SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30149.Seq
         (867 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC024009-1|AAH24009.3|  725|Homo sapiens leucine rich repeat con...    32   3.1  
AK058059-1|BAB71645.1|  524|Homo sapiens protein ( Homo sapiens ...    32   3.1  

>BC024009-1|AAH24009.3|  725|Homo sapiens leucine rich repeat
           containing 50 protein.
          Length = 725

 Score = 31.9 bits (69), Expect = 3.1
 Identities = 18/44 (40%), Positives = 22/44 (50%)
 Frame = +2

Query: 257 VPAKNPHAPPPVSVKTTGPVWDIGQVLKAARLLCKPPQQVDFED 388
           +PA+ P  PPPV VK      +    L A  LL  PP +V  ED
Sbjct: 442 LPAEAPPPPPPVEVKGEDGDQEPEGTLPAETLLLSPPVKVKGED 485


>AK058059-1|BAB71645.1|  524|Homo sapiens protein ( Homo sapiens
           cDNA FLJ25330 fis, clone TST00576. ).
          Length = 524

 Score = 31.9 bits (69), Expect = 3.1
 Identities = 18/44 (40%), Positives = 22/44 (50%)
 Frame = +2

Query: 257 VPAKNPHAPPPVSVKTTGPVWDIGQVLKAARLLCKPPQQVDFED 388
           +PA+ P  PPPV VK      +    L A  LL  PP +V  ED
Sbjct: 241 LPAEAPPPPPPVEVKGEDGDQEPEGTLPAETLLLSPPVKVKGED 284


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 122,070,294
Number of Sequences: 237096
Number of extensions: 2592109
Number of successful extensions: 9024
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 8740
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9024
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 11095746082
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -