLSDAHQCTKLYELSWRMCLSNFQTI-RKNEDFLQ 187

Query: 683 LPLDELNSIILEDELK 730
           LP D +  ++  +EL+
Sbjct: 188 LPQDMVVQLLSSEELE 203



 Score = 41.1 bits (92), Expect = 0.005
 Identities = 24/84 (28%), Positives = 39/84 (46%), Gaps = 1/84 (1%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDV-LISGVRSXXXXXXXXXX 434
           D ++ A +  +FP HRA+L+ACS YF A+F+  L   + S+V   + +            
Sbjct: 47  DVLLHAGN-RTFPCHRAVLAACSRYFEAMFSGGLKESQDSEVNFDNSIHPEVLELLLDYA 105

Query: 435 XXXXIDVTDTNVHELLMTADYLAF 506
               + + + N   LL   D L F
Sbjct: 106 YSSRVIINEENAESLLEAGDMLEF 129


>BC142993-1|AAI42994.1|  600|Homo sapiens kelch-like 24 (Drosophila)
           protein.
          Length = 600

 Score = 44.8 bits (101), Expect = 4e-04
 Identities = 23/71 (32%), Positives = 33/71 (46%)
 Frame = +3

Query: 279 DGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVT 458
           +G  FP HRA+LSACS YF A+F        +  V I+G+ +              + +T
Sbjct: 73  EGKEFPCHRAVLSACSSYFRAMFCNDHRESREMLVEINGILAEAMECFLQYVYTGKVKIT 132

Query: 459 DTNVHELLMTA 491
             NV  L  T+
Sbjct: 133 TENVQYLFETS 143



 Score = 44.8 bits (101), Expect = 4e-04
 Identities = 27/68 (39%), Positives = 33/68 (48%)
 Frame = +2

Query: 524 CCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPLDELN 703
           C   L   L+P NCLGI  FA       L    + + L+ F  V +Q +EFL L  DEL 
Sbjct: 155 CAKFLEEQLDPCNCLGIQRFADTHSLKTLFTKCKNFALQTFEDV-SQHEEFLELDKDELI 213

Query: 704 SIILEDEL 727
             I  DEL
Sbjct: 214 DYICSDEL 221


>BC047107-1|AAH47107.1|  623|Homo sapiens kelch repeat and BTB (POZ)
           domain containing 2 protein.
          Length = 623

 Score = 44.8 bits (101), Expect = 4e-04
 Identities = 25/72 (34%), Positives = 39/72 (54%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           VLQ C ++L   +N +NC+ +++FA    C +L+  A+R +   F  V  Q D F+ L  
Sbjct: 116 VLQRCREYLIKKINAENCVRLLSFADLFSCEELKQSAKRMVEHKFTAVYHQ-DAFMQLSH 174

Query: 692 DELNSIILEDEL 727
           D L  I+  D L
Sbjct: 175 DLLIDILSSDNL 186



 Score = 44.0 bits (99), Expect = 7e-04
 Identities = 23/79 (29%), Positives = 38/79 (48%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXX 443
           IV   +G  FP H+ +L+ CS YF A+F + L   +Q+ V +  V +             
Sbjct: 33  IVLIVEGTEFPCHKMVLATCSSYFRAMFMSGLSESKQTHVHLRNVDAATLQIIITYAYTG 92

Query: 444 XIDVTDTNVHELLMTADYL 500
            + + D+ V +L  TA +L
Sbjct: 93  NLAMNDSTVEQLYETACFL 111


>BC000418-1|AAH00418.1|  589|Homo sapiens ectodermal-neural cortex
           (with BTB-like domain) protein.
          Length = 589

 Score = 44.8 bits (101), Expect = 4e-04
 Identities = 23/76 (30%), Positives = 41/76 (53%)
 Frame = +2

Query: 503 FPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLH 682
           F  +   C + L  +L+P NCLG++  +    C KL   + R  L  F T+  ++++FL 
Sbjct: 129 FQDIRDACAEFLEKNLHPTNCLGMLLLSDAHQCTKLYELSWRMCLSNFQTI-RKNEDFLQ 187

Query: 683 LPLDELNSIILEDELK 730
           LP D +  ++  +EL+
Sbjct: 188 LPQDMVVQLLSSEELE 203



 Score = 41.1 bits (92), Expect = 0.005
 Identities = 24/84 (28%), Positives = 39/84 (46%), Gaps = 1/84 (1%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDV-LISGVRSXXXXXXXXXX 434
           D ++ A +  +FP HRA+L+ACS YF A+F+  L   + S+V   + +            
Sbjct: 47  DVLLHAGN-RTFPCHRAVLAACSRYFEAMFSGGLKESQDSEVNFDNSIHPEVLELLLDYA 105

Query: 435 XXXXIDVTDTNVHELLMTADYLAF 506
               + + + N   LL   D L F
Sbjct: 106 YSSRVIINEENAESLLEAGDMLEF 129


>AY422472-1|AAR13703.1|  600|Homo sapiens DRE1 protein protein.
          Length = 600

 Score = 44.8 bits (101), Expect = 4e-04
 Identities = 23/71 (32%), Positives = 33/71 (46%)
 Frame = +3

Query: 279 DGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVT 458
           +G  FP HRA+LSACS YF A+F        +  V I+G+ +              + +T
Sbjct: 73  EGKEFPCHRAVLSACSSYFRAMFCNDHRESREMLVEINGILAEAMECFLQYVYTGKVKIT 132

Query: 459 DTNVHELLMTA 491
             NV  L  T+
Sbjct: 133 TENVQYLFETS 143



 Score = 44.8 bits (101), Expect = 4e-04
 Identities = 27/68 (39%), Positives = 33/68 (48%)
 Frame = +2

Query: 524 CCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPLDELN 703
           C   L   L+P NCLGI  FA       L    + + L+ F  V +Q +EFL L  DEL 
Sbjct: 155 CAKFLEEQLDPCNCLGIQRFADTHSLKTLFTKCKNFALQTFEDV-SQHEEFLELDKDELI 213

Query: 704 SIILEDEL 727
             I  DEL
Sbjct: 214 DYICSDEL 221


>AK026326-1|BAB15447.1|  403|Homo sapiens protein ( Homo sapiens
           cDNA: FLJ22673 fis, clone HSI10503. ).
          Length = 403

 Score = 44.8 bits (101), Expect = 4e-04
 Identities = 23/71 (32%), Positives = 33/71 (46%)
 Frame = +3

Query: 279 DGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVT 458
           +G  FP HRA+LSACS YF A+F        +  V I+G+ +              + +T
Sbjct: 73  EGKEFPCHRAVLSACSSYFRAMFCNDHRESREMLVEINGILAEAMECFLQYVYTGKVKIT 132

Query: 459 DTNVHELLMTA 491
             NV  L  T+
Sbjct: 133 TENVQYLFETS 143



 Score = 39.1 bits (87), Expect = 0.021
 Identities = 23/59 (38%), Positives = 29/59 (49%)
 Frame = +2

Query: 524 CCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPLDEL 700
           C   L   L+P NCLGI  FA       L    + + L+ F  V +Q +EFL L  DEL
Sbjct: 155 CAKFLEEQLDPCNCLGIQRFADTHSLKTLFTKCKNFALQTFEDV-SQHEEFLELDKDEL 212


>AK000066-1|BAA90921.1|  421|Homo sapiens protein ( Homo sapiens
           cDNA FLJ20059 fis, clone COL01349. ).
          Length = 421

 Score = 44.8 bits (101), Expect = 4e-04
 Identities = 27/68 (39%), Positives = 33/68 (48%)
 Frame = +2

Query: 524 CCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPLDELN 703
           C   L   L+P NCLGI  FA       L    + + L+ F  V +Q +EFL L  DEL 
Sbjct: 39  CAKFLEEQLDPCNCLGIQRFADTHSLKTLFTKCKNFALQTFEDV-SQHEEFLELDKDELI 97

Query: 704 SIILEDEL 727
             I  DEL
Sbjct: 98  DYICSDEL 105


>AF059611-1|AAC26109.1|  589|Homo sapiens nuclear matrix protein
           NRP/B protein.
          Length = 589

 Score = 44.8 bits (101), Expect = 4e-04
 Identities = 23/76 (30%), Positives = 41/76 (53%)
 Frame = +2

Query: 503 FPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLH 682
           F  +   C + L  +L+P NCLG++  +    C KL   + R  L  F T+  ++++FL 
Sbjct: 129 FQDIRDACAEFLEKNLHPTNCLGMLLLSDAHQCTKLYELSWRMCLSNFQTI-RKNEDFLQ 187

Query: 683 LPLDELNSIILEDELK 730
           LP D +  ++  +EL+
Sbjct: 188 LPQDMVVQLLSSEELE 203



 Score = 41.1 bits (92), Expect = 0.005
 Identities = 24/84 (28%), Positives = 39/84 (46%), Gaps = 1/84 (1%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDV-LISGVRSXXXXXXXXXX 434
           D ++ A +  +FP HRA+L+ACS YF A+F+  L   + S+V   + +            
Sbjct: 47  DVLLHAGN-RTFPCHRAVLAACSRYFEAMFSGGLKESQDSEVNFDNSIHPEVLELLLDYA 105

Query: 435 XXXXIDVTDTNVHELLMTADYLAF 506
               + + + N   LL   D L F
Sbjct: 106 YSSRVIINEENAESLLEAGDMLEF 129


>AF010314-1|AAC39532.1|  516|Homo sapiens Pig10 protein.
          Length = 516

 Score = 44.8 bits (101), Expect = 4e-04
 Identities = 23/76 (30%), Positives = 41/76 (53%)
 Frame = +2

Query: 503 FPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLH 682
           F  +   C + L  +L+P NCLG++  +    C KL   + R  L  F T+  ++++FL 
Sbjct: 132 FKDIRDACAEFLEKNLHPTNCLGMLLLSDAHQCTKLYELSWRMCLSNFQTI-RKNEDFLQ 190

Query: 683 LPLDELNSIILEDELK 730
           LP D +  ++  +EL+
Sbjct: 191 LPQDMVVQLLSSEELE 206



 Score = 39.1 bits (87), Expect = 0.021
 Identities = 18/42 (42%), Positives = 28/42 (66%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDV 383
           D ++ A +  +FP HRA+L+ACS YF A+F+  L   + S+V
Sbjct: 47  DVLLHAGN-RTFPCHRAVLAACSRYFEAMFSGGLKESQDSEV 87


>AF005381-1|AAC64498.1|  589|Homo sapiens ectoderm-neural cortex-1
           protein protein.
          Length = 589

 Score = 44.8 bits (101), Expect = 4e-04
 Identities = 23/76 (30%), Positives = 41/76 (53%)
 Frame = +2

Query: 503 FPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLH 682
           F  +   C + L  +L+P NCLG++  +    C KL   + R  L  F T+  ++++FL 
Sbjct: 129 FQDIRDACAEFLEKNLHPTNCLGMLLLSDAHQCTKLYELSWRMCLSNFQTI-RKNEDFLQ 187

Query: 683 LPLDELNSIILEDELK 730
           LP D +  ++  +EL+
Sbjct: 188 LPQDMVVQLLSSEELE 203



 Score = 41.1 bits (92), Expect = 0.005
 Identities = 24/84 (28%), Positives = 39/84 (46%), Gaps = 1/84 (1%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDV-LISGVRSXXXXXXXXXX 434
           D ++ A +  +FP HRA+L+ACS YF A+F+  L   + S+V   + +            
Sbjct: 47  DVLLHAGN-RTFPCHRAVLAACSRYFEAMFSGGLKESQDSEVNFDNSIHPEVLELLLDYA 105

Query: 435 XXXXIDVTDTNVHELLMTADYLAF 506
               + + + N   LL   D L F
Sbjct: 106 YSSRVIINEENAESLLEAGDMLEF 129


>AB040922-1|BAA96013.1|  511|Homo sapiens KIAA1489 protein protein.
          Length = 511

 Score = 44.8 bits (101), Expect = 4e-04
 Identities = 25/72 (34%), Positives = 39/72 (54%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           VLQ C ++L   +N +NC+ +++FA    C +L+  A+R +   F  V  Q D F+ L  
Sbjct: 4   VLQRCREYLIKKINAENCVRLLSFADLFSCEELKQSAKRMVEHKFTAVYHQ-DAFMQLSH 62

Query: 692 DELNSIILEDEL 727
           D L  I+  D L
Sbjct: 63  DLLIDILSSDNL 74


>BC127886-1|AAI27887.1|  581|Homo sapiens C8ORFK36 protein protein.
          Length = 581

 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 20/57 (35%), Positives = 31/57 (54%)
 Frame = +2

Query: 500 RFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSD 670
           +FP + + C  +L+S L P NCLG++  +  + C  L+  AR   L  F  VA  +D
Sbjct: 115 QFPKLFEACSSYLQSQLAPSNCLGMIRLSEILSCETLKKKAREVALTSFPEVAASAD 171



 Score = 36.3 bits (80), Expect = 0.15
 Identities = 18/75 (24%), Positives = 33/75 (44%)
 Frame = +3

Query: 294 PVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTDTNVH 473
           P HR +L++ SPYF A+F ++   + ++ V + G+                  +   NV 
Sbjct: 46  PCHRNVLASSSPYFRAMFCSSFREKSEAKVQLKGIDPPTLDQIVSYVYTGEARIATDNVL 105

Query: 474 ELLMTADYLAFLECF 518
            ++  A  L F + F
Sbjct: 106 PVMEAASMLQFPKLF 120


>AB196636-1|BAE53438.1|  581|Homo sapiens C8orfK36 protein protein.
          Length = 581

 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 20/57 (35%), Positives = 31/57 (54%)
 Frame = +2

Query: 500 RFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSD 670
           +FP + + C  +L+S L P NCLG++  +  + C  L+  AR   L  F  VA  +D
Sbjct: 115 QFPKLFEACSSYLQSQLAPSNCLGMIRLSEILSCETLKKKAREVALTSFPEVAASAD 171



 Score = 36.7 bits (81), Expect = 0.11
 Identities = 18/75 (24%), Positives = 33/75 (44%)
 Frame = +3

Query: 294 PVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTDTNVH 473
           P HR +L++ SPYF A+F ++   + ++ V + G+                  +   NV 
Sbjct: 46  PCHRNVLASSSPYFRAMFCSSFREKSEAKVQLKGIDPPTLDQIVSYVYTGEAHIATDNVL 105

Query: 474 ELLMTADYLAFLECF 518
            ++  A  L F + F
Sbjct: 106 PVMEAASMLQFPKLF 120


>BC113513-1|AAI13514.1|  617|Homo sapiens kelch-like 9 (Drosophila)
           protein.
          Length = 617

 Score = 44.0 bits (99), Expect = 7e-04
 Identities = 24/94 (25%), Positives = 41/94 (43%), Gaps = 1/94 (1%)
 Frame = +3

Query: 255 CDAIVRADDGAS-FPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXX 431
           CD  +   DG   FPVHRA++++ S YF A+FT  +  ++   + + GV           
Sbjct: 50  CDVTLVPGDGDEIFPVHRAMMASASDYFKAMFTGGMKEQDLMCIKLHGVNKVGLKKIIDF 109

Query: 432 XXXXXIDVTDTNVHELLMTADYLAFLECFSFVAI 533
                + +   N+ + L  A +L  L    F  +
Sbjct: 110 IYTAKLSLNMDNLQDTLEAASFLQILPVLDFCKV 143


>BC113511-1|AAI13512.1|  584|Homo sapiens zinc finger and BTB domain
           containing 7A protein.
          Length = 584

 Score = 44.0 bits (99), Expect = 7e-04
 Identities = 25/82 (30%), Positives = 39/82 (47%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++  + G  FP HR++L+ACS YF  LFT+     +Q+   I  V +          
Sbjct: 34  CDVVILVE-GREFPTHRSVLAACSQYFKKLFTSGAVVDQQNVYEIDFVSAEALTALMDFA 92

Query: 435 XXXXIDVTDTNVHELLMTADYL 500
               + V+  NV ++L  A  L
Sbjct: 93  YTATLTVSTANVGDILSAARLL 114


>BC105008-1|AAI05009.1|  617|Homo sapiens kelch-like 9 (Drosophila)
           protein.
          Length = 617

 Score = 44.0 bits (99), Expect = 7e-04
 Identities = 24/94 (25%), Positives = 41/94 (43%), Gaps = 1/94 (1%)
 Frame = +3

Query: 255 CDAIVRADDGAS-FPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXX 431
           CD  +   DG   FPVHRA++++ S YF A+FT  +  ++   + + GV           
Sbjct: 50  CDVTLVPGDGDEIFPVHRAMMASASDYFKAMFTGGMKEQDLMCIKLHGVNKVGLKKIIDF 109

Query: 432 XXXXXIDVTDTNVHELLMTADYLAFLECFSFVAI 533
                + +   N+ + L  A +L  L    F  +
Sbjct: 110 IYTAKLSLNMDNLQDTLEAASFLQILPVLDFCKV 143


>BC084568-1|AAH84568.1|  584|Homo sapiens ZBTB7A protein protein.
          Length = 584

 Score = 44.0 bits (99), Expect = 7e-04
 Identities = 25/82 (30%), Positives = 39/82 (47%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++  + G  FP HR++L+ACS YF  LFT+     +Q+   I  V +          
Sbjct: 34  CDVVILVE-GREFPTHRSVLAACSQYFKKLFTSGAVVDQQNVYEIDFVSAEALTALMDFA 92

Query: 435 XXXXIDVTDTNVHELLMTADYL 500
               + V+  NV ++L  A  L
Sbjct: 93  YTATLTVSTANVGDILSAARLL 114


>BC039133-1|AAH39133.1|  617|Homo sapiens kelch-like 9 (Drosophila)
           protein.
          Length = 617

 Score = 44.0 bits (99), Expect = 7e-04
 Identities = 24/94 (25%), Positives = 41/94 (43%), Gaps = 1/94 (1%)
 Frame = +3

Query: 255 CDAIVRADDGAS-FPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXX 431
           CD  +   DG   FPVHRA++++ S YF A+FT  +  ++   + + GV           
Sbjct: 50  CDVTLVPGDGDEIFPVHRAMMASASDYFKAMFTGGMKEQDLMCIKLHGVNKVGLKKIIDF 109

Query: 432 XXXXXIDVTDTNVHELLMTADYLAFLECFSFVAI 533
                + +   N+ + L  A +L  L    F  +
Sbjct: 110 IYTAKLSLNMDNLQDTLEAASFLQILPVLDFCKV 143


>BC037887-1|AAH37887.1|  623|Homo sapiens kelch repeat and BTB (POZ)
           domain containing 2 protein.
          Length = 623

 Score = 44.0 bits (99), Expect = 7e-04
 Identities = 23/79 (29%), Positives = 38/79 (48%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXX 443
           IV   +G  FP H+ +L+ CS YF A+F + L   +Q+ V +  V +             
Sbjct: 33  IVLIVEGTEFPCHKMVLATCSSYFRAMFMSGLSESKQTHVHLRNVDAATLQIIITYAYTG 92

Query: 444 XIDVTDTNVHELLMTADYL 500
            + + D+ V +L  TA +L
Sbjct: 93  NLAMNDSTVEQLYETACFL 111



 Score = 44.0 bits (99), Expect = 7e-04
 Identities = 23/72 (31%), Positives = 39/72 (54%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           VLQ C ++L   +N +NC+ +++FA    C +L+  A+R ++ +  T     D F+ L  
Sbjct: 116 VLQRCREYLIKKINAENCVRLLSFADLFSCEELKQSAKR-MVEHKFTAVYHKDAFMQLSH 174

Query: 692 DELNSIILEDEL 727
           D L  I+  D L
Sbjct: 175 DLLIDILSSDNL 186


>AL162420-7|CAH73191.1|  617|Homo sapiens kelch-like 9 (Drosophila)
           protein.
          Length = 617

 Score = 44.0 bits (99), Expect = 7e-04
 Identities = 24/94 (25%), Positives = 41/94 (43%), Gaps = 1/94 (1%)
 Frame = +3

Query: 255 CDAIVRADDGAS-FPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXX 431
           CD  +   DG   FPVHRA++++ S YF A+FT  +  ++   + + GV           
Sbjct: 50  CDVTLVPGDGDEIFPVHRAMMASASDYFKAMFTGGMKEQDLMCIKLHGVNKVGLKKIIDF 109

Query: 432 XXXXXIDVTDTNVHELLMTADYLAFLECFSFVAI 533
                + +   N+ + L  A +L  L    F  +
Sbjct: 110 IYTAKLSLNMDNLQDTLEAASFLQILPVLDFCKV 143


>AF151831-1|AAD34068.1|  335|Homo sapiens CGI-73 protein protein.
          Length = 335

 Score = 44.0 bits (99), Expect = 7e-04
 Identities = 23/79 (29%), Positives = 38/79 (48%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXX 443
           IV   +G  FP H+ +L+ CS YF A+F + L   +Q+ V +  V +             
Sbjct: 33  IVLIVEGTEFPCHKMVLATCSSYFRAMFMSGLSESKQTHVHLRNVDAATLQIIITYAYTG 92

Query: 444 XIDVTDTNVHELLMTADYL 500
            + + D+ V +L  TA +L
Sbjct: 93  NLAMNDSTVEQLYETACFL 111



 Score = 40.7 bits (91), Expect = 0.007
 Identities = 24/72 (33%), Positives = 37/72 (51%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           VLQ C ++L   +N +NC+ +++FA    C +L+  A+R +   F  V  Q   F+ L  
Sbjct: 116 VLQRCREYLIKKINAENCVRLLSFADLFSCEELKQSAKRMVEHKFTAVYHQV-AFMQLSH 174

Query: 692 DELNSIILEDEL 727
           D L  I   D L
Sbjct: 175 DLLIDIFSSDNL 186


>AF097916-1|AAC72973.1|  584|Homo sapiens HIV-1 inducer of short
           transcripts binding protein protein.
          Length = 584

 Score = 44.0 bits (99), Expect = 7e-04
 Identities = 25/82 (30%), Positives = 39/82 (47%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++  + G  FP HR++L+ACS YF  LFT+     +Q+   I  V +          
Sbjct: 34  CDVVILVE-GREFPTHRSVLAACSQYFKKLFTSGAVVDQQNVYEIDFVSAEALTALMDFA 92

Query: 435 XXXXIDVTDTNVHELLMTADYL 500
               + V+  NV ++L  A  L
Sbjct: 93  YTATLTVSTANVGDILSAARLL 114


>AF000561-1|AAB58414.1|  590|Homo sapiens TTF-I interacting peptide
           21 protein.
          Length = 590

 Score = 44.0 bits (99), Expect = 7e-04
 Identities = 25/82 (30%), Positives = 39/82 (47%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++  + G  FP HR++L+ACS YF  LFT+     +Q+   I  V +          
Sbjct: 86  CDVVILVE-GREFPTHRSVLAACSQYFKKLFTSGAVVDQQNVYEIDFVSAEALTALMDFA 144

Query: 435 XXXXIDVTDTNVHELLMTADYL 500
               + V+  NV ++L  A  L
Sbjct: 145 YTATLTVSTANVGDILSAARLL 166


>AB037775-1|BAA92592.1|  632|Homo sapiens KIAA1354 protein protein.
          Length = 632

 Score = 44.0 bits (99), Expect = 7e-04
 Identities = 24/94 (25%), Positives = 41/94 (43%), Gaps = 1/94 (1%)
 Frame = +3

Query: 255 CDAIVRADDGAS-FPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXX 431
           CD  +   DG   FPVHRA++++ S YF A+FT  +  ++   + + GV           
Sbjct: 65  CDVTLVPGDGDEIFPVHRAMMASASDYFKAMFTGGMKEQDLMCIKLHGVNKVGLKKIIDF 124

Query: 432 XXXXXIDVTDTNVHELLMTADYLAFLECFSFVAI 533
                + +   N+ + L  A +L  L    F  +
Sbjct: 125 IYTAKLSLNMDNLQDTLEAASFLQILPVLDFCKV 158


>EF633513-1|ABR23528.1|  634|Homo sapiens kelch-like 31 protein.
          Length = 634

 Score = 43.6 bits (98), Expect = 0.001
 Identities = 17/73 (23%), Positives = 45/73 (61%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           ++++C D L   ++ +NC+ ++  A        +A A++++   F+  A +SD+F+ L  
Sbjct: 155 LVKMCSDFLIREMSVENCMYVVNIAETYSLKNAKAAAQKFIRDNFLEFA-ESDQFMKLTF 213

Query: 692 DELNSIILEDELK 730
           +++N ++++D+L+
Sbjct: 214 EQINELLIDDDLQ 226


>AY172949-1|AAO39718.1|  617|Homo sapiens KLHL9 protein protein.
          Length = 617

 Score = 43.6 bits (98), Expect = 0.001
 Identities = 24/94 (25%), Positives = 41/94 (43%), Gaps = 1/94 (1%)
 Frame = +3

Query: 255 CDAIVRADDGAS-FPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXX 431
           CD  +   DG   FPVHRA++++ S YF A+FT  +  ++   + + GV           
Sbjct: 50  CDVTLVPGDGDEIFPVHRAMMASASDYFKAMFTGGMKEQDLMCIKLHGVNKVGLKKIIDF 109

Query: 432 XXXXXIDVTDTNVHELLMTADYLAFLECFSFVAI 533
                + +   N+ + L  A +L  L    F  +
Sbjct: 110 IYTAKLSLNMDNLQDTLEAAGFLQILPVLDFCKV 143


>AL157773-1|CAC16284.1|  634|Homo sapiens kelch-like 31 (Drosophila)
           protein.
          Length = 634

 Score = 43.6 bits (98), Expect = 0.001
 Identities = 17/73 (23%), Positives = 45/73 (61%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           ++++C D L   ++ +NC+ ++  A        +A A++++   F+  A +SD+F+ L  
Sbjct: 155 LVKMCSDFLIREMSVENCMYVVNIAETYSLKNAKAAAQKFIRDNFLEFA-ESDQFMKLTF 213

Query: 692 DELNSIILEDELK 730
           +++N ++++D+L+
Sbjct: 214 EQINELLIDDDLQ 226


>CR456613-1|CAG30499.1|  641|Homo sapiens ZNF278 protein.
          Length = 641

 Score = 42.7 bits (96), Expect = 0.002
 Identities = 18/35 (51%), Positives = 25/35 (71%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTL 359
           CD ++R  D  SFP HRA+L+ACS YF ++F+  L
Sbjct: 41  CDVLLRVGD-ESFPAHRAVLAACSEYFESVFSAQL 74


>BC021091-1|AAH21091.1|  537|Homo sapiens POZ (BTB) and AT hook
           containing zinc finger 1 protein.
          Length = 537

 Score = 42.7 bits (96), Expect = 0.002
 Identities = 18/35 (51%), Positives = 25/35 (71%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTL 359
           CD ++R  D  SFP HRA+L+ACS YF ++F+  L
Sbjct: 41  CDVLLRVGD-ESFPAHRAVLAACSEYFESVFSAQL 74


>BC013922-1|AAH13922.1|  378|Homo sapiens BTB (POZ) domain
           containing 8 protein.
          Length = 378

 Score = 42.7 bits (96), Expect = 0.002
 Identities = 33/98 (33%), Positives = 41/98 (41%), Gaps = 1/98 (1%)
 Frame = +3

Query: 243 VSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXX 422
           V   C  I    DG  F  HRAILSA S YF A+ +       Q  V + G+        
Sbjct: 201 VKPGCPDIDIFVDGKRFKAHRAILSARSSYFAAMLSGCWAESSQEYVTLQGISHVELNVM 260

Query: 423 XXXXXXXXIDVTD-TNVHELLMTADYLAFLECFSFVAI 533
                   +D+ D TNV ++L  AD    LE    VAI
Sbjct: 261 MHFIYGGTLDIPDKTNVGQILNMADMYG-LEGLKEVAI 297


>AY028384-1|AAK19024.1|  641|Homo sapiens BTB-POZ domain zinc finger
           transcription factor protein.
          Length = 641

 Score = 42.7 bits (96), Expect = 0.002
 Identities = 18/35 (51%), Positives = 25/35 (71%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTL 359
           CD ++R  D  SFP HRA+L+ACS YF ++F+  L
Sbjct: 41  CDVLLRVGD-ESFPAHRAVLAACSEYFESVFSAQL 74


>AL096880-1|CAB51404.1|  616|Homo sapiens hypothetical protein
           protein.
          Length = 616

 Score = 42.7 bits (96), Expect = 0.002
 Identities = 18/35 (51%), Positives = 25/35 (71%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTL 359
           CD ++R  D  SFP HRA+L+ACS YF ++F+  L
Sbjct: 16  CDVLLRVGD-ESFPAHRAVLAACSEYFESVFSAQL 49


>AF254085-1|AAG09034.1|  687|Homo sapiens zinc finger sarcoma gene
           long C isoform protein.
          Length = 687

 Score = 42.7 bits (96), Expect = 0.002
 Identities = 18/35 (51%), Positives = 25/35 (71%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTL 359
           CD ++R  D  SFP HRA+L+ACS YF ++F+  L
Sbjct: 41  CDVLLRVGD-ESFPAHRAVLAACSEYFESVFSAQL 74


>AF254084-1|AAG09033.1|  537|Homo sapiens zinc finger sarcoma gene
           long B isoform protein.
          Length = 537

 Score = 42.7 bits (96), Expect = 0.002
 Identities = 18/35 (51%), Positives = 25/35 (71%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTL 359
           CD ++R  D  SFP HRA+L+ACS YF ++F+  L
Sbjct: 41  CDVLLRVGD-ESFPAHRAVLAACSEYFESVFSAQL 74


>AF254083-1|AAG09032.1|  641|Homo sapiens zinc finger sarcoma gene
           long A isoform protein.
          Length = 641

 Score = 42.7 bits (96), Expect = 0.002
 Identities = 18/35 (51%), Positives = 25/35 (71%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTL 359
           CD ++R  D  SFP HRA+L+ACS YF ++F+  L
Sbjct: 41  CDVLLRVGD-ESFPAHRAVLAACSEYFESVFSAQL 74


>AF254082-1|AAG09031.1|  537|Homo sapiens zinc finger sarcoma gene
           short isoform protein.
          Length = 537

 Score = 42.7 bits (96), Expect = 0.002
 Identities = 18/35 (51%), Positives = 25/35 (71%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTL 359
           CD ++R  D  SFP HRA+L+ACS YF ++F+  L
Sbjct: 41  CDVLLRVGD-ESFPAHRAVLAACSEYFESVFSAQL 74


>AF242522-1|AAF99602.1|  424|Homo sapiens krueppel-related zinc
           finger protein SBZF5 protein.
          Length = 424

 Score = 42.7 bits (96), Expect = 0.002
 Identities = 18/35 (51%), Positives = 25/35 (71%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTL 359
           CD ++R  D  SFP HRA+L+ACS YF ++F+  L
Sbjct: 41  CDVLLRVGD-ESFPAHRAVLAACSEYFESVFSAQL 74


>AC005003-1|AAF01349.1|  641|Homo sapiens WUGSC:H_DJ400N23.1
           protein.
          Length = 641

 Score = 42.7 bits (96), Expect = 0.002
 Identities = 18/35 (51%), Positives = 25/35 (71%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTL 359
           CD ++R  D  SFP HRA+L+ACS YF ++F+  L
Sbjct: 41  CDVLLRVGD-ESFPAHRAVLAACSEYFESVFSAQL 74


>AB208787-1|BAD92024.1|  651|Homo sapiens zinc finger protein 278
           long A isoform variant protein.
          Length = 651

 Score = 42.7 bits (96), Expect = 0.002
 Identities = 18/35 (51%), Positives = 25/35 (71%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTL 359
           CD ++R  D  SFP HRA+L+ACS YF ++F+  L
Sbjct: 51  CDVLLRVGD-ESFPAHRAVLAACSEYFESVFSAQL 84


>CR456352-1|CAG30238.1|  634|Homo sapiens Em:AC005500.4 protein.
          Length = 634

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 20/77 (25%), Positives = 42/77 (54%)
 Frame = +2

Query: 500 RFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFL 679
           + P ++  CCD L S ++ +N L +   A      +L      Y+L+ FV   +++D++ 
Sbjct: 131 QIPEIIHFCCDFLMSWVDEENILDVYRLAELFDLSRLTEQLDTYILKNFVAF-SRTDKYR 189

Query: 680 HLPLDELNSIILEDELK 730
            LPL+++ S++  + L+
Sbjct: 190 QLPLEKVYSLLSSNRLE 206



 Score = 40.7 bits (91), Expect = 0.007
 Identities = 25/87 (28%), Positives = 37/87 (42%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXX 443
           +V   +G     HR +L+A   YF  +F   L   EQ +VLI GV               
Sbjct: 52  VVLVVEGRHIEAHRILLAASCDYFRGMFAGGLKEMEQEEVLIHGVSYNAMCQILHFIYTS 111

Query: 444 XIDVTDTNVHELLMTADYLAFLECFSF 524
            ++++ +NV E L+ A  L   E   F
Sbjct: 112 ELELSLSNVQETLVAACQLQIPEIIHF 138


>BC028100-1|AAH28100.1|  589|Homo sapiens KLHL25 protein protein.
          Length = 589

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 27/77 (35%), Positives = 39/77 (50%)
 Frame = +2

Query: 500 RFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFL 679
           +F  V     + L  +L P NCLG+M  +    C +L   + R  L +F TV  QS++F 
Sbjct: 128 QFHDVRDAAAEFLEKNLFPSNCLGMMLLSDAHQCRRLYEFSWRMCLVHFETV-RQSEDFN 186

Query: 680 HLPLDELNSIILEDELK 730
            L  D L  +I  DEL+
Sbjct: 187 SLSKDTLLDLISSDELE 203



 Score = 35.5 bits (78), Expect = 0.25
 Identities = 26/84 (30%), Positives = 36/84 (42%), Gaps = 1/84 (1%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFTTTL-HSREQSDVLISGVRSXXXXXXXXXX 434
           D  + A D A FP HRA+L+A S YF A+F+  L  SR+ +      +            
Sbjct: 47  DVTLWAGDRA-FPCHRAVLAASSRYFEAMFSHGLRESRDDTVNFQDNLHPEVLELLLDFA 105

Query: 435 XXXXIDVTDTNVHELLMTADYLAF 506
               I + + N   LL   D L F
Sbjct: 106 YSSRIAINEENAESLLEAGDMLQF 129


>BC015923-1|AAH15923.1|  634|Homo sapiens kelch-like 22 (Drosophila)
           protein.
          Length = 634

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 20/77 (25%), Positives = 42/77 (54%)
 Frame = +2

Query: 500 RFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFL 679
           + P ++  CCD L S ++ +N L +   A      +L      Y+L+ FV   +++D++ 
Sbjct: 131 QIPEIIHFCCDFLMSWVDEENILDVYRLAELFDLSRLTEQLDTYILKNFVAF-SRTDKYR 189

Query: 680 HLPLDELNSIILEDELK 730
            LPL+++ S++  + L+
Sbjct: 190 QLPLEKVYSLLSSNRLE 206



 Score = 40.7 bits (91), Expect = 0.007
 Identities = 25/87 (28%), Positives = 37/87 (42%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXX 443
           +V   +G     HR +L+A   YF  +F   L   EQ +VLI GV               
Sbjct: 52  VVLVVEGRHIEAHRILLAASCDYFRGMFAGGLKEMEQEEVLIHGVSYNAMCQILHFIYTS 111

Query: 444 XIDVTDTNVHELLMTADYLAFLECFSF 524
            ++++ +NV E L+ A  L   E   F
Sbjct: 112 ELELSLSNVQETLVAACQLQIPEIIHF 138


>AY764034-1|AAV51405.1|  589|Homo sapiens ENC2 protein.
          Length = 589

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 27/77 (35%), Positives = 39/77 (50%)
 Frame = +2

Query: 500 RFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFL 679
           +F  V     + L  +L P NCLG+M  +    C +L   + R  L +F TV  QS++F 
Sbjct: 128 QFHDVRDAAAEFLEKNLFPSNCLGMMLLSDAHQCRRLYEFSWRMCLVHFETV-RQSEDFN 186

Query: 680 HLPLDELNSIILEDELK 730
            L  D L  +I  DEL+
Sbjct: 187 SLSKDTLLDLISSDELE 203



 Score = 35.5 bits (78), Expect = 0.25
 Identities = 26/84 (30%), Positives = 36/84 (42%), Gaps = 1/84 (1%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFTTTL-HSREQSDVLISGVRSXXXXXXXXXX 434
           D  + A D A FP HRA+L+A S YF A+F+  L  SR+ +      +            
Sbjct: 47  DVTLWAGDRA-FPCHRAVLAASSRYFEAMFSHGLRESRDDTVNFQDNLHPEVLELLLDFA 105

Query: 435 XXXXIDVTDTNVHELLMTADYLAF 506
               I + + N   LL   D L F
Sbjct: 106 YSSRIAINEENAESLLEAGDMLQF 129


>AL136796-1|CAB66730.1|  589|Homo sapiens hypothetical protein
           protein.
          Length = 589

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 27/77 (35%), Positives = 39/77 (50%)
 Frame = +2

Query: 500 RFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFL 679
           +F  V     + L  +L P NCLG+M  +    C +L   + R  L +F TV  QS++F 
Sbjct: 128 QFHDVRDAAAEFLEKNLFPSNCLGMMLLSDAHQCRRLYEFSWRMCLVHFETV-RQSEDFN 186

Query: 680 HLPLDELNSIILEDELK 730
            L  D L  +I  DEL+
Sbjct: 187 SLSKDTLLDLISSDELE 203



 Score = 35.5 bits (78), Expect = 0.25
 Identities = 26/84 (30%), Positives = 36/84 (42%), Gaps = 1/84 (1%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFTTTL-HSREQSDVLISGVRSXXXXXXXXXX 434
           D  + A D A FP HRA+L+A S YF A+F+  L  SR+ +      +            
Sbjct: 47  DVTLWAGDRA-FPCHRAVLAASSRYFEAMFSHGLRESRDDTVNFQDNLHPEVLELLLDFA 105

Query: 435 XXXXIDVTDTNVHELLMTADYLAF 506
               I + + N   LL   D L F
Sbjct: 106 YSSRIAINEENAESLLEAGDMLQF 129


>AK222850-1|BAD96570.1|  634|Homo sapiens kelch-like variant
           protein.
          Length = 634

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 20/77 (25%), Positives = 42/77 (54%)
 Frame = +2

Query: 500 RFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFL 679
           + P ++  CCD L S ++ +N L +   A      +L      Y+L+ FV   +++D++ 
Sbjct: 131 QIPEIIHFCCDFLMSWVDEENILDVYRLAELFDLSRLTEQLDTYILKNFVAF-SRTDKYR 189

Query: 680 HLPLDELNSIILEDELK 730
            LPL+++ S++  + L+
Sbjct: 190 QLPLEKVYSLLSSNRLE 206



 Score = 40.7 bits (91), Expect = 0.007
 Identities = 25/87 (28%), Positives = 37/87 (42%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXX 443
           +V   +G     HR +L+A   YF  +F   L   EQ +VLI GV               
Sbjct: 52  VVLVVEGRHIEAHRILLAASCDYFRGMFAGGLKEMEQEEVLIHGVSYNAMCQILHFIYTS 111

Query: 444 XIDVTDTNVHELLMTADYLAFLECFSF 524
            ++++ +NV E L+ A  L   E   F
Sbjct: 112 ELELSLSNVQETLVAACQLQIPEIIHF 138


>AK027266-1|BAB55007.1|  525|Homo sapiens protein ( Homo sapiens
           cDNA FLJ14360 fis, clone HEMBA1000488, weakly similar to
           RING CANAL PROTEIN. ).
          Length = 525

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 20/77 (25%), Positives = 42/77 (54%)
 Frame = +2

Query: 500 RFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFL 679
           + P ++  CCD L S ++ +N L +   A      +L      Y+L+ FV   +++D++ 
Sbjct: 131 QIPEIIHFCCDFLMSWVDEENILDVYRLAELFDLSRLTEQLDTYILKNFVAF-SRTDKYR 189

Query: 680 HLPLDELNSIILEDELK 730
            LPL+++ S++  + L+
Sbjct: 190 QLPLEKVYSLLSSNRLE 206



 Score = 40.7 bits (91), Expect = 0.007
 Identities = 25/87 (28%), Positives = 37/87 (42%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXX 443
           +V   +G     HR +L+A   YF  +F   L   EQ +VLI GV               
Sbjct: 52  VVLVVEGRHIEAHRILLAASCDYFRGMFAGGLKEMEQEEVLIHGVSYNAMCQILHFIYTS 111

Query: 444 XIDVTDTNVHELLMTADYLAFLECFSF 524
            ++++ +NV E L+ A  L   E   F
Sbjct: 112 ELELSLSNVQETLVAACQLQIPEIIHF 138


>BC015667-1|AAH15667.1|  503|Homo sapiens KLHL29 protein protein.
          Length = 503

 Score = 41.9 bits (94), Expect = 0.003
 Identities = 22/76 (28%), Positives = 37/76 (48%)
 Frame = +2

Query: 500 RFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFL 679
           +F    ++C   L   L   NCLG++  A  + C +L   A+ + L+ F  VA Q +E L
Sbjct: 216 QFHTFCKVCVSFLEKQLTASNCLGVLAMAEAMQCSELYHMAKAFALQIFPEVAAQ-EEIL 274

Query: 680 HLPLDELNSIILEDEL 727
            +  D+  + +  D L
Sbjct: 275 SISKDDFIAYVSNDSL 290


>BC013982-1|AAH13982.1|  707|Homo sapiens KLHL29 protein protein.
          Length = 707

 Score = 41.9 bits (94), Expect = 0.003
 Identities = 22/76 (28%), Positives = 37/76 (48%)
 Frame = +2

Query: 500 RFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFL 679
           +F    ++C   L   L   NCLG++  A  + C +L   A+ + L+ F  VA Q +E L
Sbjct: 247 QFHTFCKVCVSFLEKQLTASNCLGVLAMAEAMQCSELYHMAKAFALQIFPEVAAQ-EEIL 305

Query: 680 HLPLDELNSIILEDEL 727
            +  D+  + +  D L
Sbjct: 306 SISKDDFIAYVSNDSL 321


>AY049781-1|AAL15438.1|  589|Homo sapiens ectodermal-neural cortex
           protein.
          Length = 589

 Score = 41.9 bits (94), Expect = 0.003
 Identities = 22/76 (28%), Positives = 40/76 (52%)
 Frame = +2

Query: 503 FPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLH 682
           F  +   C + L  +L+P NCLG++  +    C KL   + R     F T+  ++++FL 
Sbjct: 129 FQDIRDACAEFLEKNLHPTNCLGMLLLSDAHQCTKLYELSWRMCPSNFQTI-RKNEDFLQ 187

Query: 683 LPLDELNSIILEDELK 730
           LP D +  ++  +EL+
Sbjct: 188 LPQDMVVQLLSSEELE 203



 Score = 41.1 bits (92), Expect = 0.005
 Identities = 24/84 (28%), Positives = 39/84 (46%), Gaps = 1/84 (1%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDV-LISGVRSXXXXXXXXXX 434
           D ++ A +  +FP HRA+L+ACS YF A+F+  L   + S+V   + +            
Sbjct: 47  DVLLHAGN-RTFPCHRAVLAACSRYFEAMFSGGLKESQDSEVNFDNSIHPEVLELLLDYA 105

Query: 435 XXXXIDVTDTNVHELLMTADYLAF 506
               + + + N   LL   D L F
Sbjct: 106 YSSRVIINEENAESLLEAGDMLEF 129


>AC009242-1|AAY24259.1|  388|Homo sapiens unknown protein.
          Length = 388

 Score = 41.9 bits (94), Expect = 0.003
 Identities = 22/76 (28%), Positives = 37/76 (48%)
 Frame = +2

Query: 500 RFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFL 679
           +F    ++C   L   L   NCLG++  A  + C +L   A+ + L+ F  VA Q +E L
Sbjct: 101 QFHTFCKVCVSFLEKQLTASNCLGVLAMAEAMQCSELYHMAKAFALQIFPEVAAQ-EEIL 159

Query: 680 HLPLDELNSIILEDEL 727
            +  D+  + +  D L
Sbjct: 160 SISKDDFIAYVSNDSL 175


>AB067508-1|BAB67814.1|  545|Homo sapiens KIAA1921 protein protein.
          Length = 545

 Score = 41.9 bits (94), Expect = 0.003
 Identities = 22/76 (28%), Positives = 37/76 (48%)
 Frame = +2

Query: 500 RFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFL 679
           +F    ++C   L   L   NCLG++  A  + C +L   A+ + L+ F  VA Q +E L
Sbjct: 85  QFHTFCKVCVSFLEKQLTASNCLGVLAMAEAMQCSELYHMAKAFALQIFPEVAAQ-EEIL 143

Query: 680 HLPLDELNSIILEDEL 727
            +  D+  + +  D L
Sbjct: 144 SISKDDFIAYVSNDSL 159


>BC117466-1|AAI17467.1|  612|Homo sapiens kelch repeat and BTB (POZ)
           domain containing 3 protein.
          Length = 612

 Score = 41.5 bits (93), Expect = 0.004
 Identities = 19/69 (27%), Positives = 30/69 (43%)
 Frame = +3

Query: 294 PVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTDTNVH 473
           P HR +L+ACS +F A+F   +  R+   V I+ + S                +TD NV 
Sbjct: 64  PCHRCVLAACSDFFRAMFEVNMKERDDGSVTITNLSSKAVKAFLDYAYTGKTKITDDNVE 123

Query: 474 ELLMTADYL 500
                + +L
Sbjct: 124 MFFQLSSFL 132


>BC107691-1|AAI07692.1|  161|Homo sapiens KBTBD3 protein protein.
          Length = 161

 Score = 41.5 bits (93), Expect = 0.004
 Identities = 19/69 (27%), Positives = 30/69 (43%)
 Frame = +3

Query: 294 PVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTDTNVH 473
           P HR +L+ACS +F A+F   +  R+   V I+ + S                +TD NV 
Sbjct: 64  PCHRCVLAACSDFFRAMFEVNMKERDDGSVTITNLSSKAVKAFLDYAYTGKTKITDDNVE 123

Query: 474 ELLMTADYL 500
                + +L
Sbjct: 124 MFFQLSSFL 132


>BC064576-1|AAH64576.2|  655|Homo sapiens kelch-like 13 (Drosophila)
           protein.
          Length = 655

 Score = 41.5 bits (93), Expect = 0.004
 Identities = 22/94 (23%), Positives = 41/94 (43%), Gaps = 1/94 (1%)
 Frame = +3

Query: 255 CDA-IVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXX 431
           CD  ++  D   +FPVHR ++++ S YF A+FT  +  ++   + + GV           
Sbjct: 92  CDVTLMPGDTDDAFPVHRVMMASASDYFKAMFTGGMKEQDLMCIKLHGVSKVGLRKIIDF 151

Query: 432 XXXXXIDVTDTNVHELLMTADYLAFLECFSFVAI 533
                + +   N+ + L  A +L  L    F  +
Sbjct: 152 IYTAKLSLNMDNLQDTLEAASFLQILPVLDFCKV 185


>AL591986-1|CAC41335.1|  604|Homo sapiens hypothetical protein
           protein.
          Length = 604

 Score = 41.5 bits (93), Expect = 0.004
 Identities = 22/94 (23%), Positives = 41/94 (43%), Gaps = 1/94 (1%)
 Frame = +3

Query: 255 CDA-IVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXX 431
           CD  ++  D   +FPVHR ++++ S YF A+FT  +  ++   + + GV           
Sbjct: 41  CDVTLMPGDTDDAFPVHRVMMASASDYFKAMFTGGMKEQDLMCIKLHGVSKVGLRKIIDF 100

Query: 432 XXXXXIDVTDTNVHELLMTADYLAFLECFSFVAI 533
                + +   N+ + L  A +L  L    F  +
Sbjct: 101 IYTAKLSLNMDNLQDTLEAASFLQILPVLDFCKV 134


>AK092993-1|BAC04012.1|  608|Homo sapiens protein ( Homo sapiens
           cDNA FLJ35674 fis, clone SPLEN2018299. ).
          Length = 608

 Score = 41.5 bits (93), Expect = 0.004
 Identities = 19/69 (27%), Positives = 30/69 (43%)
 Frame = +3

Query: 294 PVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTDTNVH 473
           P HR +L+ACS +F A+F   +  R+   V I+ + S                +TD NV 
Sbjct: 60  PCHRCVLAACSDFFRAMFEVNMKERDDGSVTITNLSSKAVKAFLDYAYTGKTKITDDNVE 119

Query: 474 ELLMTADYL 500
                + +L
Sbjct: 120 MFFQLSSFL 128


>AK090472-1|BAC03453.1|  547|Homo sapiens FLJ00393 protein protein.
          Length = 547

 Score = 41.5 bits (93), Expect = 0.004
 Identities = 25/78 (32%), Positives = 39/78 (50%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L +FP V + C   L+  L+  NCL +  FA    C  L + A+R++LR+   +  +  E
Sbjct: 65  LLQFPAVKEACGAFLQQQLDLANCLDMQDFAEAFSCSGLASAAQRFILRHVGELGAEQLE 124

Query: 674 FLHLPLDELNSIILEDEL 727
              LPL  L   + +D L
Sbjct: 125 --RLPLARLLCYLRDDGL 140



 Score = 37.1 bits (82), Expect = 0.083
 Identities = 22/68 (32%), Positives = 28/68 (41%)
 Frame = +3

Query: 303 RAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTDTNVHELL 482
           RA+L+A SPYF A+F   L       V + GV                + V+  N   LL
Sbjct: 1   RAVLAAASPYFRAMFAGQLRESRAERVRLHGVPPDMLQLLLDFSYTGRVAVSGDNAEPLL 60

Query: 483 MTADYLAF 506
             AD L F
Sbjct: 61  RAADLLQF 68


>AF119256-1|AAF32518.1|  537|Homo sapiens PATZ protein.
          Length = 537

 Score = 41.5 bits (93), Expect = 0.004
 Identities = 17/35 (48%), Positives = 25/35 (71%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTL 359
           CD ++R  D  SFP HRA+L+AC+ YF ++F+  L
Sbjct: 41  CDVLLRVGD-ESFPAHRAVLAACNEYFESVFSAQL 74


>AC006963-1|AAF03529.1|  622|Homo sapiens WUGSC:H_DJ0278D01.1
           protein.
          Length = 622

 Score = 41.5 bits (93), Expect = 0.004
 Identities = 22/94 (23%), Positives = 41/94 (43%), Gaps = 1/94 (1%)
 Frame = +3

Query: 255 CDA-IVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXX 431
           CD  ++  D   +FPVHR ++++ S YF A+FT  +  ++   + + GV           
Sbjct: 59  CDVTLMPGDTDDAFPVHRVMMASASDYFKAMFTGGMKEQDLMCIKLHGVSKVGLRKIIDF 118

Query: 432 XXXXXIDVTDTNVHELLMTADYLAFLECFSFVAI 533
                + +   N+ + L  A +L  L    F  +
Sbjct: 119 IYTAKLSLNMDNLQDTLEAASFLQILPVLDFCKV 152


>AB037730-1|BAA92547.1|  639|Homo sapiens KIAA1309 protein protein.
          Length = 639

 Score = 41.5 bits (93), Expect = 0.004
 Identities = 22/94 (23%), Positives = 41/94 (43%), Gaps = 1/94 (1%)
 Frame = +3

Query: 255 CDA-IVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXX 431
           CD  ++  D   +FPVHR ++++ S YF A+FT  +  ++   + + GV           
Sbjct: 76  CDVTLMPGDTDDAFPVHRVMMASASDYFKAMFTGGMKEQDLMCIKLHGVSKVGLRKIIDF 135

Query: 432 XXXXXIDVTDTNVHELLMTADYLAFLECFSFVAI 533
                + +   N+ + L  A +L  L    F  +
Sbjct: 136 IYTAKLSLNMDNLQDTLEAASFLQILPVLDFCKV 169


>BC044840-1|AAH44840.1|  597|Homo sapiens giant axonal neuropathy
           (gigaxonin) protein.
          Length = 597

 Score = 41.1 bits (92), Expect = 0.005
 Identities = 22/69 (31%), Positives = 37/69 (53%)
 Frame = +2

Query: 521 LCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPLDEL 700
           LCC+ L   +  +NC+GI  FA     + +   A  YL  +F  V++ ++EFL L   +L
Sbjct: 120 LCCEFLEGCIAAENCIGIRDFALHYCLHHVHYLATEYLETHFRDVSS-TEEFLELSPQKL 178

Query: 701 NSIILEDEL 727
             +I  ++L
Sbjct: 179 KEVISLEKL 187


>AF291673-1|AAG35311.1|  597|Homo sapiens gigaxonin protein.
          Length = 597

 Score = 41.1 bits (92), Expect = 0.005
 Identities = 22/69 (31%), Positives = 37/69 (53%)
 Frame = +2

Query: 521 LCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPLDEL 700
           LCC+ L   +  +NC+GI  FA     + +   A  YL  +F  V++ ++EFL L   +L
Sbjct: 120 LCCEFLEGCIAAENCIGIRDFALHYCLHHVHYLATEYLETHFRDVSS-TEEFLELSPQKL 178

Query: 701 NSIILEDEL 727
             +I  ++L
Sbjct: 179 KEVISLEKL 187


>AF147727-1|AAF67471.1|   73|Homo sapiens unknown protein.
          Length = 73

 Score = 41.1 bits (92), Expect = 0.005
 Identities = 25/71 (35%), Positives = 36/71 (50%)
 Frame = +2

Query: 518 QLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPLDE 697
           ++C  +L+  L+  NCLGI  F  +     + A A  +L   F  VA Q DEFL L  D 
Sbjct: 2   KVCGRYLQQQLDATNCLGICEFGEQQGLLGVAAKAWAFLRENFEAVA-QEDEFLQLARDR 60

Query: 698 LNSIILEDELK 730
           L + +  D L+
Sbjct: 61  LATCLASDLLQ 71


>BC071627-1|AAH71627.1|  470|Homo sapiens KLHL32 protein protein.
          Length = 470

 Score = 39.9 bits (89), Expect = 0.012
 Identities = 30/119 (25%), Positives = 55/119 (46%), Gaps = 2/119 (1%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  + A++   F  H+A+L+ACS YF A+F+  +      +V + GV S          
Sbjct: 42  CDITLIAEE-QKFHAHKAVLAACSDYFRAMFSLCMVESGADEVNLHGVTSLGLKQALEFA 100

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLECFSFVA--IISEVH*TQKTVLEL*LLQGVFSVT 605
               I +    + ++L    +L  LE  +  +  +I E++      L+L  L  +F++T
Sbjct: 101 YTGQILLEPGVIQDVLAAGSHLQLLELLNLCSHYLIQELN--SFNYLDLYRLADLFNLT 157


>BC051349-1|AAH51349.1|  674|Homo sapiens kelch repeat and BTB (POZ)
           domain containing 6 protein.
          Length = 674

 Score = 39.9 bits (89), Expect = 0.012
 Identities = 19/73 (26%), Positives = 35/73 (47%)
 Frame = +3

Query: 282 GASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTD 461
           G  FP +R +L+A  PYF ++FT  ++  +Q+ V +  V +              + +++
Sbjct: 79  GRLFPCNRNVLAAACPYFKSMFTGGMYESQQASVTMHDVDAESFEVLVDYCYTGRVSLSE 138

Query: 462 TNVHELLMTADYL 500
            NV  L   +D L
Sbjct: 139 ANVERLYAASDML 151


>BC033821-1|AAH33821.1|  616|Homo sapiens chromosome 16 open reading
           frame 44 protein.
          Length = 616

 Score = 39.9 bits (89), Expect = 0.012
 Identities = 28/116 (24%), Positives = 47/116 (40%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++ AD+    P HR +L+ CS YF ++FT  +    Q +V + G             
Sbjct: 46  CDVVLVADE-QRVPAHRNLLAVCSDYFNSMFTIGMREAFQKEVELIGASYIGLKAVVDFL 104

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLECFSFVAIISEVH*TQKTVLEL*LLQGVFSV 602
               + +   N+  +L TA  L       F     E   ++   L L  L  ++S+
Sbjct: 105 YGGELVLDGGNIDYVLETAHLLQIWTVVDFCCEYLEQEVSEDNYLYLQELASIYSL 160


>BC032400-1|AAH32400.1|  553|Homo sapiens C16orf44 protein protein.
          Length = 553

 Score = 39.9 bits (89), Expect = 0.012
 Identities = 28/116 (24%), Positives = 47/116 (40%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++ AD+    P HR +L+ CS YF ++FT  +    Q +V + G             
Sbjct: 46  CDVVLVADE-QRVPAHRNLLAVCSDYFNSMFTIGMREAFQKEVELIGASYIGLKAVVDFL 104

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLECFSFVAIISEVH*TQKTVLEL*LLQGVFSV 602
               + +   N+  +L TA  L       F     E   ++   L L  L  ++S+
Sbjct: 105 YGGELVLDGGNIDYVLETAHLLQIWTVVDFCCEYLEQEVSEDNYLYLQELASIYSL 160


>BC026319-1|AAH26319.1|  615|Homo sapiens kelch-like 26 (Drosophila)
           protein.
          Length = 615

 Score = 39.9 bits (89), Expect = 0.012
 Identities = 18/56 (32%), Positives = 29/56 (51%)
 Frame = +3

Query: 231 STARVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGV 398
           +T R       +V   +  +FP H+ +L+ACS YF A+FT  +    Q  + + GV
Sbjct: 54  ATLRAQGQLLDVVLTINREAFPAHKVVLAACSDYFRAMFTGGMREASQDVIELKGV 109



 Score = 38.7 bits (86), Expect = 0.027
 Identities = 20/73 (27%), Positives = 38/73 (52%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V++LC + L+++++ + CL I   A       L      +  R+F+ +A + D FL LPL
Sbjct: 148 VVELCEEFLKAAMSVETCLNIGQMATTFSLASLRESVDAFTFRHFLQIAEEED-FLRLPL 206

Query: 692 DELNSIILEDELK 730
           + L   +  + L+
Sbjct: 207 ERLVFFLQSNRLQ 219


>BC000560-1|AAH00560.1|  674|Homo sapiens kelch repeat and BTB (POZ)
           domain containing 6 protein.
          Length = 674

 Score = 39.9 bits (89), Expect = 0.012
 Identities = 19/73 (26%), Positives = 35/73 (47%)
 Frame = +3

Query: 282 GASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTD 461
           G  FP +R +L+A  PYF ++FT  ++  +Q+ V +  V +              + +++
Sbjct: 79  GRLFPCNRNVLAAACPYFKSMFTGGMYESQQASVTMHDVDAESFEVLVDYCYTGRVSLSE 138

Query: 462 TNVHELLMTADYL 500
            NV  L   +D L
Sbjct: 139 ANVERLYAASDML 151


>AL833839-1|CAD38699.1|  654|Homo sapiens hypothetical protein
           protein.
          Length = 654

 Score = 39.9 bits (89), Expect = 0.012
 Identities = 19/73 (26%), Positives = 35/73 (47%)
 Frame = +3

Query: 282 GASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTD 461
           G  FP +R +L+A  PYF ++FT  ++  +Q+ V +  V +              + +++
Sbjct: 59  GRLFPCNRNVLAAACPYFKSMFTGGMYESQQASVTMHDVDAESFEVLVDYCYTGRVSLSE 118

Query: 462 TNVHELLMTADYL 500
            NV  L   +D L
Sbjct: 119 ANVERLYAASDML 131


>AL356958-1|CAI21654.1|  620|Homo sapiens kelch-like 32 (Drosophila)
           protein.
          Length = 620

 Score = 39.9 bits (89), Expect = 0.012
 Identities = 30/119 (25%), Positives = 55/119 (46%), Gaps = 2/119 (1%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  + A++   F  H+A+L+ACS YF A+F+  +      +V + GV S          
Sbjct: 42  CDITLIAEE-QKFHAHKAVLAACSDYFRAMFSLCMVESGADEVNLHGVTSLGLKQALEFA 100

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLECFSFVA--IISEVH*TQKTVLEL*LLQGVFSVT 605
               I +    + ++L    +L  LE  +  +  +I E++      L+L  L  +F++T
Sbjct: 101 YTGQILLEPGVIQDVLAAGSHLQLLELLNLCSHYLIQELN--SFNYLDLYRLADLFNLT 157


>AL354696-1|CAI16611.1|  674|Homo sapiens kelch repeat and BTB (POZ)
           domain containing 6 protein.
          Length = 674

 Score = 39.9 bits (89), Expect = 0.012
 Identities = 19/73 (26%), Positives = 35/73 (47%)
 Frame = +3

Query: 282 GASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTD 461
           G  FP +R +L+A  PYF ++FT  ++  +Q+ V +  V +              + +++
Sbjct: 79  GRLFPCNRNVLAAACPYFKSMFTGGMYESQQASVTMHDVDAESFEVLVDYCYTGRVSLSE 138

Query: 462 TNVHELLMTADYL 500
            NV  L   +D L
Sbjct: 139 ANVERLYAASDML 151


>AL033375-2|CAI19824.1|  620|Homo sapiens kelch-like 32 (Drosophila)
           protein.
          Length = 620

 Score = 39.9 bits (89), Expect = 0.012
 Identities = 30/119 (25%), Positives = 55/119 (46%), Gaps = 2/119 (1%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  + A++   F  H+A+L+ACS YF A+F+  +      +V + GV S          
Sbjct: 42  CDITLIAEE-QKFHAHKAVLAACSDYFRAMFSLCMVESGADEVNLHGVTSLGLKQALEFA 100

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLECFSFVA--IISEVH*TQKTVLEL*LLQGVFSVT 605
               I +    + ++L    +L  LE  +  +  +I E++      L+L  L  +F++T
Sbjct: 101 YTGQILLEPGVIQDVLAAGSHLQLLELLNLCSHYLIQELN--SFNYLDLYRLADLFNLT 157


>AL023656-3|CAI20428.1|  620|Homo sapiens kelch-like 32 (Drosophila)
           protein.
          Length = 620

 Score = 39.9 bits (89), Expect = 0.012
 Identities = 30/119 (25%), Positives = 55/119 (46%), Gaps = 2/119 (1%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  + A++   F  H+A+L+ACS YF A+F+  +      +V + GV S          
Sbjct: 42  CDITLIAEE-QKFHAHKAVLAACSDYFRAMFSLCMVESGADEVNLHGVTSLGLKQALEFA 100

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLECFSFVA--IISEVH*TQKTVLEL*LLQGVFSVT 605
               I +    + ++L    +L  LE  +  +  +I E++      L+L  L  +F++T
Sbjct: 101 YTGQILLEPGVIQDVLAAGSHLQLLELLNLCSHYLIQELN--SFNYLDLYRLADLFNLT 157


>AK222656-1|BAD96376.1|  615|Homo sapiens hypothetical protein
           FLJ11078 variant protein.
          Length = 615

 Score = 39.9 bits (89), Expect = 0.012
 Identities = 18/56 (32%), Positives = 29/56 (51%)
 Frame = +3

Query: 231 STARVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGV 398
           +T R       +V   +  +FP H+ +L+ACS YF A+FT  +    Q  + + GV
Sbjct: 54  ATLRAQGQLLDVVLTINREAFPAHKVVLAACSDYFRAMFTGGMREASQDVIELKGV 109



 Score = 38.7 bits (86), Expect = 0.027
 Identities = 20/73 (27%), Positives = 38/73 (52%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V++LC + L+++++ + CL I   A       L      +  R+F+ +A + D FL LPL
Sbjct: 148 VVELCEEFLKAAMSVETCLNIGQMATTFSLASLRESVDAFTFRHFLQIAEEED-FLRLPL 206

Query: 692 DELNSIILEDELK 730
           + L   +  + L+
Sbjct: 207 ERLVFFLQSNRLQ 219


>AK056633-1|BAB71238.1|  674|Homo sapiens protein ( Homo sapiens
           cDNA FLJ32071 fis, clone OCBBF1000122, weakly similar to
           RING CANAL PROTEIN. ).
          Length = 674

 Score = 39.9 bits (89), Expect = 0.012
 Identities = 19/73 (26%), Positives = 35/73 (47%)
 Frame = +3

Query: 282 GASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTD 461
           G  FP +R +L+A  PYF ++FT  ++  +Q+ V +  V +              + +++
Sbjct: 79  GRLFPCNRNVLAAACPYFKSMFTGGMYESQQASVTMHDVDAESFEVLVDYCYTGRVSLSE 138

Query: 462 TNVHELLMTADYL 500
            NV  L   +D L
Sbjct: 139 ANVERLYAASDML 151


>AK055292-1|BAB70899.1|  620|Homo sapiens protein ( Homo sapiens
           cDNA FLJ30730 fis, clone FEBRA2000053, weakly similar to
           Drosophila melanogaster Diablo (dbo) mRNA. ).
          Length = 620

 Score = 39.9 bits (89), Expect = 0.012
 Identities = 30/119 (25%), Positives = 55/119 (46%), Gaps = 2/119 (1%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  + A++   F  H+A+L+ACS YF A+F+  +      +V + GV S          
Sbjct: 42  CDITLIAEE-QKFHAHKAVLAACSDYFRAMFSLCMVESGADEVNLHGVTSLGLKQALEFA 100

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLECFSFVA--IISEVH*TQKTVLEL*LLQGVFSVT 605
               I +    + ++L    +L  LE  +  +  +I E++      L+L  L  +F++T
Sbjct: 101 YTGQILLEPGVIQDVLAAGSHLQLLELLNLCSHYLIQELN--SFNYLDLYRLADLFNLT 157


>AK022605-1|BAB14124.1|  616|Homo sapiens protein ( Homo sapiens
           cDNA FLJ12543 fis, clone NT2RM4000590, weakly similar to
           RING CANAL PROTEIN. ).
          Length = 616

 Score = 39.9 bits (89), Expect = 0.012
 Identities = 28/116 (24%), Positives = 47/116 (40%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++ AD+    P HR +L+ CS YF ++FT  +    Q +V + G             
Sbjct: 46  CDVVLVADE-QRVPAHRNLLAVCSDYFNSMFTIGMREAFQKEVELIGASYIGLKAVVDFL 104

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLECFSFVAIISEVH*TQKTVLEL*LLQGVFSV 602
               + +   N+  +L TA  L       F     E   ++   L L  L  ++S+
Sbjct: 105 YGGELVLDGGNIDYVLETAHLLQIWTVVDFCCEYLEQEVSEDNYLYLQELASIYSL 160


>AK001940-1|BAA91990.1|  615|Homo sapiens protein ( Homo sapiens
           cDNA FLJ11078 fis, clone PLACE1005102, weakly similar to
           RING CANAL PROTEIN. ).
          Length = 615

 Score = 39.9 bits (89), Expect = 0.012
 Identities = 18/56 (32%), Positives = 29/56 (51%)
 Frame = +3

Query: 231 STARVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGV 398
           +T R       +V   +  +FP H+ +L+ACS YF A+FT  +    Q  + + GV
Sbjct: 54  ATLRAQGQLLDVVLTINREAFPAHKVVLAACSDYFRAMFTGGMREASQDVIELKGV 109



 Score = 38.7 bits (86), Expect = 0.027
 Identities = 20/73 (27%), Positives = 38/73 (52%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V++LC + L+++++ + CL I   A       L      +  R+F+ +A + D FL LPL
Sbjct: 148 VVELCEEFLKAAMSVETCLNIGQMATTFSLASLRESVDAFTFRHFLQIAEEED-FLRLPL 206

Query: 692 DELNSIILEDELK 730
           + L   +  + L+
Sbjct: 207 ERLVFFLQSNRLQ 219


>AB067487-1|BAB67793.1|  582|Homo sapiens KIAA1900 protein protein.
          Length = 582

 Score = 39.9 bits (89), Expect = 0.012
 Identities = 30/119 (25%), Positives = 55/119 (46%), Gaps = 2/119 (1%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  + A++   F  H+A+L+ACS YF A+F+  +      +V + GV S          
Sbjct: 4   CDITLIAEE-QKFHAHKAVLAACSDYFRAMFSLCMVESGADEVNLHGVTSLGLKQALEFA 62

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLECFSFVA--IISEVH*TQKTVLEL*LLQGVFSVT 605
               I +    + ++L    +L  LE  +  +  +I E++      L+L  L  +F++T
Sbjct: 63  YTGQILLEPGVIQDVLAAGSHLQLLELLNLCSHYLIQELN--SFNYLDLYRLADLFNLT 119


>BC009555-1|AAH09555.1|  144|Homo sapiens KLHL7 protein protein.
          Length = 144

 Score = 39.1 bits (87), Expect = 0.021
 Identities = 25/100 (25%), Positives = 42/100 (42%), Gaps = 3/100 (3%)
 Frame = +3

Query: 204 VGGSDAGAPSTARVS---SACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQ 374
           +GG+D     T+ ++   + CD I+   +    P HR +L+A S +F  +FTT +   + 
Sbjct: 2   LGGTDCRTFLTSHINLKKTLCDVILMVQE-RKIPAHRVVLAAASHFFNLMFTTNMLESKS 60

Query: 375 SDVLISGVRSXXXXXXXXXXXXXXIDVTDTNVHELLMTAD 494
            +V +                   I V   NV  LL  A+
Sbjct: 61  FEVELKDAEPDIIEQLVEFAYTARISVNSNNVQSLLDAAN 100


>BC031830-1|AAH31830.1|  139|Homo sapiens KLHL32 protein protein.
          Length = 139

 Score = 38.7 bits (86), Expect = 0.027
 Identities = 23/86 (26%), Positives = 39/86 (45%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  + A++   F  H+A+L+ACS YF A+F+  +      +V + GV S          
Sbjct: 42  CDITLIAEE-QKFHAHKAVLAACSDYFRAMFSLCMVESGADEVNLHGVTSLGLKQALEFA 100

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLE 512
               I +    + ++L    +L  LE
Sbjct: 101 YTGQILLEPGVIQDVLAAGSHLQLLE 126


>AL033375-1|CAI19823.1|  139|Homo sapiens kelch-like 32 (Drosophila)
           protein.
          Length = 139

 Score = 38.7 bits (86), Expect = 0.027
 Identities = 23/86 (26%), Positives = 39/86 (45%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  + A++   F  H+A+L+ACS YF A+F+  +      +V + GV S          
Sbjct: 42  CDITLIAEE-QKFHAHKAVLAACSDYFRAMFSLCMVESGADEVNLHGVTSLGLKQALEFA 100

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLE 512
               I +    + ++L    +L  LE
Sbjct: 101 YTGQILLEPGVIQDVLAAGSHLQLLE 126


>AL023656-2|CAI20427.1|  139|Homo sapiens kelch-like 32 (Drosophila)
           protein.
          Length = 139

 Score = 38.7 bits (86), Expect = 0.027
 Identities = 23/86 (26%), Positives = 39/86 (45%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  + A++   F  H+A+L+ACS YF A+F+  +      +V + GV S          
Sbjct: 42  CDITLIAEE-QKFHAHKAVLAACSDYFRAMFSLCMVESGADEVNLHGVTSLGLKQALEFA 100

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLE 512
               I +    + ++L    +L  LE
Sbjct: 101 YTGQILLEPGVIQDVLAAGSHLQLLE 126


>BC050719-1|AAH50719.1|  713|Homo sapiens ZBTB1 protein protein.
          Length = 713

 Score = 37.1 bits (82), Expect = 0.083
 Identities = 17/40 (42%), Positives = 21/40 (52%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQ 374
           CD  +  DD   F  H+A+L+ACS YF   F    HS  Q
Sbjct: 24  CDCCIAIDD-IYFQAHKAVLAACSSYFRMFFMNHQHSTAQ 62


>AY598321-1|AAT06732.1|  644|Homo sapiens L2 protein.
          Length = 644

 Score = 37.1 bits (82), Expect = 0.083
 Identities = 17/40 (42%), Positives = 21/40 (52%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQ 374
           CD  +  DD   F  H+A+L+ACS YF   F    HS  Q
Sbjct: 24  CDCCIAIDD-IYFQAHKAVLAACSSYFRMFFMNHQHSTAQ 62


>AB023214-1|BAA76841.2|  646|Homo sapiens KIAA0997 protein protein.
          Length = 646

 Score = 37.1 bits (82), Expect = 0.083
 Identities = 17/40 (42%), Positives = 21/40 (52%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQ 374
           CD  +  DD   F  H+A+L+ACS YF   F    HS  Q
Sbjct: 26  CDCCIAIDD-IYFQAHKAVLAACSSYFRMFFMNHQHSTAQ 64


>BC022033-1|AAH22033.1|  684|Homo sapiens kelch repeat and BTB (POZ)
           domain containing 7 protein.
          Length = 684

 Score = 36.7 bits (81), Expect = 0.11
 Identities = 18/73 (24%), Positives = 34/73 (46%)
 Frame = +3

Query: 282 GASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTD 461
           G  F  +R +L+A  PYF ++FT  ++  +Q+ V +  V +              + +++
Sbjct: 79  GRLFSCNRNVLAAACPYFKSMFTGGMYESQQASVTMHDVDAESFEVLVDYCYTGRVSLSE 138

Query: 462 TNVHELLMTADYL 500
            NV  L   +D L
Sbjct: 139 ANVQRLYAASDML 151


>BC012070-1|AAH12070.1|  539|Homo sapiens ZBTB7B protein protein.
          Length = 539

 Score = 36.7 bits (81), Expect = 0.11
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFT 350
           CD  +R   G  +  HRA+L+ACS YF  LFT
Sbjct: 34  CDLTIRTQ-GLEYRTHRAVLAACSHYFKKLFT 64


>AY346333-1|AAQ24383.1|  305|Homo sapiens double BTB/POZ domain
           containing protein protein.
          Length = 305

 Score = 36.7 bits (81), Expect = 0.11
 Identities = 25/77 (32%), Positives = 31/77 (40%), Gaps = 1/77 (1%)
 Frame = +3

Query: 243 VSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXX 422
           V   C  I    DG  F  HRAILSA S YF A+ +       Q  V + G+        
Sbjct: 201 VKPCCPDIDIFVDGKRFKAHRAILSARSSYFAAMLSGCWAESSQEYVTLQGISHVELNVM 260

Query: 423 XXXXXXXXIDVTD-TNV 470
                   +D+ D TNV
Sbjct: 261 MHFIYGGTLDIPDKTNV 277


>AL451085-29|CAI13266.1|  539|Homo sapiens zinc finger and BTB
           domain containing 7B protein.
          Length = 539

 Score = 36.7 bits (81), Expect = 0.11
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFT 350
           CD  +R   G  +  HRA+L+ACS YF  LFT
Sbjct: 34  CDLTIRTQ-GLEYRTHRAVLAACSHYFKKLFT 64


>AL354696-3|CAI16613.1|  684|Homo sapiens kelch repeat and BTB (POZ)
           domain containing 7 protein.
          Length = 684

 Score = 36.7 bits (81), Expect = 0.11
 Identities = 18/73 (24%), Positives = 34/73 (46%)
 Frame = +3

Query: 282 GASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTD 461
           G  F  +R +L+A  PYF ++FT  ++  +Q+ V +  V +              + +++
Sbjct: 79  GRLFSCNRNVLAAACPYFKSMFTGGMYESQQASVTMHDVDAESFEVLVDYCYTGRVSLSE 138

Query: 462 TNVHELLMTADYL 500
            NV  L   +D L
Sbjct: 139 ANVQRLYAASDML 151


>AK091344-1|BAC03641.1|  684|Homo sapiens protein ( Homo sapiens
           cDNA FLJ34025 fis, clone FCBBF2003336, weakly similar to
           RING CANAL PROTEIN. ).
          Length = 684

 Score = 36.7 bits (81), Expect = 0.11
 Identities = 18/73 (24%), Positives = 34/73 (46%)
 Frame = +3

Query: 282 GASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTD 461
           G  F  +R +L+A  PYF ++FT  ++  +Q+ V +  V +              + +++
Sbjct: 79  GRLFSCNRNVLAAACPYFKSMFTGGMYESQQASVTMHDVDAESFEVLVDYCYTGRVSLSE 138

Query: 462 TNVHELLMTADYL 500
            NV  L   +D L
Sbjct: 139 ANVQRLYAASDML 151


>AF007833-1|AAC51847.1|  539|Homo sapiens kruppel-related zinc
           finger protein hcKrox protein.
          Length = 539

 Score = 36.7 bits (81), Expect = 0.11
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFT 350
           CD  +R   G  +  HRA+L+ACS YF  LFT
Sbjct: 34  CDLTIRTQ-GLEYRTHRAVLAACSHYFKKLFT 64


>AF111113-1|AAF27196.1|  166|Homo sapiens SBBI26 protein.
          Length = 166

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 21/80 (26%), Positives = 32/80 (40%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD I+   +    P HR +L+A S +F  +FTT +   +  +V +               
Sbjct: 44  CDVILMVQE-RKIPAHRVVLAAASHFFNLMFTTNMLESKSFEVELKDAEPDIIEQLVEFA 102

Query: 435 XXXXIDVTDTNVHELLMTAD 494
               I V   NV  LL  A+
Sbjct: 103 YTARISVNSNNVQSLLDAAN 122


>AC006039-2|AAO21916.1|  166|Homo sapiens unknown protein.
          Length = 166

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 21/80 (26%), Positives = 32/80 (40%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD I+   +    P HR +L+A S +F  +FTT +   +  +V +               
Sbjct: 44  CDVILMVQE-RKIPAHRVVLAAASHFFNLMFTTNMLESKSFEVELKDAEPDIIEQLVEFA 102

Query: 435 XXXXIDVTDTNVHELLMTAD 494
               I V   NV  LL  A+
Sbjct: 103 YTARISVNSNNVQSLLDAAN 122


>X95072-1|CAA64468.1|  522|Homo sapiens Translin Associated Zinc
           Finger protein-1 protein.
          Length = 522

 Score = 35.1 bits (77), Expect = 0.34
 Identities = 22/82 (26%), Positives = 33/82 (40%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  V   D A F  HRA+L++CS YF   +   L  R+   +    V +          
Sbjct: 24  CDCTVLVGD-AQFRAHRAVLASCSMYFHLFYKDQLDKRDIVHLNSDIVTAPAFALLLEFM 82

Query: 435 XXXXIDVTDTNVHELLMTADYL 500
               +   D  + ++L  A YL
Sbjct: 83  YEGKLQFKDLPIEDVLAAASYL 104


>U38896-1|AAA81368.1|  484|Homo sapiens zinc finger protein C2H2-171
           protein.
          Length = 484

 Score = 35.1 bits (77), Expect = 0.34
 Identities = 22/82 (26%), Positives = 33/82 (40%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  V   D A F  HRA+L++CS YF   +   L  R+   +    V +          
Sbjct: 24  CDCTVLVGD-AQFRAHRAVLASCSMYFHLFYKDQLDKRDIVHLNSDIVTAPAFALLLEFM 82

Query: 435 XXXXIDVTDTNVHELLMTADYL 500
               +   D  + ++L  A YL
Sbjct: 83  YEGKLQFKDLPIEDVLAAASYL 104


>BX640744-1|CAE45855.1|  544|Homo sapiens hypothetical protein
           protein.
          Length = 544

 Score = 35.1 bits (77), Expect = 0.34
 Identities = 17/72 (23%), Positives = 35/72 (48%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V + CC++++   +P NCL +  FA       L   A +Y   +F T   + ++F+ +  
Sbjct: 76  VARACCEYMKLHFHPSNCLAVRAFAESHNRIDLMDMADQYACDHF-TEVVECEDFVSVSP 134

Query: 692 DELNSIILEDEL 727
             L+ ++   +L
Sbjct: 135 QHLHKLLSSSDL 146


>BX640727-1|CAE45843.1|  620|Homo sapiens hypothetical protein
           protein.
          Length = 620

 Score = 35.1 bits (77), Expect = 0.34
 Identities = 17/72 (23%), Positives = 35/72 (48%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V + CC++++   +P NCL +  FA       L   A +Y   +F T   + ++F+ +  
Sbjct: 152 VARACCEYMKLHFHPSNCLAVRAFAESHNRIDLMDMADQYACDHF-TEVVECEDFVSVSP 210

Query: 692 DELNSIILEDEL 727
             L+ ++   +L
Sbjct: 211 QHLHKLLSSSDL 222


>BX538173-1|CAD98048.1|  620|Homo sapiens hypothetical protein
           protein.
          Length = 620

 Score = 35.1 bits (77), Expect = 0.34
 Identities = 17/72 (23%), Positives = 35/72 (48%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V + CC++++   +P NCL +  FA       L   A +Y   +F T   + ++F+ +  
Sbjct: 152 VARACCEYMKLHFHPSNCLAVRAFAESHNRIDLMDMADQYACDHF-TEVVECEDFVSVSP 210

Query: 692 DELNSIILEDEL 727
             L+ ++   +L
Sbjct: 211 QHLHKLLSSSDL 222


>BC109031-1|AAI09032.1|  644|Homo sapiens kelch-like 34 (Drosophila)
           protein.
          Length = 644

 Score = 35.1 bits (77), Expect = 0.34
 Identities = 19/57 (33%), Positives = 29/57 (50%)
 Frame = +3

Query: 201 HVGGSDAGAPSTARVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSRE 371
           H G    G  +       CD  +  + G+ FP HR++L+  S YF ALF +  H++E
Sbjct: 11  HGGALLTGYQALRAEGFLCDVTLETE-GSEFPAHRSLLACSSDYFRALFKS--HTQE 64


>BC041384-1|AAH41384.1|  620|Homo sapiens kelch-like 8 (Drosophila)
           protein.
          Length = 620

 Score = 35.1 bits (77), Expect = 0.34
 Identities = 17/72 (23%), Positives = 35/72 (48%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V + CC++++   +P NCL +  FA       L   A +Y   +F T   + ++F+ +  
Sbjct: 152 VARACCEYMKLHFHPSNCLAVRAFAESHNRIDLMDMADQYACDHF-TEVVECEDFVSVSP 210

Query: 692 DELNSIILEDEL 727
             L+ ++   +L
Sbjct: 211 QHLHKLLSSSDL 222


>BC036677-1|AAH36677.2|  531|Homo sapiens zinc finger protein 238
           protein.
          Length = 531

 Score = 35.1 bits (77), Expect = 0.34
 Identities = 22/82 (26%), Positives = 33/82 (40%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  V   D A F  HRA+L++CS YF   +   L  R+   +    V +          
Sbjct: 33  CDCTVLVGD-AQFRAHRAVLASCSMYFHIFYKDQLDKRDIVHLNSDIVTAPAFALLLEFM 91

Query: 435 XXXXIDVTDTNVHELLMTADYL 500
               +   D  + ++L  A YL
Sbjct: 92  YEGKLQFKDLPIEDVLAAASYL 113


>AL772392-1|CAI40764.1|  644|Homo sapiens novel protein protein.
          Length = 644

 Score = 35.1 bits (77), Expect = 0.34
 Identities = 19/57 (33%), Positives = 29/57 (50%)
 Frame = +3

Query: 201 HVGGSDAGAPSTARVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSRE 371
           H G    G  +       CD  +  + G+ FP HR++L+  S YF ALF +  H++E
Sbjct: 11  HGGALLTGYQALRAEGFLCDVTLETE-GSEFPAHRSLLACSSDYFRALFKS--HTQE 64


>AL590483-1|CAH71954.1|  522|Homo sapiens zinc finger protein 238
           protein.
          Length = 522

 Score = 35.1 bits (77), Expect = 0.34
 Identities = 22/82 (26%), Positives = 33/82 (40%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  V   D A F  HRA+L++CS YF   +   L  R+   +    V +          
Sbjct: 24  CDCTVLVGD-AQFRAHRAVLASCSMYFHLFYKDQLDKRDIVHLNSDIVTAPAFALLLEFM 82

Query: 435 XXXXIDVTDTNVHELLMTADYL 500
               +   D  + ++L  A YL
Sbjct: 83  YEGKLQFKDLPIEDVLAAASYL 104


>AK092279-1|BAC03848.1|  644|Homo sapiens protein ( Homo sapiens
           cDNA FLJ34960 fis, clone NTONG2003515. ).
          Length = 644

 Score = 35.1 bits (77), Expect = 0.34
 Identities = 19/57 (33%), Positives = 29/57 (50%)
 Frame = +3

Query: 201 HVGGSDAGAPSTARVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSRE 371
           H G    G  +       CD  +  + G+ FP HR++L+  S YF ALF +  H++E
Sbjct: 11  HGGALLTGYQALRAEGFLCDVTLETE-GSEFPAHRSLLACSSDYFRALFKS--HTQE 64


>AJ223321-1|CAA11262.1|  522|Homo sapiens RP58 protein protein.
          Length = 522

 Score = 35.1 bits (77), Expect = 0.34
 Identities = 22/82 (26%), Positives = 33/82 (40%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  V   D A F  HRA+L++CS YF   +   L  R+   +    V +          
Sbjct: 24  CDCTVLVGD-AQFRAHRAVLASCSMYFHLFYKDQLDKRDIVHLNSDIVTAPAFALLLEFM 82

Query: 435 XXXXIDVTDTNVHELLMTADYL 500
               +   D  + ++L  A YL
Sbjct: 83  YEGKLQFKDLPIEDVLAAASYL 104


>AJ001388-1|CAA04718.1|  522|Homo sapiens RP58 protein.
          Length = 522

 Score = 35.1 bits (77), Expect = 0.34
 Identities = 22/82 (26%), Positives = 33/82 (40%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  V   D A F  HRA+L++CS YF   +   L  R+   +    V +          
Sbjct: 24  CDCTVLVGD-AQFRAHRAVLASCSMYFHLFYKDQLDKRDIVHLNSDIVTAPAFALLLEFM 82

Query: 435 XXXXIDVTDTNVHELLMTADYL 500
               +   D  + ++L  A YL
Sbjct: 83  YEGKLQFKDLPIEDVLAAASYL 104


>AB037799-1|BAA92616.2|  628|Homo sapiens KIAA1378 protein protein.
          Length = 628

 Score = 35.1 bits (77), Expect = 0.34
 Identities = 17/72 (23%), Positives = 35/72 (48%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V + CC++++   +P NCL +  FA       L   A +Y   +F T   + ++F+ +  
Sbjct: 160 VARACCEYMKLHFHPSNCLAVRAFAESHNRIDLMDMADQYACDHF-TEVVECEDFVSVSP 218

Query: 692 DELNSIILEDEL 727
             L+ ++   +L
Sbjct: 219 QHLHKLLSSSDL 230


>Y09723-1|CAA70889.1|  803|Homo sapiens Miz-1 protein protein.
          Length = 803

 Score = 33.9 bits (74), Expect = 0.78
 Identities = 13/23 (56%), Positives = 16/23 (69%)
 Frame = +3

Query: 279 DGASFPVHRAILSACSPYFLALF 347
           DG  F  H+A+L+ACS YF  LF
Sbjct: 31  DGVHFKAHKAVLAACSEYFKMLF 53


>BC126163-1|AAI26164.1|  803|Homo sapiens zinc finger and BTB domain
           containing 17 protein.
          Length = 803

 Score = 33.9 bits (74), Expect = 0.78
 Identities = 13/23 (56%), Positives = 16/23 (69%)
 Frame = +3

Query: 279 DGASFPVHRAILSACSPYFLALF 347
           DG  F  H+A+L+ACS YF  LF
Sbjct: 31  DGVHFKAHKAVLAACSEYFKMLF 53


>BC021267-1|AAH21267.1|  388|Homo sapiens KLHL14 protein protein.
          Length = 388

 Score = 33.9 bits (74), Expect = 0.78
 Identities = 14/33 (42%), Positives = 22/33 (66%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTT 353
           CD  + A  G  F  H+A+L++CS YF +LF++
Sbjct: 33  CDVTLTAQ-GQQFHCHKAVLASCSQYFRSLFSS 64


>AL034555-3|CAB85445.1|  803|Homo sapiens zinc finger and BTB domain
           containing 17 protein.
          Length = 803

 Score = 33.9 bits (74), Expect = 0.78
 Identities = 13/23 (56%), Positives = 16/23 (69%)
 Frame = +3

Query: 279 DGASFPVHRAILSACSPYFLALF 347
           DG  F  H+A+L+ACS YF  LF
Sbjct: 31  DGVHFKAHKAVLAACSEYFKMLF 53


>AK223618-1|BAD97338.1|  803|Homo sapiens zinc finger and BTB domain
           containing 17 variant protein.
          Length = 803

 Score = 33.9 bits (74), Expect = 0.78
 Identities = 13/23 (56%), Positives = 16/23 (69%)
 Frame = +3

Query: 279 DGASFPVHRAILSACSPYFLALF 347
           DG  F  H+A+L+ACS YF  LF
Sbjct: 31  DGVHFKAHKAVLAACSEYFKMLF 53


>AB037805-1|BAA92622.1|  652|Homo sapiens KIAA1384 protein protein.
          Length = 652

 Score = 33.9 bits (74), Expect = 0.78
 Identities = 14/33 (42%), Positives = 22/33 (66%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTT 353
           CD  + A  G  F  H+A+L++CS YF +LF++
Sbjct: 57  CDVTLTAQ-GQQFHCHKAVLASCSQYFRSLFSS 88


>X53578-1|CAA37641.1|  361|Homo sapiens protein ( Human Lewis blood
           group locus mRNA for  alpha(1,3/1,4)fucosyltransferase
           (EC 2.4.1.65).  ).
          Length = 361

 Score = 33.5 bits (73), Expect = 1.0
 Identities = 12/23 (52%), Positives = 15/23 (65%)
 Frame = +1

Query: 547 IEPKKLSWNYDFCKACFLLQTRS 615
           + P+  SW  DFCKAC+ LQ  S
Sbjct: 326 LRPRSFSWALDFCKACWKLQQES 348


>U27328-1|AAC50187.1|  361|Homo sapiens alpha (1,3/1,4)
           fucosyltransferase protein.
          Length = 361

 Score = 33.5 bits (73), Expect = 1.0
 Identities = 12/23 (52%), Positives = 15/23 (65%)
 Frame = +1

Query: 547 IEPKKLSWNYDFCKACFLLQTRS 615
           + P+  SW  DFCKAC+ LQ  S
Sbjct: 326 LRPRSFSWALDFCKACWKLQQES 348


>U27327-1|AAC50186.1|  361|Homo sapiens alpha (1,3/1,4)
           fucosyltransferase protein.
          Length = 361

 Score = 33.5 bits (73), Expect = 1.0
 Identities = 12/23 (52%), Positives = 15/23 (65%)
 Frame = +1

Query: 547 IEPKKLSWNYDFCKACFLLQTRS 615
           + P+  SW  DFCKAC+ LQ  S
Sbjct: 326 LRPRSFSWALDFCKACWKLQQES 348


>U27326-1|AAC50185.1|  361|Homo sapiens alpha (1,3/1,4)
           fucosyltransferase protein.
          Length = 361

 Score = 33.5 bits (73), Expect = 1.0
 Identities = 12/23 (52%), Positives = 15/23 (65%)
 Frame = +1

Query: 547 IEPKKLSWNYDFCKACFLLQTRS 615
           + P+  SW  DFCKAC+ LQ  S
Sbjct: 326 LRPRSFSWALDFCKACWKLQQES 348


>D89325-1|BAA13942.1|  361|Homo sapiens alpha (1,3/1,4)
           fucosyltransferase protein.
          Length = 361

 Score = 33.5 bits (73), Expect = 1.0
 Identities = 12/23 (52%), Positives = 15/23 (65%)
 Frame = +1

Query: 547 IEPKKLSWNYDFCKACFLLQTRS 615
           + P+  SW  DFCKAC+ LQ  S
Sbjct: 326 LRPRSFSWALDFCKACWKLQQES 348


>D89324-1|BAA13941.1|  361|Homo sapiens alpha (1,3/1,4)
           fucosyltransferase protein.
          Length = 361

 Score = 33.5 bits (73), Expect = 1.0
 Identities = 12/23 (52%), Positives = 15/23 (65%)
 Frame = +1

Query: 547 IEPKKLSWNYDFCKACFLLQTRS 615
           + P+  SW  DFCKAC+ LQ  S
Sbjct: 326 LRPRSFSWALDFCKACWKLQQES 348


>CR533558-1|CAG38589.1|  684|Homo sapiens KBTBD7 protein.
          Length = 684

 Score = 33.5 bits (73), Expect = 1.0
 Identities = 17/73 (23%), Positives = 33/73 (45%)
 Frame = +3

Query: 282 GASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTD 461
           G  F  +R +L+A   YF ++FT  ++  +Q+ V +  V +              + +++
Sbjct: 79  GRLFSCNRNVLAAACSYFKSMFTGGMYESQQASVTMHDVDAESFEVLVDYCYTGRVSLSE 138

Query: 462 TNVHELLMTADYL 500
            NV  L   +D L
Sbjct: 139 ANVQRLYAASDML 151


>BC108675-1|AAI08676.1|  361|Homo sapiens fucosyltransferase 3
           (galactoside 3(4)-L-fucosyltransferase, Lewis blood
           group) protein.
          Length = 361

 Score = 33.5 bits (73), Expect = 1.0
 Identities = 12/23 (52%), Positives = 15/23 (65%)
 Frame = +1

Query: 547 IEPKKLSWNYDFCKACFLLQTRS 615
           + P+  SW  DFCKAC+ LQ  S
Sbjct: 326 LRPRSFSWALDFCKACWKLQQES 348


>BC074837-1|AAH74837.1|  361|Homo sapiens fucosyltransferase 3
           (galactoside 3(4)-L-fucosyltransferase, Lewis blood
           group) protein.
          Length = 361

 Score = 33.5 bits (73), Expect = 1.0
 Identities = 12/23 (52%), Positives = 15/23 (65%)
 Frame = +1

Query: 547 IEPKKLSWNYDFCKACFLLQTRS 615
           + P+  SW  DFCKAC+ LQ  S
Sbjct: 326 LRPRSFSWALDFCKACWKLQQES 348


>BC074836-1|AAH74836.1|  361|Homo sapiens fucosyltransferase 3
           (galactoside 3(4)-L-fucosyltransferase, Lewis blood
           group) protein.
          Length = 361

 Score = 33.5 bits (73), Expect = 1.0
 Identities = 12/23 (52%), Positives = 15/23 (65%)
 Frame = +1

Query: 547 IEPKKLSWNYDFCKACFLLQTRS 615
           + P+  SW  DFCKAC+ LQ  S
Sbjct: 326 LRPRSFSWALDFCKACWKLQQES 348


>AY870341-1|AAW34365.1|  361|Homo sapiens fucosyltransferase 3
           (galactoside 3(4)-L-fucosyltransferase, Lewis blood
           group  protein.
          Length = 361

 Score = 33.5 bits (73), Expect = 1.0
 Identities = 12/23 (52%), Positives = 15/23 (65%)
 Frame = +1

Query: 547 IEPKKLSWNYDFCKACFLLQTRS 615
           + P+  SW  DFCKAC+ LQ  S
Sbjct: 326 LRPRSFSWALDFCKACWKLQQES 348


>AF131913-1|AAD33514.1|  361|Homo sapiens
           alpha-(1,3/1,4)-fucosyltransferase protein.
          Length = 361

 Score = 33.5 bits (73), Expect = 1.0
 Identities = 12/23 (52%), Positives = 15/23 (65%)
 Frame = +1

Query: 547 IEPKKLSWNYDFCKACFLLQTRS 615
           + P+  SW  DFCKAC+ LQ  S
Sbjct: 326 LRPRSFSWALDFCKACWKLQQES 348


>AB043998-1|BAA96390.1|  361|Homo sapiens
           alpha-(1,3/1,4)-fucosyltransferase protein.
          Length = 361

 Score = 33.5 bits (73), Expect = 1.0
 Identities = 12/23 (52%), Positives = 15/23 (65%)
 Frame = +1

Query: 547 IEPKKLSWNYDFCKACFLLQTRS 615
           + P+  SW  DFCKAC+ LQ  S
Sbjct: 326 LRPRSFSWALDFCKACWKLQQES 348


>DQ443529-1|ABE03890.1|  531|Homo sapiens aryl hydrocarbon
           receptor-associated 3 protein.
          Length = 531

 Score = 33.1 bits (72), Expect = 1.4
 Identities = 20/72 (27%), Positives = 39/72 (54%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V Q+C D+L S ++  +C+    FA  +   +L      Y+  + + + ++ +EFL LP 
Sbjct: 6   VKQVCGDYLLSRMDVTSCISYRNFASCMGDSRLLNKVDAYIQEHLLQI-SEEEEFLKLPR 64

Query: 692 DELNSIILEDEL 727
            +L  ++LED +
Sbjct: 65  LKL-EVMLEDNV 75


>DQ443528-1|ABE03889.1|  642|Homo sapiens aryl hydrocarbon
           receptor-associated 3 protein.
          Length = 642

 Score = 33.1 bits (72), Expect = 1.4
 Identities = 20/72 (27%), Positives = 39/72 (54%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V Q+C D+L S ++  +C+    FA  +   +L      Y+  + + + ++ +EFL LP 
Sbjct: 117 VKQVCGDYLLSRMDVTSCISYRNFASCMGDSRLLNKVDAYIQEHLLQI-SEEEEFLKLPR 175

Query: 692 DELNSIILEDEL 727
            +L  ++LED +
Sbjct: 176 LKL-EVMLEDNV 186


>DQ005634-1|AAY55907.1| 1196|Homo sapiens inhibitor of Bruton's
           tyrosine kinase-beta protein.
          Length = 1196

 Score = 33.1 bits (72), Expect = 1.4
 Identities = 13/42 (30%), Positives = 24/42 (57%)
 Frame = +3

Query: 231 STARVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTT 356
           S  + S  CD  +++ DG  FP H+ +L A   YF ++ +++
Sbjct: 760 SQKKCSFLCDVTMKSVDGKEFPCHKCVLCARLEYFHSMLSSS 801


>DQ005633-1|AAY55906.1| 1353|Homo sapiens inhibitor of Bruton's
           tyrosine kinase-alpha protein.
          Length = 1353

 Score = 33.1 bits (72), Expect = 1.4
 Identities = 13/42 (30%), Positives = 24/42 (57%)
 Frame = +3

Query: 231 STARVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTT 356
           S  + S  CD  +++ DG  FP H+ +L A   YF ++ +++
Sbjct: 760 SQKKCSFLCDVTMKSVDGKEFPCHKCVLCARLEYFHSMLSSS 801


>BC113698-1|AAI13699.1| 1353|Homo sapiens inhibitor of Bruton
           agammaglobulinemia tyrosine kinase protein.
          Length = 1353

 Score = 33.1 bits (72), Expect = 1.4
 Identities = 13/42 (30%), Positives = 24/42 (57%)
 Frame = +3

Query: 231 STARVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTT 356
           S  + S  CD  +++ DG  FP H+ +L A   YF ++ +++
Sbjct: 760 SQKKCSFLCDVTMKSVDGKEFPCHKCVLCARLEYFHSMLSSS 801


>BC113696-1|AAI13697.1| 1353|Homo sapiens inhibitor of Bruton
           agammaglobulinemia tyrosine kinase protein.
          Length = 1353

 Score = 33.1 bits (72), Expect = 1.4
 Identities = 13/42 (30%), Positives = 24/42 (57%)
 Frame = +3

Query: 231 STARVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTT 356
           S  + S  CD  +++ DG  FP H+ +L A   YF ++ +++
Sbjct: 760 SQKKCSFLCDVTMKSVDGKEFPCHKCVLCARLEYFHSMLSSS 801


>BC067739-1|AAH67739.1|  642|Homo sapiens IVNS1ABP protein protein.
          Length = 642

 Score = 33.1 bits (72), Expect = 1.4
 Identities = 20/72 (27%), Positives = 39/72 (54%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V Q+C D+L S ++  +C+    FA  +   +L      Y+  + + + ++ +EFL LP 
Sbjct: 117 VKQVCGDYLLSRMDVTSCISYRNFASCMGDSRLLNKVDAYIQEHLLQI-SEEEEFLKLPR 175

Query: 692 DELNSIILEDEL 727
            +L  ++LED +
Sbjct: 176 LKL-EVMLEDNV 186


>AL356273-2|CAI22094.1|  642|Homo sapiens influenza virus NS1A
           binding protein protein.
          Length = 642

 Score = 33.1 bits (72), Expect = 1.4
 Identities = 20/72 (27%), Positives = 39/72 (54%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V Q+C D+L S ++  +C+    FA  +   +L      Y+  + + + ++ +EFL LP 
Sbjct: 117 VKQVCGDYLLSRMDVTSCISYRNFASCMGDSRLLNKVDAYIQEHLLQI-SEEEEFLKLPR 175

Query: 692 DELNSIILEDEL 727
            +L  ++LED +
Sbjct: 176 LKL-EVMLEDNV 186


>AL078644-3|CAB72329.1|  642|Homo sapiens influenza virus NS1A
           binding protein protein.
          Length = 642

 Score = 33.1 bits (72), Expect = 1.4
 Identities = 20/72 (27%), Positives = 39/72 (54%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V Q+C D+L S ++  +C+    FA  +   +L      Y+  + + + ++ +EFL LP 
Sbjct: 117 VKQVCGDYLLSRMDVTSCISYRNFASCMGDSRLLNKVDAYIQEHLLQI-SEEEEFLKLPR 175

Query: 692 DELNSIILEDEL 727
            +L  ++LED +
Sbjct: 176 LKL-EVMLEDNV 186


>AL050333-2|CAI23416.1| 1187|Homo sapiens RP1-93K22.1 protein.
          Length = 1187

 Score = 33.1 bits (72), Expect = 1.4
 Identities = 13/42 (30%), Positives = 24/42 (57%)
 Frame = +3

Query: 231 STARVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTT 356
           S  + S  CD  +++ DG  FP H+ +L A   YF ++ +++
Sbjct: 756 SQKKCSFLCDVTMKSVDGKEFPCHKCVLCARLEYFHSMLSSS 797


>AF205218-1|AAG43485.1|  642|Homo sapiens NS1-binding protein-like
           protein protein.
          Length = 642

 Score = 33.1 bits (72), Expect = 1.4
 Identities = 20/72 (27%), Positives = 39/72 (54%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V Q+C D+L S ++  +C+    FA  +   +L      Y+  + + + ++ +EFL LP 
Sbjct: 117 VKQVCGDYLLSRMDVTSCISYRNFASCMGDSRLLNKVDAYIQEHLLQI-SEEEEFLKLPR 175

Query: 692 DELNSIILEDEL 727
            +L  ++LED +
Sbjct: 176 LKL-EVMLEDNV 186


>AB037838-1|BAA92655.2| 1379|Homo sapiens KIAA1417 protein protein.
          Length = 1379

 Score = 33.1 bits (72), Expect = 1.4
 Identities = 13/42 (30%), Positives = 24/42 (57%)
 Frame = +3

Query: 231 STARVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTT 356
           S  + S  CD  +++ DG  FP H+ +L A   YF ++ +++
Sbjct: 786 SQKKCSFLCDVTMKSVDGKEFPCHKCVLCARLEYFHSMLSSS 827


>AB020657-1|BAA74873.2|  644|Homo sapiens KIAA0850 protein protein.
          Length = 644

 Score = 33.1 bits (72), Expect = 1.4
 Identities = 20/72 (27%), Positives = 39/72 (54%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V Q+C D+L S ++  +C+    FA  +   +L      Y+  + + + ++ +EFL LP 
Sbjct: 119 VKQVCGDYLLSRMDVTSCISYRNFASCMGDSRLLNKVDAYIQEHLLQI-SEEEEFLKLPR 177

Query: 692 DELNSIILEDEL 727
            +L  ++LED +
Sbjct: 178 LKL-EVMLEDNV 188


>Z97184-1|CAB09990.1|  634|Homo sapiens zinc finger protein 297
           protein.
          Length = 634

 Score = 32.7 bits (71), Expect = 1.8
 Identities = 14/27 (51%), Positives = 17/27 (62%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYF 335
           CD  +R   G  F  HRA+L+A SPYF
Sbjct: 57  CDVSIRVQ-GREFRAHRAVLAASSPYF 82


>Y12726-1|CAA73258.1|  449|Homo sapiens zinc finger protein ZFP161
           protein.
          Length = 449

 Score = 32.7 bits (71), Expect = 1.8
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALF 347
           CD  +  +D   F  HR +L+ACS YF  LF
Sbjct: 36  CDIAIVVED-VKFRAHRCVLAACSTYFKKLF 65


>EF120357-1|ABL98073.1|  619|Homo sapiens zinc finger and BTB domain
           containing 7C protein.
          Length = 619

 Score = 32.7 bits (71), Expect = 1.8
 Identities = 23/93 (24%), Positives = 39/93 (41%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++   +   +  HR++L+ACS YF  LFT    + +     I  V+           
Sbjct: 34  CDVLLVVQE-QEYRTHRSVLAACSKYFKKLFTAGTLASQPYVYEIDFVQPEALAAILEFA 92

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLECFSFVAI 533
               + +T  NV  +L  A  L  ++C   V +
Sbjct: 93  YTSTLTITAGNVKHILNAARMLE-IQCIVNVCL 124


>D89859-1|BAA20131.1|  449|Homo sapiens zinc finger 5 protein
           protein.
          Length = 449

 Score = 32.7 bits (71), Expect = 1.8
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALF 347
           CD  +  +D   F  HR +L+ACS YF  LF
Sbjct: 36  CDIAIVVED-VKFRAHRCVLAACSTYFKKLF 65


>BX248088-6|CAM25704.1|  149|Homo sapiens zinc finger and BTB domain
           containing 22 protein.
          Length = 149

 Score = 32.7 bits (71), Expect = 1.8
 Identities = 14/27 (51%), Positives = 17/27 (62%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYF 335
           CD  +R   G  F  HRA+L+A SPYF
Sbjct: 57  CDVSIRVQ-GREFRAHRAVLAASSPYF 82


>BX248088-5|CAI41787.2|  634|Homo sapiens zinc finger and BTB domain
           containing 22 protein.
          Length = 634

 Score = 32.7 bits (71), Expect = 1.8
 Identities = 14/27 (51%), Positives = 17/27 (62%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYF 335
           CD  +R   G  F  HRA+L+A SPYF
Sbjct: 57  CDVSIRVQ-GREFRAHRAVLAASSPYF 82


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 122,437,110
Number of Sequences: 237096
Number of extensions: 2672702
Number of successful extensions: 6175
Number of sequences better than 10.0: 297
Number of HSP's better than 10.0 without gapping: 5595
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6141
length of database: 76,859,062
effective HSP length: 90
effective length of database: 55,520,422
effective search space used: 11159604822
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -