SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30147.Seq
         (878 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X70940-1|CAA50280.1|  463|Homo sapiens elongation factor 1 alpha...   280   5e-75
L10340-1|AAA91835.1|  435|Homo sapiens elongation factor-1 alpha...   280   5e-75
BC110409-1|AAI10410.1|  463|Homo sapiens eukaryotic translation ...   280   5e-75
BC000432-1|AAH00432.1|  463|Homo sapiens eukaryotic translation ...   280   5e-75
AL121829-9|CAC15522.1|  463|Homo sapiens EEF1A2 protein.              280   5e-75
AF163763-1|AAF80488.1|  463|Homo sapiens elongation factor 1 A-2...   280   5e-75
AB209064-1|BAD92301.1|  340|Homo sapiens eukaryotic translation ...   280   5e-75
AF267861-1|AAG44730.1|  427|Homo sapiens EF1a-like protein protein.   278   2e-74
AK223046-1|BAD96766.1|  462|Homo sapiens eukaryotic translation ...   277   4e-74
AK222551-1|BAD96271.1|  462|Homo sapiens eukaryotic translation ...   277   5e-74
X03558-1|CAA27245.1|  462|Homo sapiens protein ( Human mRNA for ...   276   7e-74
J04617-1|AAA52343.1|  462|Homo sapiens EEF1A protein.                 276   7e-74
EF362804-1|ABO30531.1|  462|Homo sapiens EF1a protein.                276   7e-74
BC111051-1|AAI11052.1|  462|Homo sapiens eukaryotic translation ...   276   7e-74
BC082268-1|AAH82268.1|  462|Homo sapiens eukaryotic translation ...   276   7e-74
BC072385-1|AAH72385.1|  462|Homo sapiens eukaryotic translation ...   276   7e-74
BC071841-1|AAH71841.1|  462|Homo sapiens eukaryotic translation ...   276   7e-74
BC071741-1|AAH71741.1|  462|Homo sapiens eukaryotic translation ...   276   7e-74
BC071727-1|AAH71727.1|  462|Homo sapiens eukaryotic translation ...   276   7e-74
BC066893-1|AAH66893.1|  462|Homo sapiens eukaryotic translation ...   276   7e-74
BC057391-1|AAH57391.1|  462|Homo sapiens eukaryotic translation ...   276   7e-74
BC038339-1|AAH38339.1|  462|Homo sapiens eukaryotic translation ...   276   7e-74
BC028674-1|AAH28674.1|  462|Homo sapiens eukaryotic translation ...   276   7e-74
BC021686-1|AAH21686.1|  462|Homo sapiens eukaryotic translation ...   276   7e-74
BC019669-1|AAH19669.1|  462|Homo sapiens EEF1A1 protein protein.      276   7e-74
BC018641-1|AAH18641.1|  462|Homo sapiens eukaryotic translation ...   276   7e-74
BC018150-1|AAH18150.1|  462|Homo sapiens eukaryotic translation ...   276   7e-74
BC014224-1|AAH14224.1|  462|Homo sapiens eukaryotic translation ...   276   7e-74
BC012891-1|AAH12891.1|  462|Homo sapiens eukaryotic translation ...   276   7e-74
BC010735-1|AAH10735.1|  462|Homo sapiens eukaryotic translation ...   276   7e-74
BC009875-1|AAH09875.1|  462|Homo sapiens eukaryotic translation ...   276   7e-74
BC009733-1|AAH09733.1|  462|Homo sapiens eukaryotic translation ...   276   7e-74
BC008587-1|AAH08587.1|  462|Homo sapiens eukaryotic translation ...   276   7e-74
AY043301-1|AAK95378.1|  462|Homo sapiens elongation factor 1-alp...   276   7e-74
AL603910-8|CAI14883.1|  462|Homo sapiens eukaryotic translation ...   276   7e-74
AL593851-4|CAH73620.1|  462|Homo sapiens eukaryotic translation ...   276   7e-74
AK223030-1|BAD96750.1|  462|Homo sapiens eukaryotic translation ...   276   7e-74
AK222982-1|BAD96702.1|  462|Homo sapiens eukaryotic translation ...   276   7e-74
AK222523-1|BAD96243.1|  462|Homo sapiens eukaryotic translation ...   276   7e-74
AK222515-1|BAD96235.1|  462|Homo sapiens eukaryotic translation ...   276   7e-74
AF397403-1|AAK93966.1|  398|Homo sapiens translation elongation ...   276   7e-74
X16869-1|CAA34756.1|  462|Homo sapiens protein ( Human mRNA for ...   275   2e-73
L41498-1|AAC09386.1|  398|Homo sapiens longation factor 1-alpha ...   274   2e-73
L41490-1|AAC09385.1|  398|Homo sapiens eukaryotic translation el...   274   2e-73
AY062434-1|AAL38981.1|  398|Homo sapiens elongation factor 1-alp...   274   2e-73
AK223042-1|BAD96762.1|  433|Homo sapiens eukaryotic translation ...   274   3e-73
AF174496-1|AAF36537.1|  426|Homo sapiens glucocorticoid receptor...   267   3e-71
BC071619-1|AAH71619.1|  441|Homo sapiens EEF1A1 protein protein.      232   1e-60
AK222519-1|BAD96239.1|  366|Homo sapiens eukaryotic translation ...   225   2e-58
AF328730-1|AAN09722.1|  361|Homo sapiens CTCL tumor antigen HD-C...   214   3e-55
AF322220-1|AAN51932.1|  361|Homo sapiens cervical cancer suppres...   214   3e-55
AL603910-9|CAI40951.1|  145|Homo sapiens eukaryotic translation ...   150   6e-36
X03689-1|CAA27325.1|   94|Homo sapiens protein ( Human mRNA frag...   145   2e-34
BC070131-1|AAH70131.1|  111|Homo sapiens EEF1A1 protein protein.      145   2e-34
AL603910-10|CAO03613.1|  107|Homo sapiens eukaryotic translation...   145   2e-34
M29548-1|AAA52367.1|  327|Homo sapiens EEF1A protein.                 143   7e-34
U87791-1|AAD00645.1|  684|Homo sapiens eRFS protein.                  142   2e-33
BC040849-1|AAH40849.1|  684|Homo sapiens HBS1-like (S. cerevisia...   142   2e-33
BC001465-1|AAH01465.1|  684|Homo sapiens HBS1-like (S. cerevisia...   142   2e-33
AL445190-5|CAI95161.1|  684|Homo sapiens HBS1-like (S. cerevisia...   142   2e-33
AL353596-2|CAI17912.1|  684|Homo sapiens HBS1-like (S. cerevisia...   142   2e-33
AJ459826-1|CAD30873.1|  684|Homo sapiens HBS1-like protein protein.   142   2e-33
AB028961-1|BAA82990.1|  496|Homo sapiens KIAA1038 protein protein.    142   2e-33
X17644-1|CAA35635.1|  499|Homo sapiens protein ( Human GST1-Hs m...   131   3e-30
U95742-2|AAB67250.1|  499|Homo sapiens G1 to S phase transition ...   131   3e-30
BT006722-1|AAP35368.1|  498|Homo sapiens G1 to S phase transitio...   131   3e-30
BC009503-1|AAH09503.2|  633|Homo sapiens GSPT1 protein protein.       131   3e-30
BC036077-1|AAH36077.1|  628|Homo sapiens G1 to S phase transitio...   128   3e-29
AL929101-2|CAH71524.1|  628|Homo sapiens G1 to S phase transitio...   127   5e-29
AK023155-1|BAB14435.1|  504|Homo sapiens protein ( Homo sapiens ...   127   5e-29
AJ251548-1|CAB91089.1|  628|Homo sapiens polypeptide chain relea...   127   5e-29
AK001303-1|BAA91612.1|  628|Homo sapiens protein ( Homo sapiens ...   127   6e-29
BC094687-1|AAH94687.1|  308|Homo sapiens EEF1A1 protein protein.      115   2e-25
BC063511-1|AAH63511.1|  290|Homo sapiens EEF1A1 protein protein.      115   2e-25
BC014377-1|AAH14377.1|  287|Homo sapiens Unknown (protein for IM...   115   2e-25
BC070500-1|AAH70500.1|   67|Homo sapiens EEF1A1 protein protein.      108   3e-23
AL445190-4|CAI95162.1|  453|Homo sapiens HBS1-like (S. cerevisia...    86   1e-16
AL353596-1|CAI17913.1|  453|Homo sapiens HBS1-like (S. cerevisia...    86   1e-16
X84694-1|CAA59169.1|  452|Homo sapiens mitochondrial elongation ...    68   4e-11
S75463-1|AAC60647.1|  452|Homo sapiens P43 protein.                    68   4e-11
L38995-1|AAB00499.1|  452|Homo sapiens elongation factor Tu prot...    68   4e-11
BC010041-1|AAH10041.2|  455|Homo sapiens Tu translation elongati...    68   4e-11
BC001633-1|AAH01633.2|  455|Homo sapiens Tu translation elongati...    68   4e-11
BC065761-1|AAH65761.1|  251|Homo sapiens EEF1A1 protein protein.       52   3e-06
BC022412-1|AAH22412.1|  250|Homo sapiens Unknown (protein for IM...    52   3e-06
BC014892-1|AAH14892.1|  248|Homo sapiens Unknown (protein for IM...    45   3e-04
BC007933-1|AAH07933.1|  569|Homo sapiens EEFSEC protein protein.       38   0.063
AF268872-1|AAG13375.1|  526|Homo sapiens MJ0495-like protein Sel...    38   0.063
L19161-1|AAA19696.1|  472|Homo sapiens translation initiation fa...    36   0.15 
DQ120619-1|ABB92405.1|  471|Homo sapiens eFI-2-gamma protein.          36   0.15 
BC087847-1|AAH87847.1|  465|Homo sapiens Unknown (protein for IM...    36   0.15 
BC019906-1|AAH19906.1|  472|Homo sapiens eukaryotic translation ...    36   0.15 
AK222577-1|BAD96297.1|  472|Homo sapiens eukaryotic translation ...    36   0.15 
AJ006932-1|CAA07331.1|  248|Homo sapiens eIF-2gA protein.              36   0.15 
L34600-1|AAA67038.1|  727|Homo sapiens initiation factor 2 protein.    36   0.26 
BC064977-1|AAH64977.1|  465|Homo sapiens MTIF2 protein protein.        36   0.26 
BC039848-1|AAH39848.1|  500|Homo sapiens Similar to mitochondria...    36   0.26 
AF495546-1|AAM70196.1|  727|Homo sapiens translation initiation ...    36   0.26 
AF494407-1|AAM14617.1|  727|Homo sapiens mitochondrial translati...    36   0.26 
M27364-1|AAA52344.1|  227|Homo sapiens EEF1A protein.                  35   0.34 
Z11692-1|CAA77750.1|  858|Homo sapiens human  elongation factor ...    33   1.8  
X51466-1|CAA35829.1|  858|Homo sapiens elongation factor 2 protein.    33   1.8  
BC126259-1|AAI26260.1|  858|Homo sapiens EEF2 protein protein.         33   1.8  
BC006547-1|AAH06547.1|  583|Homo sapiens EEF2 protein protein.         33   1.8  
AY942181-1|AAX34409.1|  858|Homo sapiens elongation factor 2 pro...    33   1.8  
AK023282-1|BAB14507.1|  669|Homo sapiens protein ( Homo sapiens ...    32   2.4  
BC036768-1|AAH36768.1|  669|Homo sapiens GUF1 GTPase homolog (S....    31   4.2  
BC030612-1|AAH30612.1|  777|Homo sapiens G elongation factor, mi...    31   4.2  
BC015712-1|AAH15712.1|  779|Homo sapiens GFM2 protein protein.         31   4.2  
AY453587-1|AAS49035.1|  531|Homo sapiens elongation factor G iso...    31   4.2  
AK025314-1|BAB15109.1|  513|Homo sapiens protein ( Homo sapiens ...    31   4.2  
AF367997-1|AAK53401.1|  779|Homo sapiens elongation factor G2 pr...    31   4.2  
AF111808-1|AAL39010.1|  732|Homo sapiens MSTP027 protein.              31   4.2  
BC049210-1|AAH49210.1|  751|Homo sapiens G elongation factor, mi...    31   7.3  
BC032639-1|AAH32639.1| 1220|Homo sapiens eukaryotic translation ...    31   7.3  
AL133563-1|CAB63717.1| 1132|Homo sapiens hypothetical protein pr...    31   7.3  
AJ006776-1|CAB44357.1| 1220|Homo sapiens IF2 protein protein.          31   7.3  
AF367998-1|AAK53402.1|  751|Homo sapiens elongation factor G1 pr...    31   7.3  
AF309777-1|AAK58877.1|  751|Homo sapiens elongation factor G pro...    31   7.3  
AF078035-1|AAD16006.1| 1220|Homo sapiens translation initiation ...    31   7.3  
AC018690-1|AAY24313.1|  728|Homo sapiens unknown protein.              31   7.3  
AB018284-1|BAA34461.2| 1222|Homo sapiens KIAA0741 protein protein.     31   7.3  

>X70940-1|CAA50280.1|  463|Homo sapiens elongation factor 1 alpha-2
           protein.
          Length = 463

 Score =  280 bits (686), Expect = 5e-75
 Identities = 133/195 (68%), Positives = 148/195 (75%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFET+KYY+TIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 73  IDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNPA V FVP
Sbjct: 133 TREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGWHGDNMLEPS  MPWFKGW+VERKEG A G  L+EALD ILPP RP   P   P + 
Sbjct: 193 ISGWHGDNMLEPSPNMPWFKGWKVERKEGNASGVSLLEALDTILPPTRPTDKPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 2e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>L10340-1|AAA91835.1|  435|Homo sapiens elongation factor-1 alpha
           protein.
          Length = 435

 Score =  280 bits (686), Expect = 5e-75
 Identities = 133/195 (68%), Positives = 148/195 (75%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFET+KYY+TIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 45  IDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 104

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNPA V FVP
Sbjct: 105 TREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVP 164

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGWHGDNMLEPS  MPWFKGW+VERKEG A G  L+EALD ILPP RP   P   P + 
Sbjct: 165 ISGWHGDNMLEPSPNMPWFKGWKVERKEGNASGVSLLEALDTILPPTRPTDKPLRLPLQD 224

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 225 VYKIGGIGTVPVGRV 239



 Score = 87.4 bits (207), Expect = 6e-17
 Identities = 39/40 (97%), Positives = 39/40 (97%)
 Frame = +3

Query: 126 YKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 245
           YKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAERE
Sbjct: 1   YKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERE 40


>BC110409-1|AAI10410.1|  463|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 2 protein.
          Length = 463

 Score =  280 bits (686), Expect = 5e-75
 Identities = 133/195 (68%), Positives = 148/195 (75%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFET+KYY+TIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 73  IDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNPA V FVP
Sbjct: 133 TREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGWHGDNMLEPS  MPWFKGW+VERKEG A G  L+EALD ILPP RP   P   P + 
Sbjct: 193 ISGWHGDNMLEPSPNMPWFKGWKVERKEGNASGVSLLEALDTILPPTRPTDKPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 2e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>BC000432-1|AAH00432.1|  463|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 2 protein.
          Length = 463

 Score =  280 bits (686), Expect = 5e-75
 Identities = 133/195 (68%), Positives = 148/195 (75%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFET+KYY+TIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 73  IDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNPA V FVP
Sbjct: 133 TREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGWHGDNMLEPS  MPWFKGW+VERKEG A G  L+EALD ILPP RP   P   P + 
Sbjct: 193 ISGWHGDNMLEPSPNMPWFKGWKVERKEGNASGVSLLEALDTILPPTRPTDKPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 2e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>AL121829-9|CAC15522.1|  463|Homo sapiens EEF1A2 protein.
          Length = 463

 Score =  280 bits (686), Expect = 5e-75
 Identities = 133/195 (68%), Positives = 148/195 (75%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFET+KYY+TIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 73  IDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNPA V FVP
Sbjct: 133 TREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGWHGDNMLEPS  MPWFKGW+VERKEG A G  L+EALD ILPP RP   P   P + 
Sbjct: 193 ISGWHGDNMLEPSPNMPWFKGWKVERKEGNASGVSLLEALDTILPPTRPTDKPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 2e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>AF163763-1|AAF80488.1|  463|Homo sapiens elongation factor 1 A-2
           protein.
          Length = 463

 Score =  280 bits (686), Expect = 5e-75
 Identities = 133/195 (68%), Positives = 148/195 (75%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFET+KYY+TIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 73  IDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNPA V FVP
Sbjct: 133 TREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGWHGDNMLEPS  MPWFKGW+VERKEG A G  L+EALD ILPP RP   P   P + 
Sbjct: 193 ISGWHGDNMLEPSPNMPWFKGWKVERKEGNASGVSLLEALDTILPPTRPTDKPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 2e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>AB209064-1|BAD92301.1|  340|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 2 variant protein.
          Length = 340

 Score =  280 bits (686), Expect = 5e-75
 Identities = 133/195 (68%), Positives = 148/195 (75%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFET+KYY+TIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 49  IDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 108

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNPA V FVP
Sbjct: 109 TREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVP 168

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGWHGDNMLEPS  MPWFKGW+VERKEG A G  L+EALD ILPP RP   P   P + 
Sbjct: 169 ISGWHGDNMLEPSPNMPWFKGWKVERKEGNASGVSLLEALDTILPPTRPTDKPLRLPLQD 228

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 229 VYKIGGIGTVPVGRV 243



 Score = 47.6 bits (108), Expect = 6e-05
 Identities = 20/21 (95%), Positives = 21/21 (100%)
 Frame = +3

Query: 183 EMGKGSFKYAWVLDKLKAERE 245
           +MGKGSFKYAWVLDKLKAERE
Sbjct: 24  QMGKGSFKYAWVLDKLKAERE 44


>AF267861-1|AAG44730.1|  427|Homo sapiens EF1a-like protein protein.
          Length = 427

 Score =  278 bits (682), Expect = 2e-74
 Identities = 133/199 (66%), Positives = 148/199 (74%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 73  IDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNP  VAFVP
Sbjct: 133 TREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD ILPP RP   P   P + 
Sbjct: 193 ISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI*NWC 852
           +         P G   +WC
Sbjct: 253 VYKIGGIGTVPVGPSGDWC 271



 Score =  145 bits (352), Expect = 2e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>AK223046-1|BAD96766.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 462

 Score =  277 bits (679), Expect = 4e-74
 Identities = 132/195 (67%), Positives = 147/195 (75%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 73  IDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNP  VAFVP
Sbjct: 133 TREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIAKEVSTYIKKIGYNPDTVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD ILPP RP   P   P + 
Sbjct: 193 ISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 2e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>AK222551-1|BAD96271.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 462

 Score =  277 bits (678), Expect = 5e-74
 Identities = 132/195 (67%), Positives = 147/195 (75%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 73  IDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNP  VAFVP
Sbjct: 133 TREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD ILPP RP   P   P + 
Sbjct: 193 ISGWNGDNMLEPSANMPWFKGWEVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 2e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>X03558-1|CAA27245.1|  462|Homo sapiens protein ( Human mRNA for
           elongation factor 1 alpha subunit (EF-1 alpha). ).
          Length = 462

 Score =  276 bits (677), Expect = 7e-74
 Identities = 132/195 (67%), Positives = 147/195 (75%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 73  IDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNP  VAFVP
Sbjct: 133 TREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD ILPP RP   P   P + 
Sbjct: 193 ISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 2e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>J04617-1|AAA52343.1|  462|Homo sapiens EEF1A protein.
          Length = 462

 Score =  276 bits (677), Expect = 7e-74
 Identities = 132/195 (67%), Positives = 147/195 (75%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 73  IDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNP  VAFVP
Sbjct: 133 TREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD ILPP RP   P   P + 
Sbjct: 193 ISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 2e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>EF362804-1|ABO30531.1|  462|Homo sapiens EF1a protein.
          Length = 462

 Score =  276 bits (677), Expect = 7e-74
 Identities = 132/195 (67%), Positives = 147/195 (75%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 73  IDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNP  VAFVP
Sbjct: 133 TREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD ILPP RP   P   P + 
Sbjct: 193 ISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 2e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>BC111051-1|AAI11052.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  276 bits (677), Expect = 7e-74
 Identities = 132/195 (67%), Positives = 147/195 (75%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 73  IDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNP  VAFVP
Sbjct: 133 TREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD ILPP RP   P   P + 
Sbjct: 193 ISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 2e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>BC082268-1|AAH82268.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  276 bits (677), Expect = 7e-74
 Identities = 132/195 (67%), Positives = 147/195 (75%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 73  IDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNP  VAFVP
Sbjct: 133 TREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD ILPP RP   P   P + 
Sbjct: 193 ISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 2e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>BC072385-1|AAH72385.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  276 bits (677), Expect = 7e-74
 Identities = 132/195 (67%), Positives = 147/195 (75%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 73  IDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNP  VAFVP
Sbjct: 133 TREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD ILPP RP   P   P + 
Sbjct: 193 ISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 2e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>BC071841-1|AAH71841.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  276 bits (677), Expect = 7e-74
 Identities = 132/195 (67%), Positives = 147/195 (75%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 73  IDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNP  VAFVP
Sbjct: 133 TREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD ILPP RP   P   P + 
Sbjct: 193 ISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 2e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>BC071741-1|AAH71741.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  276 bits (677), Expect = 7e-74
 Identities = 132/195 (67%), Positives = 147/195 (75%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 73  IDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNP  VAFVP
Sbjct: 133 TREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD ILPP RP   P   P + 
Sbjct: 193 ISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 2e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>BC071727-1|AAH71727.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  276 bits (677), Expect = 7e-74
 Identities = 132/195 (67%), Positives = 147/195 (75%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 73  IDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNP  VAFVP
Sbjct: 133 TREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD ILPP RP   P   P + 
Sbjct: 193 ISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  141 bits (341), Expect = 3e-33
 Identities = 66/68 (97%), Positives = 66/68 (97%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKFGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>BC066893-1|AAH66893.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  276 bits (677), Expect = 7e-74
 Identities = 132/195 (67%), Positives = 147/195 (75%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 73  IDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNP  VAFVP
Sbjct: 133 TREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD ILPP RP   P   P + 
Sbjct: 193 ISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 2e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>BC057391-1|AAH57391.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  276 bits (677), Expect = 7e-74
 Identities = 132/195 (67%), Positives = 147/195 (75%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 73  IDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNP  VAFVP
Sbjct: 133 TREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD ILPP RP   P   P + 
Sbjct: 193 ISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 2e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>BC038339-1|AAH38339.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  276 bits (677), Expect = 7e-74
 Identities = 132/195 (67%), Positives = 147/195 (75%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 73  IDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNP  VAFVP
Sbjct: 133 TREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD ILPP RP   P   P + 
Sbjct: 193 ISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 2e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>BC028674-1|AAH28674.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  276 bits (677), Expect = 7e-74
 Identities = 132/195 (67%), Positives = 147/195 (75%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 73  IDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNP  VAFVP
Sbjct: 133 TREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD ILPP RP   P   P + 
Sbjct: 193 ISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 2e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>BC021686-1|AAH21686.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  276 bits (677), Expect = 7e-74
 Identities = 132/195 (67%), Positives = 147/195 (75%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 73  IDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNP  VAFVP
Sbjct: 133 TREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD ILPP RP   P   P + 
Sbjct: 193 ISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 2e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>BC019669-1|AAH19669.1|  462|Homo sapiens EEF1A1 protein protein.
          Length = 462

 Score =  276 bits (677), Expect = 7e-74
 Identities = 132/195 (67%), Positives = 147/195 (75%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 73  IDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNP  VAFVP
Sbjct: 133 TREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD ILPP RP   P   P + 
Sbjct: 193 ISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 2e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>BC018641-1|AAH18641.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  276 bits (677), Expect = 7e-74
 Identities = 132/195 (67%), Positives = 147/195 (75%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 73  IDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNP  VAFVP
Sbjct: 133 TREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD ILPP RP   P   P + 
Sbjct: 193 ISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 2e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>BC018150-1|AAH18150.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  276 bits (677), Expect = 7e-74
 Identities = 132/195 (67%), Positives = 147/195 (75%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 73  IDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNP  VAFVP
Sbjct: 133 TREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD ILPP RP   P   P + 
Sbjct: 193 ISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 2e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>BC014224-1|AAH14224.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  276 bits (677), Expect = 7e-74
 Identities = 132/195 (67%), Positives = 147/195 (75%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 73  IDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNP  VAFVP
Sbjct: 133 TREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD ILPP RP   P   P + 
Sbjct: 193 ISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 2e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>BC012891-1|AAH12891.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  276 bits (677), Expect = 7e-74
 Identities = 132/195 (67%), Positives = 147/195 (75%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 73  IDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNP  VAFVP
Sbjct: 133 TREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD ILPP RP   P   P + 
Sbjct: 193 ISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 2e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>BC010735-1|AAH10735.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  276 bits (677), Expect = 7e-74
 Identities = 132/195 (67%), Positives = 147/195 (75%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 73  IDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNP  VAFVP
Sbjct: 133 TREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD ILPP RP   P   P + 
Sbjct: 193 ISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 2e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>BC009875-1|AAH09875.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  276 bits (677), Expect = 7e-74
 Identities = 132/195 (67%), Positives = 147/195 (75%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 73  IDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNP  VAFVP
Sbjct: 133 TREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD ILPP RP   P   P + 
Sbjct: 193 ISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 2e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>BC009733-1|AAH09733.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  276 bits (677), Expect = 7e-74
 Identities = 132/195 (67%), Positives = 147/195 (75%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 73  IDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNP  VAFVP
Sbjct: 133 TREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD ILPP RP   P   P + 
Sbjct: 193 ISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 2e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>BC008587-1|AAH08587.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  276 bits (677), Expect = 7e-74
 Identities = 132/195 (67%), Positives = 147/195 (75%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 73  IDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNP  VAFVP
Sbjct: 133 TREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD ILPP RP   P   P + 
Sbjct: 193 ISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 2e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>AY043301-1|AAK95378.1|  462|Homo sapiens elongation factor 1-alpha
           protein.
          Length = 462

 Score =  276 bits (677), Expect = 7e-74
 Identities = 132/195 (67%), Positives = 147/195 (75%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 73  IDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNP  VAFVP
Sbjct: 133 TREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD ILPP RP   P   P + 
Sbjct: 193 ISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 2e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>AL603910-8|CAI14883.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  276 bits (677), Expect = 7e-74
 Identities = 132/195 (67%), Positives = 147/195 (75%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 73  IDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNP  VAFVP
Sbjct: 133 TREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD ILPP RP   P   P + 
Sbjct: 193 ISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 2e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>AL593851-4|CAH73620.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha-like 3 protein.
          Length = 462

 Score =  276 bits (677), Expect = 7e-74
 Identities = 132/195 (67%), Positives = 147/195 (75%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 73  IDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNP  VAFVP
Sbjct: 133 TREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD ILPP RP   P   P + 
Sbjct: 193 ISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 2e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>AK223030-1|BAD96750.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 462

 Score =  276 bits (677), Expect = 7e-74
 Identities = 132/195 (67%), Positives = 147/195 (75%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 73  IDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNP  VAFVP
Sbjct: 133 TREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD ILPP RP   P   P + 
Sbjct: 193 ISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 2e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>AK222982-1|BAD96702.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 462

 Score =  276 bits (677), Expect = 7e-74
 Identities = 132/195 (67%), Positives = 147/195 (75%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 73  IDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNP  VAFVP
Sbjct: 133 TREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSAYIKKIGYNPDTVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD ILPP RP   P   P + 
Sbjct: 193 ISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 2e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>AK222523-1|BAD96243.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 462

 Score =  276 bits (677), Expect = 7e-74
 Identities = 132/195 (67%), Positives = 147/195 (75%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 73  IDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNP  VAFVP
Sbjct: 133 TREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD ILPP RP   P   P + 
Sbjct: 193 ISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 2e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>AK222515-1|BAD96235.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 462

 Score =  276 bits (677), Expect = 7e-74
 Identities = 132/195 (67%), Positives = 147/195 (75%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 73  IDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNP  VAFVP
Sbjct: 133 TREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD ILPP RP   P   P + 
Sbjct: 193 ISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 2e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>AF397403-1|AAK93966.1|  398|Homo sapiens translation elongation
           factor 1 alpha 1-like 14 protein.
          Length = 398

 Score =  276 bits (677), Expect = 7e-74
 Identities = 132/195 (67%), Positives = 147/195 (75%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 9   IDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 68

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNP  VAFVP
Sbjct: 69  TREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVP 128

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD ILPP RP   P   P + 
Sbjct: 129 ISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQD 188

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 189 VYKIGGIGTVPVGRV 203


>X16869-1|CAA34756.1|  462|Homo sapiens protein ( Human mRNA for
           elongation factor 1-alpha (clone CEF4). ).
          Length = 462

 Score =  275 bits (674), Expect = 2e-73
 Identities = 131/195 (67%), Positives = 147/195 (75%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 73  IDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNP  VAFVP
Sbjct: 133 TREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EA+D ILPP RP   P   P + 
Sbjct: 193 ISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEAVDCILPPTRPTDKPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 2e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>L41498-1|AAC09386.1|  398|Homo sapiens longation factor 1-alpha 1
           protein.
          Length = 398

 Score =  274 bits (673), Expect = 2e-73
 Identities = 131/195 (67%), Positives = 147/195 (75%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFETSKYYVTIIDAPGHRDFI+NMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 9   IDISLWKFETSKYYVTIIDAPGHRDFIQNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 68

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNP  VAFVP
Sbjct: 69  TREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVP 128

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD ILPP RP   P   P + 
Sbjct: 129 ISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLGLPLQD 188

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 189 VYKIGGIGTVPVGRV 203


>L41490-1|AAC09385.1|  398|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1-like 14 protein.
          Length = 398

 Score =  274 bits (673), Expect = 2e-73
 Identities = 131/195 (67%), Positives = 147/195 (75%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFETSKYYVTIIDAPGHRDFI+NMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 9   IDISLWKFETSKYYVTIIDAPGHRDFIQNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 68

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNP  VAFVP
Sbjct: 69  TREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVP 128

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD ILPP RP   P   P + 
Sbjct: 129 ISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLGLPLQD 188

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 189 VYKIGGIGTVPVGRV 203


>AY062434-1|AAL38981.1|  398|Homo sapiens elongation factor 1-alpha
           1 protein.
          Length = 398

 Score =  274 bits (673), Expect = 2e-73
 Identities = 131/195 (67%), Positives = 147/195 (75%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFETSKYYVTIIDAPGHRDFI+NMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 9   IDISLWKFETSKYYVTIIDAPGHRDFIQNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 68

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNP  VAFVP
Sbjct: 69  TREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVP 128

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD ILPP RP   P   P + 
Sbjct: 129 ISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLGLPLQD 188

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 189 VYKIGGIGTVPVGRV 203


>AK223042-1|BAD96762.1|  433|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 433

 Score =  274 bits (672), Expect = 3e-73
 Identities = 131/195 (67%), Positives = 146/195 (74%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFETSKYYVT IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 44  IDISLWKFETSKYYVTTIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 103

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNP  VAFVP
Sbjct: 104 TREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVP 163

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD ILPP RP   P   P + 
Sbjct: 164 ISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQG 223

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 224 VYKIGGIGTVPVGRV 238



 Score = 84.6 bits (200), Expect = 4e-16
 Identities = 38/39 (97%), Positives = 38/39 (97%)
 Frame = +3

Query: 129 KCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 245
           KCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAERE
Sbjct: 1   KCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERE 39


>AF174496-1|AAF36537.1|  426|Homo sapiens glucocorticoid receptor
           AF-1 specific elongation factor protein.
          Length = 426

 Score =  267 bits (655), Expect = 3e-71
 Identities = 129/195 (66%), Positives = 144/195 (73%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 37  IDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 96

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNK  S           +  ++     +++GYNP  VAFVP
Sbjct: 97  TREHALLAYTLGVKQLIVGVNKSHSTEPPYSQKRYEEIVKEVRTYIKKIGYNPDTVAFVP 156

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD ILPP  P   P   P + 
Sbjct: 157 ISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPHSPTDKPLRLPLQD 216

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 217 VYKIGGIGTVPVGRV 231



 Score = 58.0 bits (134), Expect = 4e-08
 Identities = 26/28 (92%), Positives = 26/28 (92%)
 Frame = +3

Query: 162 KFEKEAQEMGKGSFKYAWVLDKLKAERE 245
           KFEKEA EMGKGSFKYAWV DKLKAERE
Sbjct: 5   KFEKEAAEMGKGSFKYAWVWDKLKAERE 32


>BC071619-1|AAH71619.1|  441|Homo sapiens EEF1A1 protein protein.
          Length = 441

 Score =  232 bits (568), Expect = 1e-60
 Identities = 121/195 (62%), Positives = 135/195 (69%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 73  IDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA++    + IV            VS  ++K           +GYNP  VAFVP
Sbjct: 133 TREHALLAYSQKRYEEIV----------KEVSTYIKK-----------IGYNPDTVAFVP 171

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD ILPP RP   P   P + 
Sbjct: 172 ISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQD 231

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 232 VYKIGGIGTVPVGRV 246



 Score =  145 bits (352), Expect = 2e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>AK222519-1|BAD96239.1|  366|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 366

 Score =  225 bits (550), Expect = 2e-58
 Identities = 109/171 (63%), Positives = 123/171 (71%)
 Frame = +1

Query: 328 DFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMD 507
           DFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVGVNKMD
Sbjct: 1   DFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMD 60

Query: 508 SLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQV 687
           S           +  ++     +++GYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V
Sbjct: 61  STEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKV 120

Query: 688 ERKEGKADGKCLIEALDAILPPARPLTSPCVFPARRIXNSVVXVPCPSGRI 840
            RK+G A G  L+EALD ILPP RP   P   P + +         P GR+
Sbjct: 121 TRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRV 171


>AF328730-1|AAN09722.1|  361|Homo sapiens CTCL tumor antigen
           HD-CL-08 protein.
          Length = 361

 Score =  214 bits (523), Expect = 3e-55
 Identities = 104/166 (62%), Positives = 118/166 (71%)
 Frame = +1

Query: 343 MITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSLNHH 522
           MITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVGVNKMDS    
Sbjct: 1   MITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPP 60

Query: 523 TVSPDLRKSRRKYPHTSRRLGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEG 702
                  +  ++     +++GYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G
Sbjct: 61  YSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDG 120

Query: 703 KADGKCLIEALDAILPPARPLTSPCVFPARRIXNSVVXVPCPSGRI 840
            A G  L+EALD ILPP RP   P   P + +         P GR+
Sbjct: 121 NASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRV 166


>AF322220-1|AAN51932.1|  361|Homo sapiens cervical cancer suppressor
           3 protein.
          Length = 361

 Score =  214 bits (523), Expect = 3e-55
 Identities = 104/166 (62%), Positives = 118/166 (71%)
 Frame = +1

Query: 343 MITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSLNHH 522
           MITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVGVNKMDS    
Sbjct: 1   MITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPP 60

Query: 523 TVSPDLRKSRRKYPHTSRRLGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEG 702
                  +  ++     +++GYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G
Sbjct: 61  YSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDG 120

Query: 703 KADGKCLIEALDAILPPARPLTSPCVFPARRIXNSVVXVPCPSGRI 840
            A G  L+EALD ILPP RP   P   P + +         P GR+
Sbjct: 121 NASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRV 166


>AL603910-9|CAI40951.1|  145|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 145

 Score =  150 bits (364), Expect = 6e-36
 Identities = 70/73 (95%), Positives = 72/73 (98%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 73  IDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGV 474
           TREHALLA+TLGV
Sbjct: 133 TREHALLAYTLGV 145



 Score =  145 bits (352), Expect = 2e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>X03689-1|CAA27325.1|   94|Homo sapiens protein ( Human mRNA
           fragment for elongation factor TU (N-terminus). ).
          Length = 94

 Score =  145 bits (352), Expect = 2e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68



 Score = 48.8 bits (111), Expect = 3e-05
 Identities = 20/22 (90%), Positives = 22/22 (100%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPG 321
           IDI+LWKFET+KYYVTIIDAPG
Sbjct: 73  IDISLWKFETAKYYVTIIDAPG 94


>BC070131-1|AAH70131.1|  111|Homo sapiens EEF1A1 protein protein.
          Length = 111

 Score =  145 bits (352), Expect = 2e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>AL603910-10|CAO03613.1|  107|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 107

 Score =  145 bits (352), Expect = 2e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68



 Score = 77.8 bits (183), Expect = 5e-14
 Identities = 34/35 (97%), Positives = 35/35 (100%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTS 360
           IDI+LWKFETSKYYVTIIDAPGHRDFIKNMITGTS
Sbjct: 73  IDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTS 107


>M29548-1|AAA52367.1|  327|Homo sapiens EEF1A protein.
          Length = 327

 Score =  143 bits (347), Expect = 7e-34
 Identities = 69/130 (53%), Positives = 83/130 (63%)
 Frame = +1

Query: 451 LLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVPISGWH 630
           LLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNP  VAFVPISGW+
Sbjct: 3   LLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWN 62

Query: 631 GDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARRIXNSV 810
           GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD ILPP RP   P   P + +    
Sbjct: 63  GDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIG 122

Query: 811 VXVPCPSGRI 840
                P GR+
Sbjct: 123 GIGTVPVGRV 132


>U87791-1|AAD00645.1|  684|Homo sapiens eRFS protein.
          Length = 684

 Score =  142 bits (343), Expect = 2e-33
 Identities = 74/173 (42%), Positives = 102/173 (58%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +D+ + KFET+   +T++DAPGH+DFI NMITG +QAD AVL+V A  GEFEAG    GQ
Sbjct: 326 MDVGMTKFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFEAGFETGGQ 385

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREH LL  +LGV QL V VNKMD +N        ++   K  H  ++ G+  + V F+P
Sbjct: 386 TREHGLLVRSLGVTQLAVAVNKMDQVNWQ--QERFQEITGKLGHFLKQAGFKESDVGFIP 443

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSP 774
            SG  G+N++  S      K ++         G CL+E +D+  PP R +  P
Sbjct: 444 TSGLSGENLITRSQSSELTKWYK---------GLCLLEQIDSFKPPQRSIDKP 487



 Score = 86.2 bits (204), Expect = 1e-16
 Identities = 37/64 (57%), Positives = 50/64 (78%)
 Frame = +3

Query: 54  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 233
           K  +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++ GK SF YAWVLD+  
Sbjct: 258 KQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETG 317

Query: 234 AERE 245
            ERE
Sbjct: 318 EERE 321


>BC040849-1|AAH40849.1|  684|Homo sapiens HBS1-like (S. cerevisiae)
           protein.
          Length = 684

 Score =  142 bits (343), Expect = 2e-33
 Identities = 74/173 (42%), Positives = 102/173 (58%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +D+ + KFET+   +T++DAPGH+DFI NMITG +QAD AVL+V A  GEFEAG    GQ
Sbjct: 326 MDVGMTKFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFEAGFETGGQ 385

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREH LL  +LGV QL V VNKMD +N        ++   K  H  ++ G+  + V F+P
Sbjct: 386 TREHGLLVRSLGVTQLAVAVNKMDQVNWQ--QERFQEITGKLGHFLKQAGFKESDVGFIP 443

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSP 774
            SG  G+N++  S      K ++         G CL+E +D+  PP R +  P
Sbjct: 444 TSGLSGENLITRSQSSELTKWYK---------GLCLLEQIDSFKPPQRSIDKP 487



 Score = 86.2 bits (204), Expect = 1e-16
 Identities = 37/64 (57%), Positives = 50/64 (78%)
 Frame = +3

Query: 54  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 233
           K  +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++ GK SF YAWVLD+  
Sbjct: 258 KQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETG 317

Query: 234 AERE 245
            ERE
Sbjct: 318 EERE 321


>BC001465-1|AAH01465.1|  684|Homo sapiens HBS1-like (S. cerevisiae)
           protein.
          Length = 684

 Score =  142 bits (343), Expect = 2e-33
 Identities = 74/173 (42%), Positives = 102/173 (58%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +D+ + KFET+   +T++DAPGH+DFI NMITG +QAD AVL+V A  GEFEAG    GQ
Sbjct: 326 MDVGMTKFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFEAGFETGGQ 385

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREH LL  +LGV QL V VNKMD +N        ++   K  H  ++ G+  + V F+P
Sbjct: 386 TREHGLLVRSLGVTQLAVAVNKMDQVNWQ--QERFQEITGKLGHFLKQAGFKESDVGFIP 443

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSP 774
            SG  G+N++  S      K ++         G CL+E +D+  PP R +  P
Sbjct: 444 TSGLSGENLITRSQSSELTKWYK---------GLCLLEQIDSFKPPQRSIDKP 487



 Score = 86.2 bits (204), Expect = 1e-16
 Identities = 37/64 (57%), Positives = 50/64 (78%)
 Frame = +3

Query: 54  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 233
           K  +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++ GK SF YAWVLD+  
Sbjct: 258 KQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETG 317

Query: 234 AERE 245
            ERE
Sbjct: 318 EERE 321


>AL445190-5|CAI95161.1|  684|Homo sapiens HBS1-like (S. cerevisiae)
           protein.
          Length = 684

 Score =  142 bits (343), Expect = 2e-33
 Identities = 74/173 (42%), Positives = 102/173 (58%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +D+ + KFET+   +T++DAPGH+DFI NMITG +QAD AVL+V A  GEFEAG    GQ
Sbjct: 326 MDVGMTKFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFEAGFETGGQ 385

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREH LL  +LGV QL V VNKMD +N        ++   K  H  ++ G+  + V F+P
Sbjct: 386 TREHGLLVRSLGVTQLAVAVNKMDQVNWQ--QERFQEITGKLGHFLKQAGFKESDVGFIP 443

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSP 774
            SG  G+N++  S      K ++         G CL+E +D+  PP R +  P
Sbjct: 444 TSGLSGENLITRSQSSELTKWYK---------GLCLLEQIDSFKPPQRSIDKP 487



 Score = 86.2 bits (204), Expect = 1e-16
 Identities = 37/64 (57%), Positives = 50/64 (78%)
 Frame = +3

Query: 54  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 233
           K  +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++ GK SF YAWVLD+  
Sbjct: 258 KQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETG 317

Query: 234 AERE 245
            ERE
Sbjct: 318 EERE 321


>AL353596-2|CAI17912.1|  684|Homo sapiens HBS1-like (S. cerevisiae)
           protein.
          Length = 684

 Score =  142 bits (343), Expect = 2e-33
 Identities = 74/173 (42%), Positives = 102/173 (58%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +D+ + KFET+   +T++DAPGH+DFI NMITG +QAD AVL+V A  GEFEAG    GQ
Sbjct: 326 MDVGMTKFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFEAGFETGGQ 385

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREH LL  +LGV QL V VNKMD +N        ++   K  H  ++ G+  + V F+P
Sbjct: 386 TREHGLLVRSLGVTQLAVAVNKMDQVNWQ--QERFQEITGKLGHFLKQAGFKESDVGFIP 443

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSP 774
            SG  G+N++  S      K ++         G CL+E +D+  PP R +  P
Sbjct: 444 TSGLSGENLITRSQSSELTKWYK---------GLCLLEQIDSFKPPQRSIDKP 487



 Score = 86.2 bits (204), Expect = 1e-16
 Identities = 37/64 (57%), Positives = 50/64 (78%)
 Frame = +3

Query: 54  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 233
           K  +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++ GK SF YAWVLD+  
Sbjct: 258 KQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETG 317

Query: 234 AERE 245
            ERE
Sbjct: 318 EERE 321


>AJ459826-1|CAD30873.1|  684|Homo sapiens HBS1-like protein protein.
          Length = 684

 Score =  142 bits (343), Expect = 2e-33
 Identities = 74/173 (42%), Positives = 102/173 (58%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +D+ + KFET+   +T++DAPGH+DFI NMITG +QAD AVL+V A  GEFEAG    GQ
Sbjct: 326 MDVGMTKFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFEAGFETGGQ 385

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREH LL  +LGV QL V VNKMD +N        ++   K  H  ++ G+  + V F+P
Sbjct: 386 TREHGLLVRSLGVTQLAVAVNKMDQVNWQ--QERFQEITGKLGHFLKQAGFKESDVGFIP 443

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSP 774
            SG  G+N++  S      K ++         G CL+E +D+  PP R +  P
Sbjct: 444 TSGLSGENLITRSQSSELTKWYK---------GLCLLEQIDSFKPPQRSIDKP 487



 Score = 86.2 bits (204), Expect = 1e-16
 Identities = 37/64 (57%), Positives = 50/64 (78%)
 Frame = +3

Query: 54  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 233
           K  +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++ GK SF YAWVLD+  
Sbjct: 258 KQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETG 317

Query: 234 AERE 245
            ERE
Sbjct: 318 EERE 321


>AB028961-1|BAA82990.1|  496|Homo sapiens KIAA1038 protein protein.
          Length = 496

 Score =  142 bits (343), Expect = 2e-33
 Identities = 74/173 (42%), Positives = 102/173 (58%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +D+ + KFET+   +T++DAPGH+DFI NMITG +QAD AVL+V A  GEFEAG    GQ
Sbjct: 138 MDVGMTKFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFEAGFETGGQ 197

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREH LL  +LGV QL V VNKMD +N        ++   K  H  ++ G+  + V F+P
Sbjct: 198 TREHGLLVRSLGVTQLAVAVNKMDQVNWQ--QERFQEITGKLGHFLKQAGFKESDVGFIP 255

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSP 774
            SG  G+N++  S      K ++         G CL+E +D+  PP R +  P
Sbjct: 256 TSGLSGENLITRSQSSELTKWYK---------GLCLLEQIDSFKPPQRSIDKP 299



 Score = 86.2 bits (204), Expect = 1e-16
 Identities = 37/64 (57%), Positives = 50/64 (78%)
 Frame = +3

Query: 54  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 233
           K  +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++ GK SF YAWVLD+  
Sbjct: 70  KQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETG 129

Query: 234 AERE 245
            ERE
Sbjct: 130 EERE 133


>X17644-1|CAA35635.1|  499|Homo sapiens protein ( Human GST1-Hs mRNA
           for GTP-binding protein. ).
          Length = 499

 Score =  131 bits (317), Expect = 3e-30
 Identities = 65/142 (45%), Positives = 89/142 (62%), Gaps = 1/142 (0%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +++    FET K + TI+DAPGH+ F+ NMI G SQAD AVL+++A  GEFE G  K GQ
Sbjct: 140 VEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQ 199

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAA-VAFV 612
           TREHA+LA T GVK LIV +NKMD    +  +    + + K     +++G+NP   + F+
Sbjct: 200 TREHAMLAKTAGVKHLIVLINKMDDPTVNWSNERYEECKEKLVPFLKKVGFNPKKDIHFM 259

Query: 613 PISGWHGDNMLEPSTKMPWFKG 678
           P SG  G N+ E S   PW+ G
Sbjct: 260 PCSGLTGANLKEQSDFCPWYIG 281



 Score = 77.0 bits (181), Expect = 8e-14
 Identities = 32/70 (45%), Positives = 49/70 (70%)
 Frame = +3

Query: 36  PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAW 215
           P    +K H+N+V IGHVD+GKST  G ++Y  G +DKRT+EK+E+EA+E  + ++  +W
Sbjct: 66  PPGAPKKEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYEREAKEKNRETWYLSW 125

Query: 216 VLDKLKAERE 245
            LD  + ER+
Sbjct: 126 ALDTNQEERD 135


>U95742-2|AAB67250.1|  499|Homo sapiens G1 to S phase transition
           protein protein.
          Length = 499

 Score =  131 bits (317), Expect = 3e-30
 Identities = 65/142 (45%), Positives = 89/142 (62%), Gaps = 1/142 (0%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +++    FET K + TI+DAPGH+ F+ NMI G SQAD AVL+++A  GEFE G  K GQ
Sbjct: 140 VEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQ 199

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAA-VAFV 612
           TREHA+LA T GVK LIV +NKMD    +  +    + + K     +++G+NP   + F+
Sbjct: 200 TREHAMLAKTAGVKHLIVLINKMDDPTVNWSNERYEECKEKLVPFLKKVGFNPKKDIHFM 259

Query: 613 PISGWHGDNMLEPSTKMPWFKG 678
           P SG  G N+ E S   PW+ G
Sbjct: 260 PCSGLTGANLKEQSDFCPWYIG 281



 Score = 77.0 bits (181), Expect = 8e-14
 Identities = 32/70 (45%), Positives = 49/70 (70%)
 Frame = +3

Query: 36  PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAW 215
           P    +K H+N+V IGHVD+GKST  G ++Y  G +DKRT+EK+E+EA+E  + ++  +W
Sbjct: 66  PPGAPKKEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYEREAKEKNRETWYLSW 125

Query: 216 VLDKLKAERE 245
            LD  + ER+
Sbjct: 126 ALDTNQEERD 135


>BT006722-1|AAP35368.1|  498|Homo sapiens G1 to S phase transition 1
           protein.
          Length = 498

 Score =  131 bits (317), Expect = 3e-30
 Identities = 65/142 (45%), Positives = 89/142 (62%), Gaps = 1/142 (0%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +++    FET K + TI+DAPGH+ F+ NMI G SQAD AVL+++A  GEFE G  K GQ
Sbjct: 139 VEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQ 198

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAA-VAFV 612
           TREHA+LA T GVK LIV +NKMD    +  +    + + K     +++G+NP   + F+
Sbjct: 199 TREHAMLAKTAGVKHLIVLINKMDDPTVNWSNERYEECKEKLVPFLKKVGFNPKKDIHFM 258

Query: 613 PISGWHGDNMLEPSTKMPWFKG 678
           P SG  G N+ E S   PW+ G
Sbjct: 259 PCSGLTGANLKEQSDFCPWYIG 280



 Score = 77.0 bits (181), Expect = 8e-14
 Identities = 32/70 (45%), Positives = 49/70 (70%)
 Frame = +3

Query: 36  PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAW 215
           P    +K H+N+V IGHVD+GKST  G ++Y  G +DKRT+EK+E+EA+E  + ++  +W
Sbjct: 65  PPGAPKKEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYEREAKEKNRETWYLSW 124

Query: 216 VLDKLKAERE 245
            LD  + ER+
Sbjct: 125 ALDTNQEERD 134


>BC009503-1|AAH09503.2|  633|Homo sapiens GSPT1 protein protein.
          Length = 633

 Score =  131 bits (317), Expect = 3e-30
 Identities = 65/142 (45%), Positives = 89/142 (62%), Gaps = 1/142 (0%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +++    FET K + TI+DAPGH+ F+ NMI G SQAD AVL+++A  GEFE G  K GQ
Sbjct: 274 VEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQ 333

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAA-VAFV 612
           TREHA+LA T GVK LIV +NKMD    +  +    + + K     +++G+NP   + F+
Sbjct: 334 TREHAMLAKTAGVKHLIVLINKMDDPTVNWSNERYEECKEKLVPFLKKVGFNPKKDIHFM 393

Query: 613 PISGWHGDNMLEPSTKMPWFKG 678
           P SG  G N+ E S   PW+ G
Sbjct: 394 PCSGLTGANLKEQSDFCPWYIG 415



 Score = 77.0 bits (181), Expect = 8e-14
 Identities = 32/70 (45%), Positives = 49/70 (70%)
 Frame = +3

Query: 36  PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAW 215
           P    +K H+N+V IGHVD+GKST  G ++Y  G +DKRT+EK+E+EA+E  + ++  +W
Sbjct: 200 PPGAPKKEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYEREAKEKNRETWYLSW 259

Query: 216 VLDKLKAERE 245
            LD  + ER+
Sbjct: 260 ALDTNQEERD 269


>BC036077-1|AAH36077.1|  628|Homo sapiens G1 to S phase transition 2
           protein.
          Length = 628

 Score =  128 bits (309), Expect = 3e-29
 Identities = 66/145 (45%), Positives = 92/145 (63%), Gaps = 4/145 (2%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +++    FET + + TI+DAPGH+ F+ NMI G SQAD AVL+++A  GEFE G  K GQ
Sbjct: 269 VEVGRAYFETERKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQ 328

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRK---SRRKYPHTSRRLGYNPAA-V 603
           TREHA+LA T GVK LIV +NKMD    HTV+  + +    + K     +++G++P   +
Sbjct: 329 TREHAMLAKTAGVKHLIVLINKMDD---HTVNWSIERYEECKEKLVPFLKKVGFSPKKDI 385

Query: 604 AFVPISGWHGDNMLEPSTKMPWFKG 678
            F+P SG  G N+ E S   PW+ G
Sbjct: 386 HFMPCSGLTGANIKEQSDFCPWYTG 410



 Score = 75.8 bits (178), Expect = 2e-13
 Identities = 31/70 (44%), Positives = 49/70 (70%)
 Frame = +3

Query: 36  PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAW 215
           P    +K H+N+V IGHVD+GKST  G +++  G +DKRT+EK+E+EA+E  + ++  +W
Sbjct: 195 PSGAPKKEHVNVVFIGHVDAGKSTIGGQIMFLTGMVDKRTLEKYEREAKEKNRETWYLSW 254

Query: 216 VLDKLKAERE 245
            LD  + ER+
Sbjct: 255 ALDTNQEERD 264


>AL929101-2|CAH71524.1|  628|Homo sapiens G1 to S phase transition 2
           protein.
          Length = 628

 Score =  127 bits (307), Expect = 5e-29
 Identities = 63/142 (44%), Positives = 88/142 (61%), Gaps = 1/142 (0%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +++    FET + + TI+DAPGH+ F+ NMI G SQAD AVL+++A  GEFE G  K GQ
Sbjct: 269 VEVGRAYFETERKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQ 328

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAA-VAFV 612
           TREHA+LA T GVK LIV +NKMD    +       + + K     +++G++P   + F+
Sbjct: 329 TREHAMLAKTAGVKHLIVLINKMDDPTVNWSIERYEECKEKLVPFLKKVGFSPKKDIHFM 388

Query: 613 PISGWHGDNMLEPSTKMPWFKG 678
           P SG  G N+ E S   PW+ G
Sbjct: 389 PCSGLTGANIKEQSDFCPWYTG 410



 Score = 75.8 bits (178), Expect = 2e-13
 Identities = 31/70 (44%), Positives = 49/70 (70%)
 Frame = +3

Query: 36  PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAW 215
           P    +K H+N+V IGHVD+GKST  G +++  G +DKRT+EK+E+EA+E  + ++  +W
Sbjct: 195 PSGAPKKEHVNVVFIGHVDAGKSTIGGQIMFLTGMVDKRTLEKYEREAKEKNRETWYLSW 254

Query: 216 VLDKLKAERE 245
            LD  + ER+
Sbjct: 255 ALDTNQEERD 264


>AK023155-1|BAB14435.1|  504|Homo sapiens protein ( Homo sapiens
           cDNA FLJ13093 fis, clone NT2RP3002151, highly similar to
           G1 TO S PHASE TRANSITION PROTEIN 1 HOMOLOG. ).
          Length = 504

 Score =  127 bits (307), Expect = 5e-29
 Identities = 63/142 (44%), Positives = 88/142 (61%), Gaps = 1/142 (0%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +++    FET + + TI+DAPGH+ F+ NMI G SQAD AVL+++A  GEFE G  K GQ
Sbjct: 166 VEVGRAYFETERKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQ 225

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAA-VAFV 612
           TREHA+LA T GVK LIV +NKMD    +       + + K     +++G++P   + F+
Sbjct: 226 TREHAMLAKTAGVKHLIVLINKMDDPTVNWSIERYEECKEKLVPFLKKVGFSPKKDIHFM 285

Query: 613 PISGWHGDNMLEPSTKMPWFKG 678
           P SG  G N+ E S   PW+ G
Sbjct: 286 PCSGLTGANIKEQSDFCPWYTG 307



 Score = 75.8 bits (178), Expect = 2e-13
 Identities = 31/70 (44%), Positives = 49/70 (70%)
 Frame = +3

Query: 36  PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAW 215
           P    +K H+N+V IGHVD+GKST  G +++  G +DKRT+EK+E+EA+E  + ++  +W
Sbjct: 92  PSGAPKKEHVNVVFIGHVDAGKSTIGGQIMFLTGMVDKRTLEKYEREAKEKNRETWYLSW 151

Query: 216 VLDKLKAERE 245
            LD  + ER+
Sbjct: 152 ALDTNQEERD 161


>AJ251548-1|CAB91089.1|  628|Homo sapiens polypeptide chain release
           factor 3b protein.
          Length = 628

 Score =  127 bits (307), Expect = 5e-29
 Identities = 63/142 (44%), Positives = 88/142 (61%), Gaps = 1/142 (0%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +++    FET + + TI+DAPGH+ F+ NMI G SQAD AVL+++A  GEFE G  K GQ
Sbjct: 269 VEVGRAYFETERKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQ 328

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAA-VAFV 612
           TREHA+LA T GVK LIV +NKMD    +       + + K     +++G++P   + F+
Sbjct: 329 TREHAMLAKTAGVKHLIVLINKMDDPTVNWSIERYEECKEKLVPFLKKVGFSPKKDIHFM 388

Query: 613 PISGWHGDNMLEPSTKMPWFKG 678
           P SG  G N+ E S   PW+ G
Sbjct: 389 PCSGLTGANIKEQSDFCPWYTG 410



 Score = 75.8 bits (178), Expect = 2e-13
 Identities = 31/70 (44%), Positives = 49/70 (70%)
 Frame = +3

Query: 36  PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAW 215
           P    +K H+N+V IGHVD+GKST  G +++  G +DKRT+EK+E+EA+E  + ++  +W
Sbjct: 195 PSGAPKKEHVNVVFIGHVDAGKSTIGGQIMFLTGMVDKRTLEKYEREAKEKNRETWYLSW 254

Query: 216 VLDKLKAERE 245
            LD  + ER+
Sbjct: 255 ALDTNQEERD 264


>AK001303-1|BAA91612.1|  628|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10441 fis, clone NT2RP1000733, highly similar to
           Human mRNA for GSPT1-TK protein. ).
          Length = 628

 Score =  127 bits (306), Expect = 6e-29
 Identities = 63/142 (44%), Positives = 88/142 (61%), Gaps = 1/142 (0%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +++    FET + + TI+DAPGH+ F+ NMI G SQAD AVL+++A  GEFE G  K GQ
Sbjct: 269 VEVGRAYFETERKHFTILDAPGHKGFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQ 328

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAA-VAFV 612
           TREHA+LA T GVK LIV +NKMD    +       + + K     +++G++P   + F+
Sbjct: 329 TREHAMLAKTAGVKHLIVLINKMDDPTVNWSIERYEECKEKLVPFLKKVGFSPKKDIHFM 388

Query: 613 PISGWHGDNMLEPSTKMPWFKG 678
           P SG  G N+ E S   PW+ G
Sbjct: 389 PCSGLTGANIKEQSDFCPWYTG 410



 Score = 75.8 bits (178), Expect = 2e-13
 Identities = 31/70 (44%), Positives = 49/70 (70%)
 Frame = +3

Query: 36  PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAW 215
           P    +K H+N+V IGHVD+GKST  G +++  G +DKRT+EK+E+EA+E  + ++  +W
Sbjct: 195 PSGAPKKEHVNVVFIGHVDAGKSTIGGQIMFLTGMVDKRTLEKYEREAKEKNRETWYLSW 254

Query: 216 VLDKLKAERE 245
            LD  + ER+
Sbjct: 255 ALDTNQEERD 264


>BC094687-1|AAH94687.1|  308|Homo sapiens EEF1A1 protein protein.
          Length = 308

 Score =  115 bits (277), Expect = 2e-25
 Identities = 50/89 (56%), Positives = 60/89 (67%)
 Frame = +1

Query: 574 RRLGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPP 753
           +++GYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD ILPP
Sbjct: 25  KKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPP 84

Query: 754 ARPLTSPCVFPARRIXNSVVXVPCPSGRI 840
            RP   P   P + +         P GR+
Sbjct: 85  TRPTDKPLRLPLQDVYKIGGIGTVPVGRV 113



 Score = 63.7 bits (148), Expect = 8e-10
 Identities = 47/123 (38%), Positives = 57/123 (46%), Gaps = 1/123 (0%)
 Frame = +3

Query: 510 TEPPYSEPRFEEIKKEVSSYIKKIGLQPSCCRF-RAHFWMARRQHVGAFNQNALVQGMAG 686
           TEPPYS+ R+EEI KEVS+YIKKIG  P    F     W        + N          
Sbjct: 4   TEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVT 63

Query: 687 GA*GRQS*RKMPH*SSRCHPATCPXPDKPLRLPCKTYTKFXGXGTVPVXQNLKLVC*KPG 866
              G  S   +        P T P  DKPLRLP +   K  G GTVPV + ++    KPG
Sbjct: 64  RKDGNASGTTLLEALDCILPPTRP-TDKPLRLPLQDVYKIGGIGTVPVGR-VETGVLKPG 121

Query: 867 TIV 875
            +V
Sbjct: 122 MVV 124


>BC063511-1|AAH63511.1|  290|Homo sapiens EEF1A1 protein protein.
          Length = 290

 Score =  115 bits (277), Expect = 2e-25
 Identities = 50/89 (56%), Positives = 60/89 (67%)
 Frame = +1

Query: 574 RRLGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPP 753
           +++GYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD ILPP
Sbjct: 7   KKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPP 66

Query: 754 ARPLTSPCVFPARRIXNSVVXVPCPSGRI 840
            RP   P   P + +         P GR+
Sbjct: 67  TRPTDKPLRLPLQDVYKIGGIGTVPVGRV 95


>BC014377-1|AAH14377.1|  287|Homo sapiens Unknown (protein for
           IMAGE:4041545) protein.
          Length = 287

 Score =  115 bits (277), Expect = 2e-25
 Identities = 50/89 (56%), Positives = 60/89 (67%)
 Frame = +1

Query: 574 RRLGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPP 753
           +++GYNP  VAFVPISGW+GDNMLEPS  MPWFKGW+V RK+G A G  L+EALD ILPP
Sbjct: 4   KKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPP 63

Query: 754 ARPLTSPCVFPARRIXNSVVXVPCPSGRI 840
            RP   P   P + +         P GR+
Sbjct: 64  TRPTDKPLRLPLQDVYKIGGIGTVPVGRV 92


>BC070500-1|AAH70500.1|   67|Homo sapiens EEF1A1 protein protein.
          Length = 67

 Score =  108 bits (259), Expect = 3e-23
 Identities = 49/51 (96%), Positives = 50/51 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGK 194
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMG+
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGR 51


>AL445190-4|CAI95162.1|  453|Homo sapiens HBS1-like (S. cerevisiae)
           protein.
          Length = 453

 Score = 86.2 bits (204), Expect = 1e-16
 Identities = 37/64 (57%), Positives = 50/64 (78%)
 Frame = +3

Query: 54  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 233
           K  +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++ GK SF YAWVLD+  
Sbjct: 258 KQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETG 317

Query: 234 AERE 245
            ERE
Sbjct: 318 EERE 321


>AL353596-1|CAI17913.1|  453|Homo sapiens HBS1-like (S. cerevisiae)
           protein.
          Length = 453

 Score = 86.2 bits (204), Expect = 1e-16
 Identities = 37/64 (57%), Positives = 50/64 (78%)
 Frame = +3

Query: 54  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 233
           K  +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++ GK SF YAWVLD+  
Sbjct: 258 KQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETG 317

Query: 234 AERE 245
            ERE
Sbjct: 318 EERE 321


>X84694-1|CAA59169.1|  452|Homo sapiens mitochondrial elongation
           factor Tu protein.
          Length = 452

 Score = 68.1 bits (159), Expect = 4e-11
 Identities = 36/86 (41%), Positives = 52/86 (60%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           I+ A  ++ T+  +    D PGH D++KNMITGT+  D  +L+VAA  G          Q
Sbjct: 108 INAAHVEYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMP-------Q 160

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSL 513
           TREH LLA  +GV+ ++V VNK D++
Sbjct: 161 TREHLLLARQIGVEHVVVYVNKADAV 186



 Score = 37.9 bits (84), Expect = 0.048
 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 3/53 (5%)
 Frame = +3

Query: 48  KEKTHINIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEMGKG 197
           ++K H+N+  IGHVD GK+T T     ++ + GG   +  E+ +   +E  +G
Sbjct: 53  RDKPHVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARG 105


>S75463-1|AAC60647.1|  452|Homo sapiens P43 protein.
          Length = 452

 Score = 68.1 bits (159), Expect = 4e-11
 Identities = 36/86 (41%), Positives = 52/86 (60%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           I+ A  ++ T+  +    D PGH D++KNMITGT+  D  +L+VAA  G          Q
Sbjct: 111 INAAHVEYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMP-------Q 163

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSL 513
           TREH LLA  +GV+ ++V VNK D++
Sbjct: 164 TREHLLLARQIGVEHVVVYVNKADAV 189



 Score = 37.9 bits (84), Expect = 0.048
 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 3/53 (5%)
 Frame = +3

Query: 48  KEKTHINIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEMGKG 197
           ++K H+N+  IGHVD GK+T T     ++ + GG   +  E+ +   +E  +G
Sbjct: 56  RDKPHVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARG 108


>L38995-1|AAB00499.1|  452|Homo sapiens elongation factor Tu
           protein.
          Length = 452

 Score = 68.1 bits (159), Expect = 4e-11
 Identities = 36/86 (41%), Positives = 52/86 (60%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           I+ A  ++ T+  +    D PGH D++KNMITGT+  D  +L+VAA  G          Q
Sbjct: 108 INAAHVEYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMP-------Q 160

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSL 513
           TREH LLA  +GV+ ++V VNK D++
Sbjct: 161 TREHLLLARQIGVEHVVVYVNKADAV 186



 Score = 37.9 bits (84), Expect = 0.048
 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 3/53 (5%)
 Frame = +3

Query: 48  KEKTHINIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEMGKG 197
           ++K H+N+  IGHVD GK+T T     ++ + GG   +  E+ +   +E  +G
Sbjct: 53  RDKPHVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARG 105


>BC010041-1|AAH10041.2|  455|Homo sapiens Tu translation elongation
           factor, mitochondrial protein.
          Length = 455

 Score = 68.1 bits (159), Expect = 4e-11
 Identities = 36/86 (41%), Positives = 52/86 (60%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           I+ A  ++ T+  +    D PGH D++KNMITGT+  D  +L+VAA  G          Q
Sbjct: 111 INAAHVEYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMP-------Q 163

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSL 513
           TREH LLA  +GV+ ++V VNK D++
Sbjct: 164 TREHLLLARQIGVEHVVVYVNKADAV 189



 Score = 37.9 bits (84), Expect = 0.048
 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 3/53 (5%)
 Frame = +3

Query: 48  KEKTHINIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEMGKG 197
           ++K H+N+  IGHVD GK+T T     ++ + GG   +  E+ +   +E  +G
Sbjct: 56  RDKPHVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARG 108


>BC001633-1|AAH01633.2|  455|Homo sapiens Tu translation elongation
           factor, mitochondrial protein.
          Length = 455

 Score = 68.1 bits (159), Expect = 4e-11
 Identities = 36/86 (41%), Positives = 52/86 (60%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           I+ A  ++ T+  +    D PGH D++KNMITGT+  D  +L+VAA  G          Q
Sbjct: 111 INAAHVEYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMP-------Q 163

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSL 513
           TREH LLA  +GV+ ++V VNK D++
Sbjct: 164 TREHLLLARQIGVEHVVVYVNKADAV 189



 Score = 37.9 bits (84), Expect = 0.048
 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 3/53 (5%)
 Frame = +3

Query: 48  KEKTHINIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEMGKG 197
           ++K H+N+  IGHVD GK+T T     ++ + GG   +  E+ +   +E  +G
Sbjct: 56  RDKPHVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARG 108


>BC065761-1|AAH65761.1|  251|Homo sapiens EEF1A1 protein protein.
          Length = 251

 Score = 52.0 bits (119), Expect = 3e-06
 Identities = 24/55 (43%), Positives = 30/55 (54%)
 Frame = +1

Query: 676 GWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARRIXNSVVXVPCPSGRI 840
           GW+V RK+G A G  L+EALD ILPP RP   P   P + +         P GR+
Sbjct: 2   GWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRV 56


>BC022412-1|AAH22412.1|  250|Homo sapiens Unknown (protein for
           IMAGE:4134193) protein.
          Length = 250

 Score = 52.0 bits (119), Expect = 3e-06
 Identities = 24/55 (43%), Positives = 30/55 (54%)
 Frame = +1

Query: 676 GWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARRIXNSVVXVPCPSGRI 840
           GW+V RK+G A G  L+EALD ILPP RP   P   P + +         P GR+
Sbjct: 1   GWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRV 55


>BC014892-1|AAH14892.1|  248|Homo sapiens Unknown (protein for
           IMAGE:3909122) protein.
          Length = 248

 Score = 45.2 bits (102), Expect = 3e-04
 Identities = 22/53 (41%), Positives = 28/53 (52%)
 Frame = +1

Query: 682 QVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARRIXNSVVXVPCPSGRI 840
           +V RK+G A G  L+EALD ILPP RP   P   P + +         P GR+
Sbjct: 1   KVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRV 53


>BC007933-1|AAH07933.1|  569|Homo sapiens EEFSEC protein protein.
          Length = 569

 Score = 37.5 bits (83), Expect = 0.063
 Identities = 30/124 (24%), Positives = 55/124 (44%), Gaps = 1/124 (0%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTRE-HALLAFTLGV 474
           VT++D PGH   I+ +I G    D  +L++          ++K  QT+    L+   +  
Sbjct: 61  VTLVDCPGHASLIRTIIGGAQIIDLMMLVI---------DVTKGMQTQSAECLVIGQIAC 111

Query: 475 KQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVPISGWHGDNMLEPS 654
           ++L+V +NK+D L        + K  +K   T     +  A +  +P++   G     P 
Sbjct: 112 QKLVVVLNKIDLLPEGKRQAAIDKMTKKMQKTLENTKFRGAPI--IPVAAKPG-GPEAPE 168

Query: 655 TKMP 666
           T+ P
Sbjct: 169 TEAP 172


>AF268872-1|AAG13375.1|  526|Homo sapiens MJ0495-like protein SelB
           protein.
          Length = 526

 Score = 37.5 bits (83), Expect = 0.063
 Identities = 30/124 (24%), Positives = 55/124 (44%), Gaps = 1/124 (0%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTRE-HALLAFTLGV 474
           VT++D PGH   I+ +I G    D  +L++          ++K  QT+    L+   +  
Sbjct: 18  VTLVDCPGHASLIRTIIGGAQIIDLMMLVI---------DVTKGMQTQSAECLVIGQIAC 68

Query: 475 KQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVPISGWHGDNMLEPS 654
           ++L+V +NK+D L        + K  +K   T     +  A +  +P++   G     P 
Sbjct: 69  QKLVVVLNKIDLLPEGKRQAAIDKMTKKMQKTLENTKFRGAPI--IPVAAKPG-GPEAPE 125

Query: 655 TKMP 666
           T+ P
Sbjct: 126 TEAP 129


>L19161-1|AAA19696.1|  472|Homo sapiens translation initiation
           factor eIF-2 gamma subunit protein.
          Length = 472

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 19/71 (26%), Positives = 34/71 (47%)
 Frame = +1

Query: 295 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 474
           +V+ +D PGH   +  M+ G +  D A+L++A              QT EH      + +
Sbjct: 129 HVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKL 182

Query: 475 KQLIVGVNKMD 507
           K +++  NK+D
Sbjct: 183 KHILILQNKID 193


>DQ120619-1|ABB92405.1|  471|Homo sapiens eFI-2-gamma protein.
          Length = 471

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 19/71 (26%), Positives = 34/71 (47%)
 Frame = +1

Query: 295 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 474
           +V+ +D PGH   +  M+ G +  D A+L++A              QT EH      + +
Sbjct: 129 HVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKL 182

Query: 475 KQLIVGVNKMD 507
           K +++  NK+D
Sbjct: 183 KHILILQNKID 193


>BC087847-1|AAH87847.1|  465|Homo sapiens Unknown (protein for
           IMAGE:30389268) protein.
          Length = 465

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 19/71 (26%), Positives = 34/71 (47%)
 Frame = +1

Query: 295 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 474
           +V+ +D PGH   +  M+ G +  D A+L++A              QT EH      + +
Sbjct: 128 HVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKL 181

Query: 475 KQLIVGVNKMD 507
           K +++  NK+D
Sbjct: 182 KHILILQNKID 192


>BC019906-1|AAH19906.1|  472|Homo sapiens eukaryotic translation
           initiation factor 2, subunit 3 gamma, 52kDa protein.
          Length = 472

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 19/71 (26%), Positives = 34/71 (47%)
 Frame = +1

Query: 295 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 474
           +V+ +D PGH   +  M+ G +  D A+L++A              QT EH      + +
Sbjct: 129 HVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKL 182

Query: 475 KQLIVGVNKMD 507
           K +++  NK+D
Sbjct: 183 KHILILQNKID 193


>AK222577-1|BAD96297.1|  472|Homo sapiens eukaryotic translation
           initiation factor 2, subunit 3 gamma, 52kDa variant
           protein.
          Length = 472

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 19/71 (26%), Positives = 34/71 (47%)
 Frame = +1

Query: 295 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 474
           +V+ +D PGH   +  M+ G +  D A+L++A              QT EH      + +
Sbjct: 129 HVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKL 182

Query: 475 KQLIVGVNKMD 507
           K +++  NK+D
Sbjct: 183 KHILILQNKID 193


>AJ006932-1|CAA07331.1|  248|Homo sapiens eIF-2gA protein.
          Length = 248

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 19/71 (26%), Positives = 34/71 (47%)
 Frame = +1

Query: 295 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 474
           +V+ +D PGH   +  M+ G +  D A+L++A              QT EH      + +
Sbjct: 69  HVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKL 122

Query: 475 KQLIVGVNKMD 507
           K +++  NK+D
Sbjct: 123 KHILILQNKID 133


>L34600-1|AAA67038.1|  727|Homo sapiens initiation factor 2 protein.
          Length = 727

 Score = 35.5 bits (78), Expect = 0.26
 Identities = 33/117 (28%), Positives = 49/117 (41%), Gaps = 1/117 (0%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 477
           +T +D PGH  F      G    D  VL+VAA  G  +  +    ++ +HA  A      
Sbjct: 230 ITFLDTPGHAAFSAMRARGAQVTDIVVLVVAADDGVMKQTV----ESIQHAKDAQV---- 281

Query: 478 QLIVGVNKMDSLNHHTVSPD-LRKSRRKYPHTSRRLGYNPAAVAFVPISGWHGDNML 645
            +I+ VNK D        P+ ++K    Y       G     V  VP+S   GDN++
Sbjct: 282 PIILAVNKCDKAE---ADPEKVKKELLAYDVVCEDYG---GDVQAVPVSALTGDNLM 332


>BC064977-1|AAH64977.1|  465|Homo sapiens MTIF2 protein protein.
          Length = 465

 Score = 35.5 bits (78), Expect = 0.26
 Identities = 33/117 (28%), Positives = 49/117 (41%), Gaps = 1/117 (0%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 477
           +T +D PGH  F      G    D  VL+VAA  G  +  +    ++ +HA  A      
Sbjct: 230 ITFLDTPGHAAFSAMRARGAQVTDIVVLVVAADDGVMKQTV----ESIQHAKDAQV---- 281

Query: 478 QLIVGVNKMDSLNHHTVSPD-LRKSRRKYPHTSRRLGYNPAAVAFVPISGWHGDNML 645
            +I+ VNK D        P+ ++K    Y       G     V  VP+S   GDN++
Sbjct: 282 PIILAVNKCDKAE---ADPEKVKKELLAYDVVCEDYG---GDVQAVPVSALTGDNLM 332


>BC039848-1|AAH39848.1|  500|Homo sapiens Similar to mitochondrial
           translational initiation factor 2 protein.
          Length = 500

 Score = 35.5 bits (78), Expect = 0.26
 Identities = 33/117 (28%), Positives = 49/117 (41%), Gaps = 1/117 (0%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 477
           +T +D PGH  F      G    D  VL+VAA  G  +  +    ++ +HA  A      
Sbjct: 230 ITFLDTPGHAAFSAMRARGAQVTDIVVLVVAADDGVMKQTV----ESIQHAKDAQV---- 281

Query: 478 QLIVGVNKMDSLNHHTVSPD-LRKSRRKYPHTSRRLGYNPAAVAFVPISGWHGDNML 645
            +I+ VNK D        P+ ++K    Y       G     V  VP+S   GDN++
Sbjct: 282 PIILAVNKCDKAE---ADPEKVKKELLAYDVVCEDYG---GDVQAVPVSALTGDNLM 332


>AF495546-1|AAM70196.1|  727|Homo sapiens translation initiation
           factor 2 protein.
          Length = 727

 Score = 35.5 bits (78), Expect = 0.26
 Identities = 33/117 (28%), Positives = 49/117 (41%), Gaps = 1/117 (0%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 477
           +T +D PGH  F      G    D  VL+VAA  G  +  +    ++ +HA  A      
Sbjct: 230 ITFLDTPGHAAFSAMRARGAQVTDIVVLVVAADDGVMKQTV----ESIQHAKDAQV---- 281

Query: 478 QLIVGVNKMDSLNHHTVSPD-LRKSRRKYPHTSRRLGYNPAAVAFVPISGWHGDNML 645
            +I+ VNK D        P+ ++K    Y       G     V  VP+S   GDN++
Sbjct: 282 PIILAVNKCDKAE---ADPEKVKKELLAYDVVCEDYG---GDVQAVPVSALTGDNLM 332


>AF494407-1|AAM14617.1|  727|Homo sapiens mitochondrial
           translation-initiation factor 2 protein.
          Length = 727

 Score = 35.5 bits (78), Expect = 0.26
 Identities = 33/117 (28%), Positives = 49/117 (41%), Gaps = 1/117 (0%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 477
           +T +D PGH  F      G    D  VL+VAA  G  +  +    ++ +HA  A      
Sbjct: 230 ITFLDTPGHAAFSAMRARGAQVTDIVVLVVAADDGVMKQTV----ESIQHAKDAQV---- 281

Query: 478 QLIVGVNKMDSLNHHTVSPD-LRKSRRKYPHTSRRLGYNPAAVAFVPISGWHGDNML 645
            +I+ VNK D        P+ ++K    Y       G     V  VP+S   GDN++
Sbjct: 282 PIILAVNKCDKAE---ADPEKVKKELLAYDVVCEDYG---GDVQAVPVSALTGDNLM 332


>M27364-1|AAA52344.1|  227|Homo sapiens EEF1A protein.
          Length = 227

 Score = 35.1 bits (77), Expect = 0.34
 Identities = 21/44 (47%), Positives = 26/44 (59%)
 Frame = +3

Query: 744 PATCPXPDKPLRLPCKTYTKFXGXGTVPVXQNLKLVC*KPGTIV 875
           P T P  DKPLRLP +   K  G GTVPV + ++    KPG +V
Sbjct: 4   PPTRPT-DKPLRLPLQGVYKIGGIGTVPVGR-VETGVLKPGMVV 45


>Z11692-1|CAA77750.1|  858|Homo sapiens human  elongation factor 2
           protein.
          Length = 858

 Score = 32.7 bits (71), Expect = 1.8
 Identities = 16/32 (50%), Positives = 19/32 (59%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 137
           M K+    N+ VI HVD GKST T  L+ K G
Sbjct: 13  MDKKANIRNMSVIAHVDHGKSTLTDSLVCKAG 44


>X51466-1|CAA35829.1|  858|Homo sapiens elongation factor 2 protein.
          Length = 858

 Score = 32.7 bits (71), Expect = 1.8
 Identities = 16/32 (50%), Positives = 19/32 (59%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 137
           M K+    N+ VI HVD GKST T  L+ K G
Sbjct: 13  MDKKANIRNMSVIAHVDHGKSTLTDSLVCKAG 44


>BC126259-1|AAI26260.1|  858|Homo sapiens EEF2 protein protein.
          Length = 858

 Score = 32.7 bits (71), Expect = 1.8
 Identities = 16/32 (50%), Positives = 19/32 (59%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 137
           M K+    N+ VI HVD GKST T  L+ K G
Sbjct: 13  MDKKANIRNMSVIAHVDHGKSTLTDSLVCKAG 44


>BC006547-1|AAH06547.1|  583|Homo sapiens EEF2 protein protein.
          Length = 583

 Score = 32.7 bits (71), Expect = 1.8
 Identities = 16/32 (50%), Positives = 19/32 (59%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 137
           M K+    N+ VI HVD GKST T  L+ K G
Sbjct: 13  MDKKANIRNMSVIAHVDHGKSTLTDSLVCKAG 44


>AY942181-1|AAX34409.1|  858|Homo sapiens elongation factor 2
           protein.
          Length = 858

 Score = 32.7 bits (71), Expect = 1.8
 Identities = 16/32 (50%), Positives = 19/32 (59%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 137
           M K+    N+ VI HVD GKST T  L+ K G
Sbjct: 13  MDKKANIRNMSVIAHVDHGKSTLTDSLVCKAG 44


>AK023282-1|BAB14507.1|  669|Homo sapiens protein ( Homo sapiens
           cDNA FLJ13220 fis, clone NT2RP4002047, moderately
           similar to GTP-BINDING PROTEIN LEPA. ).
          Length = 669

 Score = 32.3 bits (70), Expect = 2.4
 Identities = 14/28 (50%), Positives = 17/28 (60%)
 Frame = +3

Query: 66  NIVVIGHVDSGKSTTTGHLIYKCGGIDK 149
           N  ++ HVD GKST T  L+   G IDK
Sbjct: 70  NFSIVAHVDHGKSTLTDRLLELTGTIDK 97



 Score = 31.5 bits (68), Expect = 4.2
 Identities = 24/79 (30%), Positives = 35/79 (44%)
 Frame = +1

Query: 280 ETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLA 459
           E  +Y + +ID PGH DF   +    S     +L+V A  G          QT  +  LA
Sbjct: 130 EGKQYLLNLIDTPGHVDFSYEVSRSLSACQGVLLVVDANEG-------IQAQTVANFFLA 182

Query: 460 FTLGVKQLIVGVNKMDSLN 516
           F   +  + V +NK+D  N
Sbjct: 183 FEAQLSVIPV-INKIDLKN 200


>BC036768-1|AAH36768.1|  669|Homo sapiens GUF1 GTPase homolog (S.
           cerevisiae) protein.
          Length = 669

 Score = 31.5 bits (68), Expect = 4.2
 Identities = 24/79 (30%), Positives = 35/79 (44%)
 Frame = +1

Query: 280 ETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLA 459
           E  +Y + +ID PGH DF   +    S     +L+V A  G          QT  +  LA
Sbjct: 130 EGKQYLLNLIDTPGHVDFSYEVSRSLSACQGVLLVVDANEG-------IQAQTVANFFLA 182

Query: 460 FTLGVKQLIVGVNKMDSLN 516
           F   +  + V +NK+D  N
Sbjct: 183 FEAQLSVIPV-INKIDLKN 200



 Score = 30.3 bits (65), Expect = 9.6
 Identities = 13/28 (46%), Positives = 16/28 (57%)
 Frame = +3

Query: 66  NIVVIGHVDSGKSTTTGHLIYKCGGIDK 149
           N  ++ HVD GKST    L+   G IDK
Sbjct: 70  NFSIVAHVDHGKSTLADRLLELTGTIDK 97


>BC030612-1|AAH30612.1|  777|Homo sapiens G elongation factor,
           mitochondrial 2 protein.
          Length = 777

 Score = 31.5 bits (68), Expect = 4.2
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = +3

Query: 66  NIVVIGHVDSGKSTTTGHLIYKCG 137
           NI ++ H+D+GK+TTT  ++Y  G
Sbjct: 72  NIGIMAHIDAGKTTTTERILYYSG 95


>BC015712-1|AAH15712.1|  779|Homo sapiens GFM2 protein protein.
          Length = 779

 Score = 31.5 bits (68), Expect = 4.2
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = +3

Query: 66  NIVVIGHVDSGKSTTTGHLIYKCG 137
           NI ++ H+D+GK+TTT  ++Y  G
Sbjct: 72  NIGIMAHIDAGKTTTTERILYYSG 95


>AY453587-1|AAS49035.1|  531|Homo sapiens elongation factor G
           isoform protein.
          Length = 531

 Score = 31.5 bits (68), Expect = 4.2
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = +3

Query: 66  NIVVIGHVDSGKSTTTGHLIYKCG 137
           NI ++ H+D+GK+TTT  ++Y  G
Sbjct: 72  NIGIMAHIDAGKTTTTERILYYSG 95


>AK025314-1|BAB15109.1|  513|Homo sapiens protein ( Homo sapiens
           cDNA: FLJ21661 fis, clone COL08837. ).
          Length = 513

 Score = 31.5 bits (68), Expect = 4.2
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = +3

Query: 66  NIVVIGHVDSGKSTTTGHLIYKCG 137
           NI ++ H+D+GK+TTT  ++Y  G
Sbjct: 72  NIGIMAHIDAGKTTTTERILYYSG 95


>AF367997-1|AAK53401.1|  779|Homo sapiens elongation factor G2
           protein.
          Length = 779

 Score = 31.5 bits (68), Expect = 4.2
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = +3

Query: 66  NIVVIGHVDSGKSTTTGHLIYKCG 137
           NI ++ H+D+GK+TTT  ++Y  G
Sbjct: 72  NIGIMAHIDAGKTTTTERILYYSG 95


>AF111808-1|AAL39010.1|  732|Homo sapiens MSTP027 protein.
          Length = 732

 Score = 31.5 bits (68), Expect = 4.2
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = +3

Query: 66  NIVVIGHVDSGKSTTTGHLIYKCG 137
           NI ++ H+D+GK+TTT  ++Y  G
Sbjct: 72  NIGIMAHIDAGKTTTTERILYYSG 95


>BC049210-1|AAH49210.1|  751|Homo sapiens G elongation factor,
           mitochondrial 1 protein.
          Length = 751

 Score = 30.7 bits (66), Expect = 7.3
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +3

Query: 66  NIVVIGHVDSGKSTTTGHLIYKCGGIDK 149
           NI +  H+DSGK+T T  ++Y  G I K
Sbjct: 48  NIGISAHIDSGKTTLTERVLYYTGRIAK 75


>BC032639-1|AAH32639.1| 1220|Homo sapiens eukaryotic translation
           initiation factor 5B protein.
          Length = 1220

 Score = 30.7 bits (66), Expect = 7.3
 Identities = 27/78 (34%), Positives = 35/78 (44%)
 Frame = +1

Query: 304 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 483
           IID PGH  F      G+S  D A+L+V     +   G+    QT E   L  +      
Sbjct: 700 IIDTPGHESFSNLRNRGSSLCDIAILVV-----DIMHGLEP--QTIESINLLKSKKC-PF 751

Query: 484 IVGVNKMDSLNHHTVSPD 537
           IV +NK+D L     SPD
Sbjct: 752 IVALNKIDRLYDWKKSPD 769


>AL133563-1|CAB63717.1| 1132|Homo sapiens hypothetical protein
           protein.
          Length = 1132

 Score = 30.7 bits (66), Expect = 7.3
 Identities = 27/78 (34%), Positives = 35/78 (44%)
 Frame = +1

Query: 304 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 483
           IID PGH  F      G+S  D A+L+V     +   G+    QT E   L  +      
Sbjct: 612 IIDTPGHESFSNLRNRGSSLCDIAILVV-----DIMHGLEP--QTIESINLLKSKKC-PF 663

Query: 484 IVGVNKMDSLNHHTVSPD 537
           IV +NK+D L     SPD
Sbjct: 664 IVALNKIDRLYDWKKSPD 681


>AJ006776-1|CAB44357.1| 1220|Homo sapiens IF2 protein protein.
          Length = 1220

 Score = 30.7 bits (66), Expect = 7.3
 Identities = 27/78 (34%), Positives = 35/78 (44%)
 Frame = +1

Query: 304 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 483
           IID PGH  F      G+S  D A+L+V     +   G+    QT E   L  +      
Sbjct: 700 IIDTPGHESFSNLRNRGSSLCDIAILVV-----DIMHGLEP--QTIESINLLKSKKC-PF 751

Query: 484 IVGVNKMDSLNHHTVSPD 537
           IV +NK+D L     SPD
Sbjct: 752 IVALNKIDRLYDWKKSPD 769


>AF367998-1|AAK53402.1|  751|Homo sapiens elongation factor G1
           protein.
          Length = 751

 Score = 30.7 bits (66), Expect = 7.3
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +3

Query: 66  NIVVIGHVDSGKSTTTGHLIYKCGGIDK 149
           NI +  H+DSGK+T T  ++Y  G I K
Sbjct: 48  NIGISAHIDSGKTTLTERVLYYTGRIAK 75


>AF309777-1|AAK58877.1|  751|Homo sapiens elongation factor G
           protein.
          Length = 751

 Score = 30.7 bits (66), Expect = 7.3
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +3

Query: 66  NIVVIGHVDSGKSTTTGHLIYKCGGIDK 149
           NI +  H+DSGK+T T  ++Y  G I K
Sbjct: 48  NIGISAHIDSGKTTLTERVLYYTGRIAK 75


>AF078035-1|AAD16006.1| 1220|Homo sapiens translation initiation
           factor IF2 protein.
          Length = 1220

 Score = 30.7 bits (66), Expect = 7.3
 Identities = 27/78 (34%), Positives = 35/78 (44%)
 Frame = +1

Query: 304 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 483
           IID PGH  F      G+S  D A+L+V     +   G+    QT E   L  +      
Sbjct: 700 IIDTPGHESFSNLRNRGSSLCDIAILVV-----DIMHGLEP--QTIESINLLKSKKC-PF 751

Query: 484 IVGVNKMDSLNHHTVSPD 537
           IV +NK+D L     SPD
Sbjct: 752 IVALNKIDRLYDWKKSPD 769


>AC018690-1|AAY24313.1|  728|Homo sapiens unknown protein.
          Length = 728

 Score = 30.7 bits (66), Expect = 7.3
 Identities = 27/78 (34%), Positives = 35/78 (44%)
 Frame = +1

Query: 304 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 483
           IID PGH  F      G+S  D A+L+V     +   G+    QT E   L  +      
Sbjct: 208 IIDTPGHESFSNLRNRGSSLCDIAILVV-----DIMHGLEP--QTIESINLLKSKKC-PF 259

Query: 484 IVGVNKMDSLNHHTVSPD 537
           IV +NK+D L     SPD
Sbjct: 260 IVALNKIDRLYDWKKSPD 277


>AB018284-1|BAA34461.2| 1222|Homo sapiens KIAA0741 protein protein.
          Length = 1222

 Score = 30.7 bits (66), Expect = 7.3
 Identities = 27/78 (34%), Positives = 35/78 (44%)
 Frame = +1

Query: 304 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 483
           IID PGH  F      G+S  D A+L+V     +   G+    QT E   L  +      
Sbjct: 702 IIDTPGHESFSNLRNRGSSLCDIAILVV-----DIMHGLEP--QTIESINLLKSKKC-PF 753

Query: 484 IVGVNKMDSLNHHTVSPD 537
           IV +NK+D L     SPD
Sbjct: 754 IVALNKIDRLYDWKKSPD 771


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 136,267,620
Number of Sequences: 237096
Number of extensions: 3025272
Number of successful extensions: 11280
Number of sequences better than 10.0: 122
Number of HSP's better than 10.0 without gapping: 10602
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11082
length of database: 76,859,062
effective HSP length: 90
effective length of database: 55,520,422
effective search space used: 11215125244
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -