SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30141.Seq
         (897 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC003683-1|AAH03683.1|  385|Homo sapiens FLOT2 protein protein.       142   1e-33
M60922-1|AAA65729.1|  379|Homo sapiens surface antigen protein.       139   1e-32
CR542265-1|CAG47061.1|  379|Homo sapiens FLOT2 protein.               139   1e-32
CR541784-1|CAG46583.1|  379|Homo sapiens FLOT2 protein.               139   1e-32
BT019478-1|AAV38285.1|  379|Homo sapiens flotillin 2 protein.         139   1e-32
BT019477-1|AAV38284.1|  379|Homo sapiens flotillin 2 protein.         139   1e-32
BC017292-1|AAH17292.1|  379|Homo sapiens FLOT2 protein protein.       139   1e-32
AF117234-1|AAF17215.1|  253|Homo sapiens flotillin protein.            98   3e-20
CR456946-1|CAG33227.1|  427|Homo sapiens FLOT1 protein.                97   6e-20
BX248307-15|CAM25942.1|  185|Homo sapiens flotillin 1 protein.         97   6e-20
BX248307-12|CAM25939.1|  235|Homo sapiens flotillin 1 protein.         97   6e-20
BX248307-11|CAM25937.1|  252|Homo sapiens flotillin 1 protein.         97   6e-20
BX248307-9|CAM25936.1|  427|Homo sapiens flotillin 1 protein.          97   6e-20
BT007077-1|AAP35740.1|  427|Homo sapiens flotillin 1 protein.          97   6e-20
BC001146-1|AAH01146.1|  427|Homo sapiens flotillin 1 protein.          97   6e-20
BA000025-68|BAB63320.1|  427|Homo sapiens FLOT1 protein.               97   6e-20
AL845353-27|CAI41896.1|  427|Homo sapiens flotillin 1 protein.         97   6e-20
AL845353-26|CAI41895.1|  305|Homo sapiens flotillin 1 protein.         97   6e-20
AL662848-16|CAM24857.1|  185|Homo sapiens flotillin 1 protein.         97   6e-20
AL662848-14|CAM24856.1|  235|Homo sapiens flotillin 1 protein.         97   6e-20
AL662848-11|CAM24852.1|  252|Homo sapiens flotillin 1 protein.         97   6e-20
AL662848-10|CAI17443.1|  427|Homo sapiens flotillin 1 protein.         97   6e-20
AL662797-20|CAM25521.1|  185|Homo sapiens flotillin 1 protein.         97   6e-20
AL662797-17|CAM25520.1|  235|Homo sapiens flotillin 1 protein.         97   6e-20
AL662797-16|CAM25518.1|  252|Homo sapiens flotillin 1 protein.         97   6e-20
AL662797-14|CAI18202.1|  427|Homo sapiens flotillin 1 protein.         97   6e-20
AF089750-1|AAC35387.1|  427|Homo sapiens flotillin-1 protein.          97   6e-20
AB202099-2|BAE78620.1|  427|Homo sapiens flotillin 1 protein.          97   6e-20
AB103607-2|BAF31269.1|  427|Homo sapiens FLOT1 protein protein.        97   6e-20
AB088101-2|BAC54934.1|  427|Homo sapiens flotillin 1 protein.          97   6e-20
AK222530-1|BAD96250.1|  427|Homo sapiens flotillin 1 variant pro...    93   1e-18
BX248307-13|CAM25941.1|  192|Homo sapiens flotillin 1 protein.         70   1e-11
BX248307-10|CAM25938.1|  238|Homo sapiens flotillin 1 protein.         70   1e-11
AL662848-15|CAM24855.1|  192|Homo sapiens flotillin 1 protein.         70   1e-11
AL662848-12|CAM24853.1|  238|Homo sapiens flotillin 1 protein.         70   1e-11
AL662797-18|CAM25519.1|  192|Homo sapiens flotillin 1 protein.         70   1e-11
AL662797-15|CAM25517.1|  238|Homo sapiens flotillin 1 protein.         70   1e-11
BC060864-1|AAH60864.1|  607|Homo sapiens UDP-N-acetyl-alpha-D-ga...    33   1.4  
U29175-1|AAB40977.1| 1647|Homo sapiens transcriptional activator...    31   4.3  
D26156-1|BAA05143.1| 1647|Homo sapiens transcriptional activator...    31   4.3  
BC150298-1|AAI50299.1| 1647|Homo sapiens SWI/SNF related, matrix...    31   4.3  
BC139924-1|AAI39925.1|  584|Homo sapiens SMARCA4 protein protein.      31   4.3  
BC139917-1|AAI39918.1|  584|Homo sapiens SMARCA4 protein protein.      31   4.3  
AF254822-2|AAG24789.1| 1647|Homo sapiens SMARCA4 isoform 1 protein.    31   4.3  
AF254822-1|AAG24790.1| 1679|Homo sapiens SMARCA4 isoform 2 protein.    31   4.3  
AB209313-1|BAD92550.1| 1164|Homo sapiens SWI/SNF-related matrix-...    31   4.3  
X72889-1|CAA51407.1| 1586|Homo sapiens HBRM protein.                   31   7.5  
D26155-1|BAA05142.1| 1572|Homo sapiens transcriptional activator...    31   7.5  
AL359076-5|CAI12969.1|  559|Homo sapiens SWI/SNF related, matrix...    31   7.5  
AL359076-4|CAI12968.1| 1572|Homo sapiens SWI/SNF related, matrix...    31   7.5  
AL359076-3|CAI12967.1| 1590|Homo sapiens SWI/SNF related, matrix...    31   7.5  
AL138755-9|CAI14600.1| 1572|Homo sapiens SWI/SNF related, matrix...    31   7.5  
AL138755-8|CAI14599.1| 1590|Homo sapiens SWI/SNF related, matrix...    31   7.5  
BC037341-1|AAH37341.3|  607|Homo sapiens UDP-N-acetyl-alpha-D-ga...    30   9.9  
AJ626724-1|CAF25035.1|  607|Homo sapiens GalNAc-transferase 18 p...    30   9.9  
AB078147-1|BAD93179.1|  607|Homo sapiens UDP-N-acetyl-alpha-D-ga...    30   9.9  

>BC003683-1|AAH03683.1|  385|Homo sapiens FLOT2 protein protein.
          Length = 385

 Score =  142 bits (345), Expect = 1e-33
 Identities = 84/179 (46%), Positives = 106/179 (59%)
 Frame = +3

Query: 255 EVMTLNPMCEYVETAQGVPLTVTGVAQCKIMNEDELLTTACEQFLGKTVKEIKMTVLQTL 434
           E+MTL P CE VETA+GV LTVTGVAQ KIM E ELL  ACEQFLGK V++IK  VLQTL
Sbjct: 48  EIMTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTL 107

Query: 435 EGHLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASL 614
           EGHLR+ILGTLTVE++Y+DRDQFA    +                 ++         +SL
Sbjct: 108 EGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSL 167

Query: 615 GKFATANVKRDAERPCRSG*PRCWY*GSGIEKNAMDVKIFD*HPKLKDNRDSSKFQKGA 791
           GK  TA V+RDA+              +  +K  +DVK F    K+ D++ + + QK A
Sbjct: 168 GKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVK-FMADTKIADSKRAFELQKSA 225



 Score = 79.0 bits (186), Expect = 2e-14
 Identities = 32/48 (66%), Positives = 38/48 (79%)
 Frame = +1

Query: 115 MGNIHTVGPNEALIVSGGCFGPTTKRTIVGGWAWAWCLVTDVQRISLK 258
           MGN HTVGPNEAL+VSGGC G   K+ + GGWAWAW  ++D QRISL+
Sbjct: 1   MGNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISLE 48


>M60922-1|AAA65729.1|  379|Homo sapiens surface antigen protein.
          Length = 379

 Score =  139 bits (337), Expect = 1e-32
 Identities = 83/177 (46%), Positives = 104/177 (58%)
 Frame = +3

Query: 261 MTLNPMCEYVETAQGVPLTVTGVAQCKIMNEDELLTTACEQFLGKTVKEIKMTVLQTLEG 440
           MTL P CE VETA+GV LTVTGVAQ KIM E ELL  ACEQFLGK V++IK  VLQTLEG
Sbjct: 1   MTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEG 60

Query: 441 HLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLGK 620
           HLR+ILGTLTVE++Y+DRDQFA    +                 ++         +SLGK
Sbjct: 61  HLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGK 120

Query: 621 FATANVKRDAERPCRSG*PRCWY*GSGIEKNAMDVKIFD*HPKLKDNRDSSKFQKGA 791
             TA V+RDA+              +  +K  +DVK F    K+ D++ + + QK A
Sbjct: 121 TQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVK-FMADTKIADSKRAFELQKSA 176


>CR542265-1|CAG47061.1|  379|Homo sapiens FLOT2 protein.
          Length = 379

 Score =  139 bits (337), Expect = 1e-32
 Identities = 83/177 (46%), Positives = 104/177 (58%)
 Frame = +3

Query: 261 MTLNPMCEYVETAQGVPLTVTGVAQCKIMNEDELLTTACEQFLGKTVKEIKMTVLQTLEG 440
           MTL P CE VETA+GV LTVTGVAQ KIM E ELL  ACEQFLGK V++IK  VLQTLEG
Sbjct: 1   MTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEG 60

Query: 441 HLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLGK 620
           HLR+ILGTLTVE++Y+DRDQFA    +                 ++         +SLGK
Sbjct: 61  HLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGK 120

Query: 621 FATANVKRDAERPCRSG*PRCWY*GSGIEKNAMDVKIFD*HPKLKDNRDSSKFQKGA 791
             TA V+RDA+              +  +K  +DVK F    K+ D++ + + QK A
Sbjct: 121 TQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVK-FMADTKIADSKRAFELQKSA 176


>CR541784-1|CAG46583.1|  379|Homo sapiens FLOT2 protein.
          Length = 379

 Score =  139 bits (337), Expect = 1e-32
 Identities = 83/177 (46%), Positives = 104/177 (58%)
 Frame = +3

Query: 261 MTLNPMCEYVETAQGVPLTVTGVAQCKIMNEDELLTTACEQFLGKTVKEIKMTVLQTLEG 440
           MTL P CE VETA+GV LTVTGVAQ KIM E ELL  ACEQFLGK V++IK  VLQTLEG
Sbjct: 1   MTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEG 60

Query: 441 HLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLGK 620
           HLR+ILGTLTVE++Y+DRDQFA    +                 ++         +SLGK
Sbjct: 61  HLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGK 120

Query: 621 FATANVKRDAERPCRSG*PRCWY*GSGIEKNAMDVKIFD*HPKLKDNRDSSKFQKGA 791
             TA V+RDA+              +  +K  +DVK F    K+ D++ + + QK A
Sbjct: 121 TQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVK-FMADTKIADSKRAFELQKSA 176


>BT019478-1|AAV38285.1|  379|Homo sapiens flotillin 2 protein.
          Length = 379

 Score =  139 bits (337), Expect = 1e-32
 Identities = 83/177 (46%), Positives = 104/177 (58%)
 Frame = +3

Query: 261 MTLNPMCEYVETAQGVPLTVTGVAQCKIMNEDELLTTACEQFLGKTVKEIKMTVLQTLEG 440
           MTL P CE VETA+GV LTVTGVAQ KIM E ELL  ACEQFLGK V++IK  VLQTLEG
Sbjct: 1   MTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEG 60

Query: 441 HLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLGK 620
           HLR+ILGTLTVE++Y+DRDQFA    +                 ++         +SLGK
Sbjct: 61  HLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGK 120

Query: 621 FATANVKRDAERPCRSG*PRCWY*GSGIEKNAMDVKIFD*HPKLKDNRDSSKFQKGA 791
             TA V+RDA+              +  +K  +DVK F    K+ D++ + + QK A
Sbjct: 121 TQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVK-FMADTKIADSKRAFELQKSA 176


>BT019477-1|AAV38284.1|  379|Homo sapiens flotillin 2 protein.
          Length = 379

 Score =  139 bits (337), Expect = 1e-32
 Identities = 83/177 (46%), Positives = 104/177 (58%)
 Frame = +3

Query: 261 MTLNPMCEYVETAQGVPLTVTGVAQCKIMNEDELLTTACEQFLGKTVKEIKMTVLQTLEG 440
           MTL P CE VETA+GV LTVTGVAQ KIM E ELL  ACEQFLGK V++IK  VLQTLEG
Sbjct: 1   MTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEG 60

Query: 441 HLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLGK 620
           HLR+ILGTLTVE++Y+DRDQFA    +                 ++         +SLGK
Sbjct: 61  HLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGK 120

Query: 621 FATANVKRDAERPCRSG*PRCWY*GSGIEKNAMDVKIFD*HPKLKDNRDSSKFQKGA 791
             TA V+RDA+              +  +K  +DVK F    K+ D++ + + QK A
Sbjct: 121 TQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVK-FMADTKIADSKRAFELQKSA 176


>BC017292-1|AAH17292.1|  379|Homo sapiens FLOT2 protein protein.
          Length = 379

 Score =  139 bits (337), Expect = 1e-32
 Identities = 83/177 (46%), Positives = 104/177 (58%)
 Frame = +3

Query: 261 MTLNPMCEYVETAQGVPLTVTGVAQCKIMNEDELLTTACEQFLGKTVKEIKMTVLQTLEG 440
           MTL P CE VETA+GV LTVTGVAQ KIM E ELL  ACEQFLGK V++IK  VLQTLEG
Sbjct: 1   MTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEG 60

Query: 441 HLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLGK 620
           HLR+ILGTLTVE++Y+DRDQFA    +                 ++         +SLGK
Sbjct: 61  HLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGK 120

Query: 621 FATANVKRDAERPCRSG*PRCWY*GSGIEKNAMDVKIFD*HPKLKDNRDSSKFQKGA 791
             TA V+RDA+              +  +K  +DVK F    K+ D++ + + QK A
Sbjct: 121 TQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVK-FMADTKIADSKRAFELQKSA 176


>AF117234-1|AAF17215.1|  253|Homo sapiens flotillin protein.
          Length = 253

 Score = 98.3 bits (234), Expect = 3e-20
 Identities = 56/131 (42%), Positives = 73/131 (55%), Gaps = 1/131 (0%)
 Frame = +3

Query: 261 MTLNPMCEYVETAQGVPLTVTGVAQCKIMNED-ELLTTACEQFLGKTVKEIKMTVLQTLE 437
           +TLN   E V T  GVP++VTG+AQ KI  ++ E+L  AC+ FLGKT  EI    L+TLE
Sbjct: 46  LTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLE 105

Query: 438 GHLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLG 617
           GH RAI+  +TVEE+YKDR +F+    K                 L+          SLG
Sbjct: 106 GHQRAIMANMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLG 165

Query: 618 KFATANVKRDA 650
           K  TA V++DA
Sbjct: 166 KARTAQVQKDA 176



 Score = 36.3 bits (80), Expect = 0.15
 Identities = 18/42 (42%), Positives = 24/42 (57%)
 Frame = +1

Query: 130 TVGPNEALIVSGGCFGPTTKRTIVGGWAWAWCLVTDVQRISL 255
           T GPNEA++VSG C  P     + GG  +    +  +QRISL
Sbjct: 4   TCGPNEAMVVSGFCRSPPV--MVAGGRVFVLPCIQQIQRISL 43


>CR456946-1|CAG33227.1|  427|Homo sapiens FLOT1 protein.
          Length = 427

 Score = 97.5 bits (232), Expect = 6e-20
 Identities = 56/131 (42%), Positives = 73/131 (55%), Gaps = 1/131 (0%)
 Frame = +3

Query: 261 MTLNPMCEYVETAQGVPLTVTGVAQCKIMNED-ELLTTACEQFLGKTVKEIKMTVLQTLE 437
           +TLN   E V T  GVP++VTG+AQ KI  ++ E+L  AC+ FLGKT  EI    L+TLE
Sbjct: 46  LTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLE 105

Query: 438 GHLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLG 617
           GH RAI+  +TVEE+YKDR +F+    K                 L+          SLG
Sbjct: 106 GHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLG 165

Query: 618 KFATANVKRDA 650
           K  TA V++DA
Sbjct: 166 KARTAQVQKDA 176



 Score = 36.3 bits (80), Expect = 0.15
 Identities = 18/42 (42%), Positives = 24/42 (57%)
 Frame = +1

Query: 130 TVGPNEALIVSGGCFGPTTKRTIVGGWAWAWCLVTDVQRISL 255
           T GPNEA++VSG C  P     + GG  +    +  +QRISL
Sbjct: 4   TCGPNEAMVVSGFCRSPPV--IVAGGRVFVLPCIQQIQRISL 43


>BX248307-15|CAM25942.1|  185|Homo sapiens flotillin 1 protein.
          Length = 185

 Score = 97.5 bits (232), Expect = 6e-20
 Identities = 56/131 (42%), Positives = 73/131 (55%), Gaps = 1/131 (0%)
 Frame = +3

Query: 261 MTLNPMCEYVETAQGVPLTVTGVAQCKIMNED-ELLTTACEQFLGKTVKEIKMTVLQTLE 437
           +TLN   E V T  GVP++VTG+AQ KI  ++ E+L  AC+ FLGKT  EI    L+TLE
Sbjct: 46  LTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLE 105

Query: 438 GHLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLG 617
           GH RAI+  +TVEE+YKDR +F+    K                 L+          SLG
Sbjct: 106 GHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLG 165

Query: 618 KFATANVKRDA 650
           K  TA V++DA
Sbjct: 166 KARTAQVQKDA 176



 Score = 36.3 bits (80), Expect = 0.15
 Identities = 18/42 (42%), Positives = 24/42 (57%)
 Frame = +1

Query: 130 TVGPNEALIVSGGCFGPTTKRTIVGGWAWAWCLVTDVQRISL 255
           T GPNEA++VSG C  P     + GG  +    +  +QRISL
Sbjct: 4   TCGPNEAMVVSGFCRSPPV--MVAGGRVFVLPCIQQIQRISL 43


>BX248307-12|CAM25939.1|  235|Homo sapiens flotillin 1 protein.
          Length = 235

 Score = 97.5 bits (232), Expect = 6e-20
 Identities = 56/131 (42%), Positives = 73/131 (55%), Gaps = 1/131 (0%)
 Frame = +3

Query: 261 MTLNPMCEYVETAQGVPLTVTGVAQCKIMNED-ELLTTACEQFLGKTVKEIKMTVLQTLE 437
           +TLN   E V T  GVP++VTG+AQ KI  ++ E+L  AC+ FLGKT  EI    L+TLE
Sbjct: 46  LTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLE 105

Query: 438 GHLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLG 617
           GH RAI+  +TVEE+YKDR +F+    K                 L+          SLG
Sbjct: 106 GHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLG 165

Query: 618 KFATANVKRDA 650
           K  TA V++DA
Sbjct: 166 KARTAQVQKDA 176



 Score = 36.3 bits (80), Expect = 0.15
 Identities = 18/42 (42%), Positives = 24/42 (57%)
 Frame = +1

Query: 130 TVGPNEALIVSGGCFGPTTKRTIVGGWAWAWCLVTDVQRISL 255
           T GPNEA++VSG C  P     + GG  +    +  +QRISL
Sbjct: 4   TCGPNEAMVVSGFCRSPPV--MVAGGRVFVLPCIQQIQRISL 43


>BX248307-11|CAM25937.1|  252|Homo sapiens flotillin 1 protein.
          Length = 252

 Score = 97.5 bits (232), Expect = 6e-20
 Identities = 56/131 (42%), Positives = 73/131 (55%), Gaps = 1/131 (0%)
 Frame = +3

Query: 261 MTLNPMCEYVETAQGVPLTVTGVAQCKIMNED-ELLTTACEQFLGKTVKEIKMTVLQTLE 437
           +TLN   E V T  GVP++VTG+AQ KI  ++ E+L  AC+ FLGKT  EI    L+TLE
Sbjct: 46  LTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLE 105

Query: 438 GHLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLG 617
           GH RAI+  +TVEE+YKDR +F+    K                 L+          SLG
Sbjct: 106 GHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLG 165

Query: 618 KFATANVKRDA 650
           K  TA V++DA
Sbjct: 166 KARTAQVQKDA 176



 Score = 36.3 bits (80), Expect = 0.15
 Identities = 18/42 (42%), Positives = 24/42 (57%)
 Frame = +1

Query: 130 TVGPNEALIVSGGCFGPTTKRTIVGGWAWAWCLVTDVQRISL 255
           T GPNEA++VSG C  P     + GG  +    +  +QRISL
Sbjct: 4   TCGPNEAMVVSGFCRSPPV--MVAGGRVFVLPCIQQIQRISL 43


>BX248307-9|CAM25936.1|  427|Homo sapiens flotillin 1 protein.
          Length = 427

 Score = 97.5 bits (232), Expect = 6e-20
 Identities = 56/131 (42%), Positives = 73/131 (55%), Gaps = 1/131 (0%)
 Frame = +3

Query: 261 MTLNPMCEYVETAQGVPLTVTGVAQCKIMNED-ELLTTACEQFLGKTVKEIKMTVLQTLE 437
           +TLN   E V T  GVP++VTG+AQ KI  ++ E+L  AC+ FLGKT  EI    L+TLE
Sbjct: 46  LTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLE 105

Query: 438 GHLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLG 617
           GH RAI+  +TVEE+YKDR +F+    K                 L+          SLG
Sbjct: 106 GHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLG 165

Query: 618 KFATANVKRDA 650
           K  TA V++DA
Sbjct: 166 KARTAQVQKDA 176



 Score = 36.3 bits (80), Expect = 0.15
 Identities = 18/42 (42%), Positives = 24/42 (57%)
 Frame = +1

Query: 130 TVGPNEALIVSGGCFGPTTKRTIVGGWAWAWCLVTDVQRISL 255
           T GPNEA++VSG C  P     + GG  +    +  +QRISL
Sbjct: 4   TCGPNEAMVVSGFCRSPPV--MVAGGRVFVLPCIQQIQRISL 43


>BT007077-1|AAP35740.1|  427|Homo sapiens flotillin 1 protein.
          Length = 427

 Score = 97.5 bits (232), Expect = 6e-20
 Identities = 56/131 (42%), Positives = 73/131 (55%), Gaps = 1/131 (0%)
 Frame = +3

Query: 261 MTLNPMCEYVETAQGVPLTVTGVAQCKIMNED-ELLTTACEQFLGKTVKEIKMTVLQTLE 437
           +TLN   E V T  GVP++VTG+AQ KI  ++ E+L  AC+ FLGKT  EI    L+TLE
Sbjct: 46  LTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLE 105

Query: 438 GHLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLG 617
           GH RAI+  +TVEE+YKDR +F+    K                 L+          SLG
Sbjct: 106 GHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLG 165

Query: 618 KFATANVKRDA 650
           K  TA V++DA
Sbjct: 166 KARTAQVQKDA 176



 Score = 36.3 bits (80), Expect = 0.15
 Identities = 18/42 (42%), Positives = 24/42 (57%)
 Frame = +1

Query: 130 TVGPNEALIVSGGCFGPTTKRTIVGGWAWAWCLVTDVQRISL 255
           T GPNEA++VSG C  P     + GG  +    +  +QRISL
Sbjct: 4   TCGPNEAMVVSGFCRSPPV--MVAGGRVFVLPCIQQIQRISL 43


>BC001146-1|AAH01146.1|  427|Homo sapiens flotillin 1 protein.
          Length = 427

 Score = 97.5 bits (232), Expect = 6e-20
 Identities = 56/131 (42%), Positives = 73/131 (55%), Gaps = 1/131 (0%)
 Frame = +3

Query: 261 MTLNPMCEYVETAQGVPLTVTGVAQCKIMNED-ELLTTACEQFLGKTVKEIKMTVLQTLE 437
           +TLN   E V T  GVP++VTG+AQ KI  ++ E+L  AC+ FLGKT  EI    L+TLE
Sbjct: 46  LTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLE 105

Query: 438 GHLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLG 617
           GH RAI+  +TVEE+YKDR +F+    K                 L+          SLG
Sbjct: 106 GHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLG 165

Query: 618 KFATANVKRDA 650
           K  TA V++DA
Sbjct: 166 KARTAQVQKDA 176



 Score = 36.3 bits (80), Expect = 0.15
 Identities = 18/42 (42%), Positives = 24/42 (57%)
 Frame = +1

Query: 130 TVGPNEALIVSGGCFGPTTKRTIVGGWAWAWCLVTDVQRISL 255
           T GPNEA++VSG C  P     + GG  +    +  +QRISL
Sbjct: 4   TCGPNEAMVVSGFCRSPPV--MVAGGRVFVLPCIQQIQRISL 43


>BA000025-68|BAB63320.1|  427|Homo sapiens FLOT1 protein.
          Length = 427

 Score = 97.5 bits (232), Expect = 6e-20
 Identities = 56/131 (42%), Positives = 73/131 (55%), Gaps = 1/131 (0%)
 Frame = +3

Query: 261 MTLNPMCEYVETAQGVPLTVTGVAQCKIMNED-ELLTTACEQFLGKTVKEIKMTVLQTLE 437
           +TLN   E V T  GVP++VTG+AQ KI  ++ E+L  AC+ FLGKT  EI    L+TLE
Sbjct: 46  LTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLE 105

Query: 438 GHLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLG 617
           GH RAI+  +TVEE+YKDR +F+    K                 L+          SLG
Sbjct: 106 GHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLG 165

Query: 618 KFATANVKRDA 650
           K  TA V++DA
Sbjct: 166 KARTAQVQKDA 176



 Score = 36.3 bits (80), Expect = 0.15
 Identities = 18/42 (42%), Positives = 24/42 (57%)
 Frame = +1

Query: 130 TVGPNEALIVSGGCFGPTTKRTIVGGWAWAWCLVTDVQRISL 255
           T GPNEA++VSG C  P     + GG  +    +  +QRISL
Sbjct: 4   TCGPNEAMVVSGFCRSPPV--MVAGGRVFVLPCIQQIQRISL 43


>AL845353-27|CAI41896.1|  427|Homo sapiens flotillin 1 protein.
          Length = 427

 Score = 97.5 bits (232), Expect = 6e-20
 Identities = 56/131 (42%), Positives = 73/131 (55%), Gaps = 1/131 (0%)
 Frame = +3

Query: 261 MTLNPMCEYVETAQGVPLTVTGVAQCKIMNED-ELLTTACEQFLGKTVKEIKMTVLQTLE 437
           +TLN   E V T  GVP++VTG+AQ KI  ++ E+L  AC+ FLGKT  EI    L+TLE
Sbjct: 46  LTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLE 105

Query: 438 GHLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLG 617
           GH RAI+  +TVEE+YKDR +F+    K                 L+          SLG
Sbjct: 106 GHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLG 165

Query: 618 KFATANVKRDA 650
           K  TA V++DA
Sbjct: 166 KARTAQVQKDA 176



 Score = 36.3 bits (80), Expect = 0.15
 Identities = 18/42 (42%), Positives = 24/42 (57%)
 Frame = +1

Query: 130 TVGPNEALIVSGGCFGPTTKRTIVGGWAWAWCLVTDVQRISL 255
           T GPNEA++VSG C  P     + GG  +    +  +QRISL
Sbjct: 4   TCGPNEAMVVSGFCRSPPV--MVAGGRVFVLPCIQQIQRISL 43


>AL845353-26|CAI41895.1|  305|Homo sapiens flotillin 1 protein.
          Length = 305

 Score = 97.5 bits (232), Expect = 6e-20
 Identities = 56/131 (42%), Positives = 73/131 (55%), Gaps = 1/131 (0%)
 Frame = +3

Query: 261 MTLNPMCEYVETAQGVPLTVTGVAQCKIMNED-ELLTTACEQFLGKTVKEIKMTVLQTLE 437
           +TLN   E V T  GVP++VTG+AQ KI  ++ E+L  AC+ FLGKT  EI    L+TLE
Sbjct: 46  LTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLE 105

Query: 438 GHLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLG 617
           GH RAI+  +TVEE+YKDR +F+    K                 L+          SLG
Sbjct: 106 GHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLG 165

Query: 618 KFATANVKRDA 650
           K  TA V++DA
Sbjct: 166 KARTAQVQKDA 176



 Score = 36.3 bits (80), Expect = 0.15
 Identities = 18/42 (42%), Positives = 24/42 (57%)
 Frame = +1

Query: 130 TVGPNEALIVSGGCFGPTTKRTIVGGWAWAWCLVTDVQRISL 255
           T GPNEA++VSG C  P     + GG  +    +  +QRISL
Sbjct: 4   TCGPNEAMVVSGFCRSPPV--MVAGGRVFVLPCIQQIQRISL 43


>AL662848-16|CAM24857.1|  185|Homo sapiens flotillin 1 protein.
          Length = 185

 Score = 97.5 bits (232), Expect = 6e-20
 Identities = 56/131 (42%), Positives = 73/131 (55%), Gaps = 1/131 (0%)
 Frame = +3

Query: 261 MTLNPMCEYVETAQGVPLTVTGVAQCKIMNED-ELLTTACEQFLGKTVKEIKMTVLQTLE 437
           +TLN   E V T  GVP++VTG+AQ KI  ++ E+L  AC+ FLGKT  EI    L+TLE
Sbjct: 46  LTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLE 105

Query: 438 GHLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLG 617
           GH RAI+  +TVEE+YKDR +F+    K                 L+          SLG
Sbjct: 106 GHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLG 165

Query: 618 KFATANVKRDA 650
           K  TA V++DA
Sbjct: 166 KARTAQVQKDA 176



 Score = 36.3 bits (80), Expect = 0.15
 Identities = 18/42 (42%), Positives = 24/42 (57%)
 Frame = +1

Query: 130 TVGPNEALIVSGGCFGPTTKRTIVGGWAWAWCLVTDVQRISL 255
           T GPNEA++VSG C  P     + GG  +    +  +QRISL
Sbjct: 4   TCGPNEAMVVSGFCRSPPV--MVAGGRVFVLPCIQQIQRISL 43


>AL662848-14|CAM24856.1|  235|Homo sapiens flotillin 1 protein.
          Length = 235

 Score = 97.5 bits (232), Expect = 6e-20
 Identities = 56/131 (42%), Positives = 73/131 (55%), Gaps = 1/131 (0%)
 Frame = +3

Query: 261 MTLNPMCEYVETAQGVPLTVTGVAQCKIMNED-ELLTTACEQFLGKTVKEIKMTVLQTLE 437
           +TLN   E V T  GVP++VTG+AQ KI  ++ E+L  AC+ FLGKT  EI    L+TLE
Sbjct: 46  LTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLE 105

Query: 438 GHLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLG 617
           GH RAI+  +TVEE+YKDR +F+    K                 L+          SLG
Sbjct: 106 GHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLG 165

Query: 618 KFATANVKRDA 650
           K  TA V++DA
Sbjct: 166 KARTAQVQKDA 176



 Score = 36.3 bits (80), Expect = 0.15
 Identities = 18/42 (42%), Positives = 24/42 (57%)
 Frame = +1

Query: 130 TVGPNEALIVSGGCFGPTTKRTIVGGWAWAWCLVTDVQRISL 255
           T GPNEA++VSG C  P     + GG  +    +  +QRISL
Sbjct: 4   TCGPNEAMVVSGFCRSPPV--MVAGGRVFVLPCIQQIQRISL 43


>AL662848-11|CAM24852.1|  252|Homo sapiens flotillin 1 protein.
          Length = 252

 Score = 97.5 bits (232), Expect = 6e-20
 Identities = 56/131 (42%), Positives = 73/131 (55%), Gaps = 1/131 (0%)
 Frame = +3

Query: 261 MTLNPMCEYVETAQGVPLTVTGVAQCKIMNED-ELLTTACEQFLGKTVKEIKMTVLQTLE 437
           +TLN   E V T  GVP++VTG+AQ KI  ++ E+L  AC+ FLGKT  EI    L+TLE
Sbjct: 46  LTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLE 105

Query: 438 GHLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLG 617
           GH RAI+  +TVEE+YKDR +F+    K                 L+          SLG
Sbjct: 106 GHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLG 165

Query: 618 KFATANVKRDA 650
           K  TA V++DA
Sbjct: 166 KARTAQVQKDA 176



 Score = 36.3 bits (80), Expect = 0.15
 Identities = 18/42 (42%), Positives = 24/42 (57%)
 Frame = +1

Query: 130 TVGPNEALIVSGGCFGPTTKRTIVGGWAWAWCLVTDVQRISL 255
           T GPNEA++VSG C  P     + GG  +    +  +QRISL
Sbjct: 4   TCGPNEAMVVSGFCRSPPV--MVAGGRVFVLPCIQQIQRISL 43


>AL662848-10|CAI17443.1|  427|Homo sapiens flotillin 1 protein.
          Length = 427

 Score = 97.5 bits (232), Expect = 6e-20
 Identities = 56/131 (42%), Positives = 73/131 (55%), Gaps = 1/131 (0%)
 Frame = +3

Query: 261 MTLNPMCEYVETAQGVPLTVTGVAQCKIMNED-ELLTTACEQFLGKTVKEIKMTVLQTLE 437
           +TLN   E V T  GVP++VTG+AQ KI  ++ E+L  AC+ FLGKT  EI    L+TLE
Sbjct: 46  LTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLE 105

Query: 438 GHLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLG 617
           GH RAI+  +TVEE+YKDR +F+    K                 L+          SLG
Sbjct: 106 GHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLG 165

Query: 618 KFATANVKRDA 650
           K  TA V++DA
Sbjct: 166 KARTAQVQKDA 176



 Score = 36.3 bits (80), Expect = 0.15
 Identities = 18/42 (42%), Positives = 24/42 (57%)
 Frame = +1

Query: 130 TVGPNEALIVSGGCFGPTTKRTIVGGWAWAWCLVTDVQRISL 255
           T GPNEA++VSG C  P     + GG  +    +  +QRISL
Sbjct: 4   TCGPNEAMVVSGFCRSPPV--MVAGGRVFVLPCIQQIQRISL 43


>AL662797-20|CAM25521.1|  185|Homo sapiens flotillin 1 protein.
          Length = 185

 Score = 97.5 bits (232), Expect = 6e-20
 Identities = 56/131 (42%), Positives = 73/131 (55%), Gaps = 1/131 (0%)
 Frame = +3

Query: 261 MTLNPMCEYVETAQGVPLTVTGVAQCKIMNED-ELLTTACEQFLGKTVKEIKMTVLQTLE 437
           +TLN   E V T  GVP++VTG+AQ KI  ++ E+L  AC+ FLGKT  EI    L+TLE
Sbjct: 46  LTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLE 105

Query: 438 GHLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLG 617
           GH RAI+  +TVEE+YKDR +F+    K                 L+          SLG
Sbjct: 106 GHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLG 165

Query: 618 KFATANVKRDA 650
           K  TA V++DA
Sbjct: 166 KARTAQVQKDA 176



 Score = 36.3 bits (80), Expect = 0.15
 Identities = 18/42 (42%), Positives = 24/42 (57%)
 Frame = +1

Query: 130 TVGPNEALIVSGGCFGPTTKRTIVGGWAWAWCLVTDVQRISL 255
           T GPNEA++VSG C  P     + GG  +    +  +QRISL
Sbjct: 4   TCGPNEAMVVSGFCRSPPV--MVAGGRVFVLPCIQQIQRISL 43


>AL662797-17|CAM25520.1|  235|Homo sapiens flotillin 1 protein.
          Length = 235

 Score = 97.5 bits (232), Expect = 6e-20
 Identities = 56/131 (42%), Positives = 73/131 (55%), Gaps = 1/131 (0%)
 Frame = +3

Query: 261 MTLNPMCEYVETAQGVPLTVTGVAQCKIMNED-ELLTTACEQFLGKTVKEIKMTVLQTLE 437
           +TLN   E V T  GVP++VTG+AQ KI  ++ E+L  AC+ FLGKT  EI    L+TLE
Sbjct: 46  LTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLE 105

Query: 438 GHLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLG 617
           GH RAI+  +TVEE+YKDR +F+    K                 L+          SLG
Sbjct: 106 GHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLG 165

Query: 618 KFATANVKRDA 650
           K  TA V++DA
Sbjct: 166 KARTAQVQKDA 176



 Score = 36.3 bits (80), Expect = 0.15
 Identities = 18/42 (42%), Positives = 24/42 (57%)
 Frame = +1

Query: 130 TVGPNEALIVSGGCFGPTTKRTIVGGWAWAWCLVTDVQRISL 255
           T GPNEA++VSG C  P     + GG  +    +  +QRISL
Sbjct: 4   TCGPNEAMVVSGFCRSPPV--MVAGGRVFVLPCIQQIQRISL 43


>AL662797-16|CAM25518.1|  252|Homo sapiens flotillin 1 protein.
          Length = 252

 Score = 97.5 bits (232), Expect = 6e-20
 Identities = 56/131 (42%), Positives = 73/131 (55%), Gaps = 1/131 (0%)
 Frame = +3

Query: 261 MTLNPMCEYVETAQGVPLTVTGVAQCKIMNED-ELLTTACEQFLGKTVKEIKMTVLQTLE 437
           +TLN   E V T  GVP++VTG+AQ KI  ++ E+L  AC+ FLGKT  EI    L+TLE
Sbjct: 46  LTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLE 105

Query: 438 GHLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLG 617
           GH RAI+  +TVEE+YKDR +F+    K                 L+          SLG
Sbjct: 106 GHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLG 165

Query: 618 KFATANVKRDA 650
           K  TA V++DA
Sbjct: 166 KARTAQVQKDA 176



 Score = 36.3 bits (80), Expect = 0.15
 Identities = 18/42 (42%), Positives = 24/42 (57%)
 Frame = +1

Query: 130 TVGPNEALIVSGGCFGPTTKRTIVGGWAWAWCLVTDVQRISL 255
           T GPNEA++VSG C  P     + GG  +    +  +QRISL
Sbjct: 4   TCGPNEAMVVSGFCRSPPV--MVAGGRVFVLPCIQQIQRISL 43


>AL662797-14|CAI18202.1|  427|Homo sapiens flotillin 1 protein.
          Length = 427

 Score = 97.5 bits (232), Expect = 6e-20
 Identities = 56/131 (42%), Positives = 73/131 (55%), Gaps = 1/131 (0%)
 Frame = +3

Query: 261 MTLNPMCEYVETAQGVPLTVTGVAQCKIMNED-ELLTTACEQFLGKTVKEIKMTVLQTLE 437
           +TLN   E V T  GVP++VTG+AQ KI  ++ E+L  AC+ FLGKT  EI    L+TLE
Sbjct: 46  LTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLE 105

Query: 438 GHLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLG 617
           GH RAI+  +TVEE+YKDR +F+    K                 L+          SLG
Sbjct: 106 GHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLG 165

Query: 618 KFATANVKRDA 650
           K  TA V++DA
Sbjct: 166 KARTAQVQKDA 176



 Score = 36.3 bits (80), Expect = 0.15
 Identities = 18/42 (42%), Positives = 24/42 (57%)
 Frame = +1

Query: 130 TVGPNEALIVSGGCFGPTTKRTIVGGWAWAWCLVTDVQRISL 255
           T GPNEA++VSG C  P     + GG  +    +  +QRISL
Sbjct: 4   TCGPNEAMVVSGFCRSPPV--MVAGGRVFVLPCIQQIQRISL 43


>AF089750-1|AAC35387.1|  427|Homo sapiens flotillin-1 protein.
          Length = 427

 Score = 97.5 bits (232), Expect = 6e-20
 Identities = 56/131 (42%), Positives = 73/131 (55%), Gaps = 1/131 (0%)
 Frame = +3

Query: 261 MTLNPMCEYVETAQGVPLTVTGVAQCKIMNED-ELLTTACEQFLGKTVKEIKMTVLQTLE 437
           +TLN   E V T  GVP++VTG+AQ KI  ++ E+L  AC+ FLGKT  EI    L+TLE
Sbjct: 46  LTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLE 105

Query: 438 GHLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLG 617
           GH RAI+  +TVEE+YKDR +F+    K                 L+          SLG
Sbjct: 106 GHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLG 165

Query: 618 KFATANVKRDA 650
           K  TA V++DA
Sbjct: 166 KARTAQVQKDA 176



 Score = 36.3 bits (80), Expect = 0.15
 Identities = 18/42 (42%), Positives = 24/42 (57%)
 Frame = +1

Query: 130 TVGPNEALIVSGGCFGPTTKRTIVGGWAWAWCLVTDVQRISL 255
           T GPNEA++VSG C  P     + GG  +    +  +QRISL
Sbjct: 4   TCGPNEAMVVSGFCRSPPV--MVAGGRVFVLPCIQQIQRISL 43


>AB202099-2|BAE78620.1|  427|Homo sapiens flotillin 1 protein.
          Length = 427

 Score = 97.5 bits (232), Expect = 6e-20
 Identities = 56/131 (42%), Positives = 73/131 (55%), Gaps = 1/131 (0%)
 Frame = +3

Query: 261 MTLNPMCEYVETAQGVPLTVTGVAQCKIMNED-ELLTTACEQFLGKTVKEIKMTVLQTLE 437
           +TLN   E V T  GVP++VTG+AQ KI  ++ E+L  AC+ FLGKT  EI    L+TLE
Sbjct: 46  LTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLE 105

Query: 438 GHLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLG 617
           GH RAI+  +TVEE+YKDR +F+    K                 L+          SLG
Sbjct: 106 GHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLG 165

Query: 618 KFATANVKRDA 650
           K  TA V++DA
Sbjct: 166 KARTAQVQKDA 176



 Score = 36.3 bits (80), Expect = 0.15
 Identities = 18/42 (42%), Positives = 24/42 (57%)
 Frame = +1

Query: 130 TVGPNEALIVSGGCFGPTTKRTIVGGWAWAWCLVTDVQRISL 255
           T GPNEA++VSG C  P     + GG  +    +  +QRISL
Sbjct: 4   TCGPNEAMVVSGFCRSPPV--MVAGGRVFVLPCIQQIQRISL 43


>AB103607-2|BAF31269.1|  427|Homo sapiens FLOT1 protein protein.
          Length = 427

 Score = 97.5 bits (232), Expect = 6e-20
 Identities = 56/131 (42%), Positives = 73/131 (55%), Gaps = 1/131 (0%)
 Frame = +3

Query: 261 MTLNPMCEYVETAQGVPLTVTGVAQCKIMNED-ELLTTACEQFLGKTVKEIKMTVLQTLE 437
           +TLN   E V T  GVP++VTG+AQ KI  ++ E+L  AC+ FLGKT  EI    L+TLE
Sbjct: 46  LTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLE 105

Query: 438 GHLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLG 617
           GH RAI+  +TVEE+YKDR +F+    K                 L+          SLG
Sbjct: 106 GHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLG 165

Query: 618 KFATANVKRDA 650
           K  TA V++DA
Sbjct: 166 KARTAQVQKDA 176



 Score = 36.3 bits (80), Expect = 0.15
 Identities = 18/42 (42%), Positives = 24/42 (57%)
 Frame = +1

Query: 130 TVGPNEALIVSGGCFGPTTKRTIVGGWAWAWCLVTDVQRISL 255
           T GPNEA++VSG C  P     + GG  +    +  +QRISL
Sbjct: 4   TCGPNEAMVVSGFCRSPPV--MVAGGRVFVLPCIQQIQRISL 43


>AB088101-2|BAC54934.1|  427|Homo sapiens flotillin 1 protein.
          Length = 427

 Score = 97.5 bits (232), Expect = 6e-20
 Identities = 56/131 (42%), Positives = 73/131 (55%), Gaps = 1/131 (0%)
 Frame = +3

Query: 261 MTLNPMCEYVETAQGVPLTVTGVAQCKIMNED-ELLTTACEQFLGKTVKEIKMTVLQTLE 437
           +TLN   E V T  GVP++VTG+AQ KI  ++ E+L  AC+ FLGKT  EI    L+TLE
Sbjct: 46  LTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLE 105

Query: 438 GHLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLG 617
           GH RAI+  +TVEE+YKDR +F+    K                 L+          SLG
Sbjct: 106 GHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLG 165

Query: 618 KFATANVKRDA 650
           K  TA V++DA
Sbjct: 166 KARTAQVQKDA 176



 Score = 36.3 bits (80), Expect = 0.15
 Identities = 18/42 (42%), Positives = 24/42 (57%)
 Frame = +1

Query: 130 TVGPNEALIVSGGCFGPTTKRTIVGGWAWAWCLVTDVQRISL 255
           T GPNEA++VSG C  P     + GG  +    +  +QRISL
Sbjct: 4   TCGPNEAMVVSGFCRSPPV--MVAGGRVFVLPCIQQIQRISL 43


>AK222530-1|BAD96250.1|  427|Homo sapiens flotillin 1 variant
           protein.
          Length = 427

 Score = 93.1 bits (221), Expect = 1e-18
 Identities = 54/131 (41%), Positives = 71/131 (54%), Gaps = 1/131 (0%)
 Frame = +3

Query: 261 MTLNPMCEYVETAQGVPLTVTGVAQCKIMNED-ELLTTACEQFLGKTVKEIKMTVLQTLE 437
           +TLN   E V T  GVP++VTG+AQ KI  ++ E+L  AC+ FLGKT  EI    L+TLE
Sbjct: 46  LTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLE 105

Query: 438 GHLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLG 617
           GH R I+  +TV E+YKDR +F+    K                 L+          SLG
Sbjct: 106 GHQRVIMAHMTVGEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLG 165

Query: 618 KFATANVKRDA 650
           K  TA V++DA
Sbjct: 166 KARTAQVQKDA 176



 Score = 36.3 bits (80), Expect = 0.15
 Identities = 18/42 (42%), Positives = 24/42 (57%)
 Frame = +1

Query: 130 TVGPNEALIVSGGCFGPTTKRTIVGGWAWAWCLVTDVQRISL 255
           T GPNEA++VSG C  P     + GG  +    +  +QRISL
Sbjct: 4   TCGPNEAMVVSGFCRSPPV--MVAGGRVFVLPCIQQIQRISL 43


>BX248307-13|CAM25941.1|  192|Homo sapiens flotillin 1 protein.
          Length = 192

 Score = 70.1 bits (164), Expect = 1e-11
 Identities = 42/105 (40%), Positives = 55/105 (52%), Gaps = 1/105 (0%)
 Frame = +3

Query: 339 KIMNED-ELLTTACEQFLGKTVKEIKMTVLQTLEGHLRAILGTLTVEEVYKDRDQFAGWY 515
           KI  ++ E+L  AC+ FLGKT  EI    L+TLEGH RAI+  +TVEE+YKDR +F+   
Sbjct: 56  KIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQV 115

Query: 516 AKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLGKFATANVKRDA 650
            K                 L+          SLGK  TA V++DA
Sbjct: 116 FKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDA 160



 Score = 36.3 bits (80), Expect = 0.15
 Identities = 18/42 (42%), Positives = 24/42 (57%)
 Frame = +1

Query: 130 TVGPNEALIVSGGCFGPTTKRTIVGGWAWAWCLVTDVQRISL 255
           T GPNEA++VSG C  P     + GG  +    +  +QRISL
Sbjct: 4   TCGPNEAMVVSGFCRSPPV--MVAGGRVFVLPCIQQIQRISL 43


>BX248307-10|CAM25938.1|  238|Homo sapiens flotillin 1 protein.
          Length = 238

 Score = 70.1 bits (164), Expect = 1e-11
 Identities = 42/105 (40%), Positives = 55/105 (52%), Gaps = 1/105 (0%)
 Frame = +3

Query: 339 KIMNED-ELLTTACEQFLGKTVKEIKMTVLQTLEGHLRAILGTLTVEEVYKDRDQFAGWY 515
           KI  ++ E+L  AC+ FLGKT  EI    L+TLEGH RAI+  +TVEE+YKDR +F+   
Sbjct: 9   KIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQV 68

Query: 516 AKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLGKFATANVKRDA 650
            K                 L+          SLGK  TA V++DA
Sbjct: 69  FKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDA 113


>AL662848-15|CAM24855.1|  192|Homo sapiens flotillin 1 protein.
          Length = 192

 Score = 70.1 bits (164), Expect = 1e-11
 Identities = 42/105 (40%), Positives = 55/105 (52%), Gaps = 1/105 (0%)
 Frame = +3

Query: 339 KIMNED-ELLTTACEQFLGKTVKEIKMTVLQTLEGHLRAILGTLTVEEVYKDRDQFAGWY 515
           KI  ++ E+L  AC+ FLGKT  EI    L+TLEGH RAI+  +TVEE+YKDR +F+   
Sbjct: 56  KIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQV 115

Query: 516 AKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLGKFATANVKRDA 650
            K                 L+          SLGK  TA V++DA
Sbjct: 116 FKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDA 160



 Score = 36.3 bits (80), Expect = 0.15
 Identities = 18/42 (42%), Positives = 24/42 (57%)
 Frame = +1

Query: 130 TVGPNEALIVSGGCFGPTTKRTIVGGWAWAWCLVTDVQRISL 255
           T GPNEA++VSG C  P     + GG  +    +  +QRISL
Sbjct: 4   TCGPNEAMVVSGFCRSPPV--MVAGGRVFVLPCIQQIQRISL 43


>AL662848-12|CAM24853.1|  238|Homo sapiens flotillin 1 protein.
          Length = 238

 Score = 70.1 bits (164), Expect = 1e-11
 Identities = 42/105 (40%), Positives = 55/105 (52%), Gaps = 1/105 (0%)
 Frame = +3

Query: 339 KIMNED-ELLTTACEQFLGKTVKEIKMTVLQTLEGHLRAILGTLTVEEVYKDRDQFAGWY 515
           KI  ++ E+L  AC+ FLGKT  EI    L+TLEGH RAI+  +TVEE+YKDR +F+   
Sbjct: 9   KIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQV 68

Query: 516 AKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLGKFATANVKRDA 650
            K                 L+          SLGK  TA V++DA
Sbjct: 69  FKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDA 113


>AL662797-18|CAM25519.1|  192|Homo sapiens flotillin 1 protein.
          Length = 192

 Score = 70.1 bits (164), Expect = 1e-11
 Identities = 42/105 (40%), Positives = 55/105 (52%), Gaps = 1/105 (0%)
 Frame = +3

Query: 339 KIMNED-ELLTTACEQFLGKTVKEIKMTVLQTLEGHLRAILGTLTVEEVYKDRDQFAGWY 515
           KI  ++ E+L  AC+ FLGKT  EI    L+TLEGH RAI+  +TVEE+YKDR +F+   
Sbjct: 56  KIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQV 115

Query: 516 AKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLGKFATANVKRDA 650
            K                 L+          SLGK  TA V++DA
Sbjct: 116 FKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDA 160



 Score = 36.3 bits (80), Expect = 0.15
 Identities = 18/42 (42%), Positives = 24/42 (57%)
 Frame = +1

Query: 130 TVGPNEALIVSGGCFGPTTKRTIVGGWAWAWCLVTDVQRISL 255
           T GPNEA++VSG C  P     + GG  +    +  +QRISL
Sbjct: 4   TCGPNEAMVVSGFCRSPPV--MVAGGRVFVLPCIQQIQRISL 43


>AL662797-15|CAM25517.1|  238|Homo sapiens flotillin 1 protein.
          Length = 238

 Score = 70.1 bits (164), Expect = 1e-11
 Identities = 42/105 (40%), Positives = 55/105 (52%), Gaps = 1/105 (0%)
 Frame = +3

Query: 339 KIMNED-ELLTTACEQFLGKTVKEIKMTVLQTLEGHLRAILGTLTVEEVYKDRDQFAGWY 515
           KI  ++ E+L  AC+ FLGKT  EI    L+TLEGH RAI+  +TVEE+YKDR +F+   
Sbjct: 9   KIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQV 68

Query: 516 AKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLGKFATANVKRDA 650
            K                 L+          SLGK  TA V++DA
Sbjct: 69  FKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDA 113


>BC060864-1|AAH60864.1|  607|Homo sapiens
           UDP-N-acetyl-alpha-D-galactosamine:polypeptide
           N-acetylgalactosaminyltransferas protein.
          Length = 607

 Score = 33.1 bits (72), Expect = 1.4
 Identities = 14/49 (28%), Positives = 26/49 (53%), Gaps = 1/49 (2%)
 Frame = -3

Query: 358 SSSFMILHWATPVTVSGTPWAVSTYSHIGFNV-ITSGIYVGRP*PDTRP 215
           + S +  HW   ++  G   A+  + + G+N  ++  + +GRP PD RP
Sbjct: 93  TDSSLFAHWGQELSPEGRRVALKQFQYYGYNAYLSDRLPLGRPLPDLRP 141


>U29175-1|AAB40977.1| 1647|Homo sapiens transcriptional activator
           protein.
          Length = 1647

 Score = 31.5 bits (68), Expect = 4.3
 Identities = 18/56 (32%), Positives = 28/56 (50%)
 Frame = +2

Query: 710 KRNGRQNIRLTPKIEGQQRLFKISERRHFDSRNLNXSLKRERAFWXYXLSSQRKIK 877
           KR   +  R+T K+E QQ++ +  +RR      LN  L+  + F  Y  S   KI+
Sbjct: 443 KRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVTGKIQ 498


>D26156-1|BAA05143.1| 1647|Homo sapiens transcriptional activator
           hSNF2b protein.
          Length = 1647

 Score = 31.5 bits (68), Expect = 4.3
 Identities = 18/56 (32%), Positives = 28/56 (50%)
 Frame = +2

Query: 710 KRNGRQNIRLTPKIEGQQRLFKISERRHFDSRNLNXSLKRERAFWXYXLSSQRKIK 877
           KR   +  R+T K+E QQ++ +  +RR      LN  L+  + F  Y  S   KI+
Sbjct: 443 KRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVTGKIQ 498


>BC150298-1|AAI50299.1| 1647|Homo sapiens SWI/SNF related, matrix
           associated, actin dependent regulator of chromatin, sub
           protein.
          Length = 1647

 Score = 31.5 bits (68), Expect = 4.3
 Identities = 18/56 (32%), Positives = 28/56 (50%)
 Frame = +2

Query: 710 KRNGRQNIRLTPKIEGQQRLFKISERRHFDSRNLNXSLKRERAFWXYXLSSQRKIK 877
           KR   +  R+T K+E QQ++ +  +RR      LN  L+  + F  Y  S   KI+
Sbjct: 443 KRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVTGKIQ 498


>BC139924-1|AAI39925.1|  584|Homo sapiens SMARCA4 protein protein.
          Length = 584

 Score = 31.5 bits (68), Expect = 4.3
 Identities = 18/56 (32%), Positives = 28/56 (50%)
 Frame = +2

Query: 710 KRNGRQNIRLTPKIEGQQRLFKISERRHFDSRNLNXSLKRERAFWXYXLSSQRKIK 877
           KR   +  R+T K+E QQ++ +  +RR      LN  L+  + F  Y  S   KI+
Sbjct: 443 KRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVTGKIQ 498


>BC139917-1|AAI39918.1|  584|Homo sapiens SMARCA4 protein protein.
          Length = 584

 Score = 31.5 bits (68), Expect = 4.3
 Identities = 18/56 (32%), Positives = 28/56 (50%)
 Frame = +2

Query: 710 KRNGRQNIRLTPKIEGQQRLFKISERRHFDSRNLNXSLKRERAFWXYXLSSQRKIK 877
           KR   +  R+T K+E QQ++ +  +RR      LN  L+  + F  Y  S   KI+
Sbjct: 443 KRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVTGKIQ 498


>AF254822-2|AAG24789.1| 1647|Homo sapiens SMARCA4 isoform 1 protein.
          Length = 1647

 Score = 31.5 bits (68), Expect = 4.3
 Identities = 18/56 (32%), Positives = 28/56 (50%)
 Frame = +2

Query: 710 KRNGRQNIRLTPKIEGQQRLFKISERRHFDSRNLNXSLKRERAFWXYXLSSQRKIK 877
           KR   +  R+T K+E QQ++ +  +RR      LN  L+  + F  Y  S   KI+
Sbjct: 443 KRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVTGKIQ 498


>AF254822-1|AAG24790.1| 1679|Homo sapiens SMARCA4 isoform 2 protein.
          Length = 1679

 Score = 31.5 bits (68), Expect = 4.3
 Identities = 18/56 (32%), Positives = 28/56 (50%)
 Frame = +2

Query: 710 KRNGRQNIRLTPKIEGQQRLFKISERRHFDSRNLNXSLKRERAFWXYXLSSQRKIK 877
           KR   +  R+T K+E QQ++ +  +RR      LN  L+  + F  Y  S   KI+
Sbjct: 443 KRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVTGKIQ 498


>AB209313-1|BAD92550.1| 1164|Homo sapiens SWI/SNF-related
           matrix-associated actin-dependent regulator of chromatin
           a4 var protein.
          Length = 1164

 Score = 31.5 bits (68), Expect = 4.3
 Identities = 18/56 (32%), Positives = 28/56 (50%)
 Frame = +2

Query: 710 KRNGRQNIRLTPKIEGQQRLFKISERRHFDSRNLNXSLKRERAFWXYXLSSQRKIK 877
           KR   +  R+T K+E QQ++ +  +RR      LN  L+  + F  Y  S   KI+
Sbjct: 400 KRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVTGKIQ 455


>X72889-1|CAA51407.1| 1586|Homo sapiens HBRM protein.
          Length = 1586

 Score = 30.7 bits (66), Expect = 7.5
 Identities = 18/56 (32%), Positives = 28/56 (50%)
 Frame = +2

Query: 710 KRNGRQNIRLTPKIEGQQRLFKISERRHFDSRNLNXSLKRERAFWXYXLSSQRKIK 877
           KR   +  R+T K+E QQ++ +  +RR      LN  L+  + F  Y  S   KI+
Sbjct: 415 KRQTLREARMTEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVAGKIQ 470


>D26155-1|BAA05142.1| 1572|Homo sapiens transcriptional activator
           hSNF2a protein.
          Length = 1572

 Score = 30.7 bits (66), Expect = 7.5
 Identities = 18/56 (32%), Positives = 28/56 (50%)
 Frame = +2

Query: 710 KRNGRQNIRLTPKIEGQQRLFKISERRHFDSRNLNXSLKRERAFWXYXLSSQRKIK 877
           KR   +  R+T K+E QQ++ +  +RR      LN  L+  + F  Y  S   KI+
Sbjct: 419 KRQTLREARMTEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVAGKIQ 474


>AL359076-5|CAI12969.1|  559|Homo sapiens SWI/SNF related, matrix
           associated, actin dependent regulator of chromatin, sub
           protein.
          Length = 559

 Score = 30.7 bits (66), Expect = 7.5
 Identities = 18/56 (32%), Positives = 28/56 (50%)
 Frame = +2

Query: 710 KRNGRQNIRLTPKIEGQQRLFKISERRHFDSRNLNXSLKRERAFWXYXLSSQRKIK 877
           KR   +  R+T K+E QQ++ +  +RR      LN  L+  + F  Y  S   KI+
Sbjct: 419 KRQTLREARMTEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVAGKIQ 474


>AL359076-4|CAI12968.1| 1572|Homo sapiens SWI/SNF related, matrix
           associated, actin dependent regulator of chromatin, sub
           protein.
          Length = 1572

 Score = 30.7 bits (66), Expect = 7.5
 Identities = 18/56 (32%), Positives = 28/56 (50%)
 Frame = +2

Query: 710 KRNGRQNIRLTPKIEGQQRLFKISERRHFDSRNLNXSLKRERAFWXYXLSSQRKIK 877
           KR   +  R+T K+E QQ++ +  +RR      LN  L+  + F  Y  S   KI+
Sbjct: 419 KRQTLREARMTEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVAGKIQ 474


>AL359076-3|CAI12967.1| 1590|Homo sapiens SWI/SNF related, matrix
           associated, actin dependent regulator of chromatin, sub
           protein.
          Length = 1590

 Score = 30.7 bits (66), Expect = 7.5
 Identities = 18/56 (32%), Positives = 28/56 (50%)
 Frame = +2

Query: 710 KRNGRQNIRLTPKIEGQQRLFKISERRHFDSRNLNXSLKRERAFWXYXLSSQRKIK 877
           KR   +  R+T K+E QQ++ +  +RR      LN  L+  + F  Y  S   KI+
Sbjct: 419 KRQTLREARMTEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVAGKIQ 474


>AL138755-9|CAI14600.1| 1572|Homo sapiens SWI/SNF related, matrix
           associated, actin dependent regulator of chromatin, sub
           protein.
          Length = 1572

 Score = 30.7 bits (66), Expect = 7.5
 Identities = 18/56 (32%), Positives = 28/56 (50%)
 Frame = +2

Query: 710 KRNGRQNIRLTPKIEGQQRLFKISERRHFDSRNLNXSLKRERAFWXYXLSSQRKIK 877
           KR   +  R+T K+E QQ++ +  +RR      LN  L+  + F  Y  S   KI+
Sbjct: 419 KRQTLREARMTEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVAGKIQ 474


>AL138755-8|CAI14599.1| 1590|Homo sapiens SWI/SNF related, matrix
           associated, actin dependent regulator of chromatin, sub
           protein.
          Length = 1590

 Score = 30.7 bits (66), Expect = 7.5
 Identities = 18/56 (32%), Positives = 28/56 (50%)
 Frame = +2

Query: 710 KRNGRQNIRLTPKIEGQQRLFKISERRHFDSRNLNXSLKRERAFWXYXLSSQRKIK 877
           KR   +  R+T K+E QQ++ +  +RR      LN  L+  + F  Y  S   KI+
Sbjct: 419 KRQTLREARMTEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVAGKIQ 474


>BC037341-1|AAH37341.3|  607|Homo sapiens
           UDP-N-acetyl-alpha-D-galactosamine:polypeptide
           N-acetylgalactosaminyltransferas protein.
          Length = 607

 Score = 30.3 bits (65), Expect = 9.9
 Identities = 13/49 (26%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
 Frame = -3

Query: 358 SSSFMILHWATPVTVSGTPWAVSTYSHIGFNV-ITSGIYVGRP*PDTRP 215
           + S +  HW   ++  G   A+  + + G+N  ++  + + RP PD RP
Sbjct: 93  TDSSLFAHWGQELSPEGRRVALKQFQYYGYNAYLSDRLPLDRPLPDLRP 141


>AJ626724-1|CAF25035.1|  607|Homo sapiens GalNAc-transferase 18
           protein.
          Length = 607

 Score = 30.3 bits (65), Expect = 9.9
 Identities = 13/49 (26%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
 Frame = -3

Query: 358 SSSFMILHWATPVTVSGTPWAVSTYSHIGFNV-ITSGIYVGRP*PDTRP 215
           + S +  HW   ++  G   A+  + + G+N  ++  + + RP PD RP
Sbjct: 93  TDSSLFAHWGQELSPEGRRVALKQFQYYGYNAYLSDRLPLDRPLPDLRP 141


>AB078147-1|BAD93179.1|  607|Homo sapiens
           UDP-N-acetyl-alpha-D-galactosamine:polypeptide
           N-acetylgalactosaminyltransferas protein.
          Length = 607

 Score = 30.3 bits (65), Expect = 9.9
 Identities = 13/49 (26%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
 Frame = -3

Query: 358 SSSFMILHWATPVTVSGTPWAVSTYSHIGFNV-ITSGIYVGRP*PDTRP 215
           + S +  HW   ++  G   A+  + + G+N  ++  + + RP PD RP
Sbjct: 93  TDSSLFAHWGQELSPEGRRVALKQFQYYGYNAYLSDRLPLDRPLPDLRP 141


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 143,650,155
Number of Sequences: 237096
Number of extensions: 3390958
Number of successful extensions: 9704
Number of sequences better than 10.0: 56
Number of HSP's better than 10.0 without gapping: 8940
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9597
length of database: 76,859,062
effective HSP length: 90
effective length of database: 55,520,422
effective search space used: 11548247776
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -