SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30148.Seq
         (812 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U47292-1|AAB05397.1|  129|Homo sapiens spasmolytic peptide protein.    32   2.1  
BC032820-1|AAH32820.1|  129|Homo sapiens trefoil factor 2 (spasm...    32   2.1  
AB038162-2|BAB13730.1|  129|Homo sapiens trefoil factor 2 protein.     32   2.1  
X51698-1|CAA35995.1|  130|Homo sapiens spasmolytic polypeptide p...    32   2.8  
AB051390-1|BAB18461.1|  807|Homo sapiens VSGP/F-spondin protein.       30   8.7  

>U47292-1|AAB05397.1|  129|Homo sapiens spasmolytic peptide protein.
          Length = 129

 Score = 32.3 bits (70), Expect = 2.1
 Identities = 27/91 (29%), Positives = 40/91 (43%), Gaps = 15/91 (16%)
 Frame = -3

Query: 447 SPENGSVCSFP------LFDLRFCF*SKVRQQSLCMLVPYQIPL*QWSRC------RNNC 304
           SP N + C FP       FD   CF S V     C    + +P  +  +C      R NC
Sbjct: 35  SPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCF---HPLPKQESDQCVMEVSDRRNC 91

Query: 303 LSP*FAPDQCSSSKISVQG-VFDIP--HFPR 220
             P  +P++C+S K      +F++P   FP+
Sbjct: 92  GYPGISPEECASRKCCFSNFIFEVPWCFFPK 122


>BC032820-1|AAH32820.1|  129|Homo sapiens trefoil factor 2
           (spasmolytic protein 1) protein.
          Length = 129

 Score = 32.3 bits (70), Expect = 2.1
 Identities = 27/91 (29%), Positives = 40/91 (43%), Gaps = 15/91 (16%)
 Frame = -3

Query: 447 SPENGSVCSFP------LFDLRFCF*SKVRQQSLCMLVPYQIPL*QWSRC------RNNC 304
           SP N + C FP       FD   CF S V     C    + +P  +  +C      R NC
Sbjct: 35  SPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCF---HPLPKQESDQCVMEVSDRRNC 91

Query: 303 LSP*FAPDQCSSSKISVQG-VFDIP--HFPR 220
             P  +P++C+S K      +F++P   FP+
Sbjct: 92  GYPGISPEECASRKCCFSNFIFEVPWCFFPK 122


>AB038162-2|BAB13730.1|  129|Homo sapiens trefoil factor 2 protein.
          Length = 129

 Score = 32.3 bits (70), Expect = 2.1
 Identities = 27/91 (29%), Positives = 40/91 (43%), Gaps = 15/91 (16%)
 Frame = -3

Query: 447 SPENGSVCSFP------LFDLRFCF*SKVRQQSLCMLVPYQIPL*QWSRC------RNNC 304
           SP N + C FP       FD   CF S V     C    + +P  +  +C      R NC
Sbjct: 35  SPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCF---HPLPKQESDQCVMEVSDRRNC 91

Query: 303 LSP*FAPDQCSSSKISVQG-VFDIP--HFPR 220
             P  +P++C+S K      +F++P   FP+
Sbjct: 92  GYPGISPEECASRKCCFSNFIFEVPWCFFPK 122


>X51698-1|CAA35995.1|  130|Homo sapiens spasmolytic polypeptide
           protein.
          Length = 130

 Score = 31.9 bits (69), Expect = 2.8
 Identities = 25/85 (29%), Positives = 37/85 (43%), Gaps = 13/85 (15%)
 Frame = -3

Query: 447 SPENGSVCSFP------LFDLRFCF*SKVRQQSLCMLVPYQIPL*QWSRC------RNNC 304
           SP N + C FP       FD   CF S V     C    + +P  +  +C      R NC
Sbjct: 36  SPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCF---HPLPKQESDQCVMEVSDRRNC 92

Query: 303 LSP*FAPDQCSSSKISVQG-VFDIP 232
             P  +P++C+S K      +F++P
Sbjct: 93  GYPGISPEECASRKCCFSNFIFEVP 117


>AB051390-1|BAB18461.1|  807|Homo sapiens VSGP/F-spondin protein.
          Length = 807

 Score = 30.3 bits (65), Expect = 8.7
 Identities = 13/47 (27%), Positives = 23/47 (48%)
 Frame = -3

Query: 444 PENGSVCSFPLFDLRFCF*SKVRQQSLCMLVPYQIPL*QWSRCRNNC 304
           PE+GSVC+ P  ++  C  ++    S C++  +     +W  C   C
Sbjct: 532 PEDGSVCTLPTEEMEKCTVNEECSPSSCLMTEWG----EWDECSATC 574


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 101,322,576
Number of Sequences: 237096
Number of extensions: 1854601
Number of successful extensions: 4850
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 4520
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4844
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 10092110758
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -