SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30139.Seq
         (697 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC039593-1|AAH39593.1|  913|Homo sapiens ubiquitin specific pept...   130   4e-30
AY074877-1|AAL79676.1|  913|Homo sapiens pVHL-interacting deubiq...   130   4e-30
AL158207-6|CAC88170.1|  914|Homo sapiens ubiquitin specific pept...   130   4e-30
AB023220-1|BAA76847.2|  917|Homo sapiens KIAA1003 protein protein.    130   4e-30
BC016663-1|AAH16663.1|  828|Homo sapiens ubiquitin specific pept...   128   2e-29
AF383173-1|AAL78315.1|  911|Homo sapiens pVHL-interacting deubiq...   128   2e-29
AF383172-1|AAL78314.1|  942|Homo sapiens pVHL-interacting deubiq...   128   2e-29
AB029020-1|BAA83049.1|  980|Homo sapiens KIAA1097 protein protein.    128   2e-29
AK022864-1|BAB14279.1|  828|Homo sapiens protein ( Homo sapiens ...   126   6e-29
BT007269-1|AAP35933.1|  520|Homo sapiens ubiquitin specific prot...    63   8e-10
BC107138-1|AAI07139.1|  520|Homo sapiens ubiquitin specific pept...    63   8e-10
BC107137-1|AAI07138.1|  520|Homo sapiens ubiquitin specific pept...    63   8e-10
BC065300-1|AAH65300.1|  520|Homo sapiens ubiquitin specific pept...    63   8e-10
BC018113-1|AAH18113.1|  520|Homo sapiens ubiquitin specific pept...    63   8e-10
AY461579-1|AAT37507.1|  498|Homo sapiens UBP protein protein.          63   8e-10
AF073344-1|AAD42992.1|  521|Homo sapiens ubiquitin-specific prot...    63   8e-10
D29956-1|BAA06225.2| 1120|Homo sapiens KIAA0055 protein.               57   7e-08
BX537420-1|CAD97662.1| 1118|Homo sapiens hypothetical protein pr...    57   7e-08
BC110590-1|AAI10591.1| 1118|Homo sapiens ubiquitin specific pept...    57   7e-08
BC041366-1|AAH41366.1|  362|Homo sapiens USP2 protein protein.         57   7e-08
BC002955-1|AAH02955.1|  605|Homo sapiens ubiquitin specific pept...    57   7e-08
BC002854-1|AAH02854.1|  605|Homo sapiens ubiquitin specific pept...    57   7e-08
AF440755-1|AAN65363.1|  396|Homo sapiens ubiquitin specific prot...    57   7e-08
AF079564-1|AAC28392.1|  353|Homo sapiens ubiquitin-specific prot...    57   7e-08
BC125123-1|AAI25124.1|  952|Homo sapiens ubiquitin specific pept...    54   5e-07
AF153604-1|AAD41086.1|  981|Homo sapiens ubiquitin-specific prot...    54   5e-07
AF106069-1|AAD52099.1|  952|Homo sapiens deubiquitinating enzyme...    54   5e-07
AF013990-1|AAG28973.1|  902|Homo sapiens ubiquitin C-terminal hy...    54   5e-07
AB011101-1|BAA25455.2|  952|Homo sapiens KIAA0529 protein protein.     54   5e-07
AK057225-1|BAB71388.1|  605|Homo sapiens protein ( Homo sapiens ...    54   6e-07
AJ583818-1|CAE47745.2|  339|Homo sapiens ubiquitin specific prot...    50   1e-05
BC094680-1|AAH94680.1|  389|Homo sapiens USP32 protein protein.        49   1e-05
AF533230-1|AAM97922.1| 1604|Homo sapiens ubiquitin-specific prot...    49   1e-05
AF350251-1|AAK30207.1| 1274|Homo sapiens ubiquitin specific prot...    49   1e-05
AF155116-1|AAD42882.1|  828|Homo sapiens NY-REN-60 antigen protein.    49   1e-05
Y17457-1|CAB44350.1|  223|Homo sapiens LSFR3A protein protein.         49   2e-05
X63547-2|CAA45111.1| 1089|Homo sapiens oncogene protein.               47   6e-05
X63546-2|CAA45109.1|  586|Homo sapiens oncogene protein.               47   6e-05
BC030704-1|AAH30704.1|  712|Homo sapiens ubiquitin specific pept...    47   6e-05
AY143550-1|AAN38838.1| 1406|Homo sapiens ubiquitin-specific prot...    47   6e-05
AJ586135-1|CAE51935.2| 1352|Homo sapiens ubiquitin-specific prot...    46   1e-04
BC090946-1|AAH90946.1|  565|Homo sapiens ubiquitin specific pept...    46   1e-04
BC070497-1|AAH70497.1|  367|Homo sapiens USP32 protein protein.        46   1e-04
BC003130-1|AAH03130.2|  477|Homo sapiens USP21 protein protein.        46   1e-04
AL590714-3|CAH72142.1|  551|Homo sapiens ubiquitin specific pept...    46   1e-04
AL590714-2|CAH72143.1|  565|Homo sapiens ubiquitin specific pept...    46   1e-04
AF217979-1|AAG17222.1|  550|Homo sapiens unknown protein.              46   1e-04
AF177758-1|AAD54321.1|  565|Homo sapiens ubiquitin specific prot...    46   1e-04
X63546-1|CAA45108.1|  786|Homo sapiens oncogene protein.               46   2e-04
U44839-1|AAC50450.1|  690|Homo sapiens UHX1 protein protein.           46   2e-04
BC063668-1|AAH63668.1|  923|Homo sapiens USP11 protein protein.        46   2e-04
BC000350-1|AAH00350.4|  921|Homo sapiens USP11 protein protein.        46   2e-04
AL096791-3|CAD20056.1|  690|Homo sapiens ubiquitin specific pept...    46   2e-04
AK127075-1|BAC86814.1| 1332|Homo sapiens protein ( Homo sapiens ...    46   2e-04
AK126752-1|BAC86673.1|  819|Homo sapiens protein ( Homo sapiens ...    46   2e-04
AB073597-1|BAC20463.1|  921|Homo sapiens deubiquitinating enzyme...    46   2e-04
AB028980-1|BAA83009.1|  977|Homo sapiens KIAA1057 protein protein.     46   2e-04
U20657-1|AAB72237.1|  963|Homo sapiens ubiquitin protease protein.     45   2e-04
BC125131-1|AAI25132.1|  963|Homo sapiens ubiquitin specific pept...    45   2e-04
BC125130-1|AAI25131.1|  963|Homo sapiens ubiquitin specific pept...    45   2e-04
BC104896-1|AAI04897.1|  983|Homo sapiens USP48 protein protein.        45   2e-04
BC103724-1|AAI03725.1|  640|Homo sapiens USP48 protein protein.        45   2e-04
BC067261-1|AAH67261.1|  640|Homo sapiens USP48 protein protein.        45   2e-04
BC011576-1|AAH11576.1|  443|Homo sapiens USP48 protein protein.        45   2e-04
AL590103-4|CAI12127.1| 1035|Homo sapiens ubiquitin specific pept...    45   2e-04
AL359815-6|CAI16256.1| 1035|Homo sapiens ubiquitin specific pept...    45   2e-04
AK223292-1|BAD97012.1|  963|Homo sapiens ubiquitin specific prot...    45   2e-04
AK222725-1|BAD96445.1|  916|Homo sapiens ubiquitin specific prot...    45   2e-04
AK026930-1|BAB15591.1|  392|Homo sapiens protein ( Homo sapiens ...    45   2e-04
AF502942-1|AAP30832.1| 1035|Homo sapiens ubiquitin-specific prot...    45   2e-04
AF017306-1|AAC27356.1|  916|Homo sapiens UnpES protein.                45   2e-04
AF017305-1|AAC27355.1|  963|Homo sapiens UnpEL protein.                45   2e-04
AJ583823-1|CAE47750.2|  711|Homo sapiens ubiquitin specific prot...    45   3e-04
BC014176-1|AAH14176.1|  640|Homo sapiens ubiquitin specific pept...    44   4e-04
AL365205-13|CAI13188.1|  640|Homo sapiens ubiquitin specific pep...    44   4e-04
AL365205-12|CAI13186.1|  585|Homo sapiens ubiquitin specific pep...    44   4e-04
AL365205-11|CAI13187.1|  688|Homo sapiens ubiquitin specific pep...    44   4e-04
AJ586139-1|CAE51939.1|  688|Homo sapiens ubiquitin-specific prot...    44   4e-04
BX640815-1|CAE45893.1|  453|Homo sapiens hypothetical protein pr...    44   5e-04
BC126898-1|AAI26899.1|  513|Homo sapiens USP22 protein protein.        44   5e-04
BC110499-1|AAI10500.1|  512|Homo sapiens USP22 protein protein.        44   5e-04
BC025317-1|AAH25317.1|  173|Homo sapiens USP22 protein protein.        44   5e-04
BC009452-1|AAH09452.1|  229|Homo sapiens Similar to non-stop pro...    44   5e-04
BC007196-1|AAH07196.1|  173|Homo sapiens USP22 protein protein.        44   5e-04
AL162082-1|CAB82415.1|  264|Homo sapiens hypothetical protein pr...    44   5e-04
AB028986-1|BAA83015.1|  593|Homo sapiens KIAA1063 protein protein.     44   5e-04
Y13619-1|CAA73941.1| 2070|Homo sapiens DFFRY protein.                  44   7e-04
Y13618-1|CAA73940.1| 2555|Homo sapiens DFFRY protein.                  44   7e-04
X98296-1|CAA66942.1| 2547|Homo sapiens ubiquitin hydrolase protein.    44   7e-04
BC063645-1|AAH63645.1|  918|Homo sapiens USP9X protein protein.        44   7e-04
AL391259-2|CAD13527.2| 2547|Homo sapiens ubiquitin specific pept...    44   7e-04
AL109797-1|CAD18900.2| 2547|Homo sapiens ubiquitin specific pept...    44   7e-04
AF233442-1|AAF61308.1|  381|Homo sapiens NEDD8-specific protease...    44   7e-04
AF000986-1|AAC51833.1| 2555|Homo sapiens ubiquitin specific prot...    44   7e-04
AB209666-1|BAD92903.1|  867|Homo sapiens USP9X protein variant p...    44   7e-04
CT841507-1|CAJ86437.1|  372|Homo sapiens Em:AC008079.1 protein.        43   0.001
CR457216-1|CAG33497.1|  372|Homo sapiens USP18 protein.                43   0.001
BT006835-1|AAP35481.1|  372|Homo sapiens ubiquitin specific prot...    43   0.001
BC014896-1|AAH14896.1|  372|Homo sapiens ubiquitin specific pept...    43   0.001
AJ586979-1|CAE52971.1|  306|Homo sapiens ubiquitin-specific prot...    43   0.001
AJ583822-1|CAE47749.1|  327|Homo sapiens ubiquitin specific prot...    43   0.001
AJ243526-1|CAB76398.1|  372|Homo sapiens putative deubiquitinazi...    43   0.001
AF176642-1|AAD49967.1|  372|Homo sapiens ubiquitin-specific prot...    43   0.001
AK022614-1|BAB14133.1|  366|Homo sapiens protein ( Homo sapiens ...    42   0.002
AK055188-1|BAB70869.1|  314|Homo sapiens protein ( Homo sapiens ...    42   0.002
AJ583817-1|CAE47744.2| 1124|Homo sapiens ubiquitin specific prot...    42   0.002
BC037574-1|AAH37574.1|  366|Homo sapiens ubiquitin specific pept...    42   0.003
BC026072-1|AAH26072.1|  370|Homo sapiens ubiquitin specific pept...    42   0.003
AL355473-1|CAI16331.1|  370|Homo sapiens ubiquitin specific prot...    42   0.003
AL158062-1|CAH70555.1|  370|Homo sapiens ubiquitin specific prot...    42   0.003
AK024318-1|BAB14881.1|  366|Homo sapiens protein ( Homo sapiens ...    42   0.003
AF022789-1|AAC23551.1|  355|Homo sapiens ubiquitin hydrolyzing e...    42   0.003
BC100029-1|AAI00030.1|  393|Homo sapiens USP3 protein protein.         41   0.005
AL157417-1|CAB75649.1|  268|Homo sapiens hypothetical protein pr...    41   0.005
AK027362-1|BAB55063.1| 1287|Homo sapiens protein ( Homo sapiens ...    40   0.006
BC068975-1|AAH68975.1| 1042|Homo sapiens ubiquitin specific pept...    40   0.008
BC039115-1|AAH39115.1| 1004|Homo sapiens USP38 protein protein.        40   0.008
AK091712-1|BAC03730.1|  422|Homo sapiens protein ( Homo sapiens ...    40   0.008
AK057992-1|BAB71627.1|  706|Homo sapiens protein ( Homo sapiens ...    40   0.008
AF211481-1|AAK26248.1|  397|Homo sapiens HP43.8KD protein.             40   0.008
AB067478-1|BAB67784.1|  780|Homo sapiens KIAA1891 protein protein.     40   0.008
BC132862-1|AAI32863.1| 1316|Homo sapiens ubiquitin specific pept...    39   0.020
BC131489-1|AAI31490.1|  604|Homo sapiens USP35 protein protein.        39   0.020
BC060846-1|AAH60846.2| 1202|Homo sapiens USP42 protein protein.        39   0.020
AY618868-1|AAT67238.1| 1324|Homo sapiens ubiquitin specific prot...    39   0.020
AK022759-1|BAB14232.1| 1198|Homo sapiens protein ( Homo sapiens ...    39   0.020
AJ601395-1|CAE53097.1| 1325|Homo sapiens ubiquitin-specific prot...    39   0.020
AJ586137-1|CAE51937.1| 1017|Homo sapiens ubiquitin-specific prot...    39   0.020
AB037793-1|BAA92610.1|  773|Homo sapiens KIAA1372 protein protein.     39   0.020
BC050525-1|AAH50525.1|  785|Homo sapiens ubiquitin specific pept...    38   0.045
AF117386-1|AAD11441.1|  785|Homo sapiens ubiquitin-specific prot...    38   0.045
AB208893-1|BAD92130.1|  586|Homo sapiens ubiquitin specific prot...    38   0.045
AB014458-1|BAA34703.1|  785|Homo sapiens ubiquitin specific prot...    38   0.045
BC146752-1|AAI46753.1| 1318|Homo sapiens ubiquitin specific pept...    37   0.060
BC142727-1|AAI42728.1| 1449|Homo sapiens USP19 protein protein.        37   0.060
BC142660-1|AAI42661.1| 1447|Homo sapiens USP19 protein protein.        37   0.060
BC082241-1|AAH82241.1| 1179|Homo sapiens USP19 protein protein.        37   0.060
BC065909-1|AAH65909.1|  784|Homo sapiens USP19 protein protein.        37   0.060
BC048269-1|AAH48269.1|  436|Homo sapiens USP19 protein protein.        37   0.060
AB020698-1|BAA74914.1| 1371|Homo sapiens KIAA0891 protein protein.     37   0.060
BC071582-1|AAH71582.1| 1123|Homo sapiens USP36 protein protein.        37   0.079
BC027992-1|AAH27992.1|  959|Homo sapiens USP36 protein protein.        37   0.079
BC016487-1|AAH16487.1|  963|Homo sapiens Unknown (protein for IM...    37   0.079
AY169386-1|AAO34133.1|  548|Homo sapiens deubiquitinating enzyme...    37   0.079
AK022913-1|BAB14306.1|  548|Homo sapiens protein ( Homo sapiens ...    37   0.079
AK001671-1|BAA91825.1|  954|Homo sapiens protein ( Homo sapiens ...    37   0.079
AB040886-1|BAA95977.1| 1123|Homo sapiens KIAA1453 protein protein.     37   0.079
AL831918-1|CAD38579.1|  810|Homo sapiens hypothetical protein pr...    36   0.10 
AK090821-1|BAC03523.1|  635|Homo sapiens protein ( Homo sapiens ...    36   0.10 
AJ586138-1|CAE51938.1| 3395|Homo sapiens ubiquitin-specific prot...    36   0.10 
AB011142-1|BAA25496.2| 3412|Homo sapiens KIAA0570 protein protein.     36   0.10 
Z81365-3|CAI43184.1|  913|Homo sapiens ubiquitin specific peptid...    36   0.14 
BC101191-1|AAI01192.1|  913|Homo sapiens ubiquitin specific pept...    36   0.14 
BC101190-1|AAI01191.1|  913|Homo sapiens ubiquitin specific pept...    36   0.14 
BC101189-1|AAI01190.1|  913|Homo sapiens ubiquitin specific pept...    36   0.14 
BC069073-1|AAH69073.1|  913|Homo sapiens ubiquitin specific pept...    36   0.14 
AF285593-1|AAK31972.1|  913|Homo sapiens ubiquitin specific prot...    36   0.14 
BX538024-1|CAD97970.1|  979|Homo sapiens hypothetical protein pr...    35   0.24 
BC133009-1|AAI33010.1|  979|Homo sapiens ubiquitin specific pept...    35   0.24 
BC133007-1|AAI33008.1|  979|Homo sapiens USP37 protein protein.        35   0.24 
BC112901-1|AAI12902.1|  885|Homo sapiens USP37 protein protein.        35   0.24 
AL832645-1|CAD89955.1|  979|Homo sapiens hypothetical protein pr...    35   0.24 
AB046814-1|BAB13420.1|  931|Homo sapiens KIAA1594 protein protein.     35   0.24 
BC030777-1|AAH30777.1|  822|Homo sapiens ubiquitin specific pept...    35   0.32 
AY333928-1|AAR13293.1|  408|Homo sapiens USP16 protein.                35   0.32 
AL832030-1|CAD91148.1|  567|Homo sapiens hypothetical protein pr...    35   0.32 
AL513550-2|CAI17192.1|  772|Homo sapiens ubiquitin specific pept...    35   0.32 
AL163249-3|CAB90432.1|  823|Homo sapiens human ubiquitin process...    35   0.32 
AL137784-3|CAI19761.1|  772|Homo sapiens ubiquitin specific pept...    35   0.32 
AK222884-1|BAD96604.1|  823|Homo sapiens ubiquitin specific prot...    35   0.32 
AK222681-1|BAD96401.1|  823|Homo sapiens ubiquitin specific prot...    35   0.32 
AJ583819-1|CAE47746.2|  814|Homo sapiens ubiquitin specific prot...    35   0.32 
AF126736-1|AAD20949.1|  823|Homo sapiens ubiquitin processing pr...    35   0.32 
BC067300-1|AAH67300.1|  350|Homo sapiens USP40 protein protein.        34   0.56 
AK001647-1|BAA91807.1| 1014|Homo sapiens protein ( Homo sapiens ...    34   0.56 
AJ583821-1|CAE47748.2| 1247|Homo sapiens ubiquitin specific prot...    34   0.56 
AF544011-1|AAQ11741.1|  530|Homo sapiens deubiquitinating enzyme...    32   1.7  
Z72499-1|CAA96580.1| 1102|Homo sapiens herpesvirus associated ub...    31   3.9  
BC113428-1|AAI13429.1|  343|Homo sapiens aristaless-like homeobo...    31   3.9  
BC112007-1|AAI12008.1|  343|Homo sapiens ALX3 protein protein.         31   3.9  
AY533200-1|AAS59847.1|  398|Homo sapiens deubiquitinating enzyme...    31   3.9  
AY188990-1|AAO38845.1|  530|Homo sapiens deubiquitinating enzyme...    31   3.9  
AL160006-1|CAI22714.1|  343|Homo sapiens aristaless-like homeobo...    31   3.9  
AF544012-1|AAQ11742.1|  530|Homo sapiens deubiquitinating enzyme...    31   3.9  
AF008203-1|AAD01418.1|  343|Homo sapiens homeobox protein protein.     31   3.9  
AF008202-1|AAD01417.2|   92|Homo sapiens homeobox protein alx3 p...    31   3.9  
AY376241-1|AAQ82908.1| 1112|Homo sapiens ubiquitin-specific prot...    31   5.2  
BC022094-1|AAH22094.2|  400|Homo sapiens USP30 protein protein.        30   9.1  
BC004868-1|AAH04868.1|  508|Homo sapiens ubiquitin specific pept...    30   9.1  
AY509884-1|AAR91701.1|  530|Homo sapiens deubiquitinating enzyme...    30   9.1  
AK027820-1|BAB55392.1|  486|Homo sapiens protein ( Homo sapiens ...    30   9.1  
AJ586136-1|CAE51936.1|  517|Homo sapiens ubiquitin-specific prot...    30   9.1  

>BC039593-1|AAH39593.1|  913|Homo sapiens ubiquitin specific
           peptidase 20 protein.
          Length = 913

 Score =  130 bits (315), Expect = 4e-30
 Identities = 60/111 (54%), Positives = 75/111 (67%)
 Frame = +3

Query: 294 FYGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH 473
           F+GPVV+L+DCLAAFF+ADELKGDNMYSC RCKKLRNGVK   ++ LP +LC+HLKRFRH
Sbjct: 531 FWGPVVTLEDCLAAFFAADELKGDNMYSCERCKKLRNGVKYCKVLRLPEILCIHLKRFRH 590

Query: 474 ELLFSAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
           E+++S K+             R    K     ++ Y L +VI H GT G G
Sbjct: 591 EVMYSFKINSHVSFPLEGLDLRPFLAKECTSQITTYDLLSVICHHGTAGSG 641



 Score = 81.0 bits (191), Expect = 4e-15
 Identities = 39/67 (58%), Positives = 46/67 (68%)
 Frame = +1

Query: 4   VPNSARAKSGSSGDGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPS 183
           V   A+  S  S      +YRS+ISD+F G +LS VQCL CDRVST +ETFQDLSLPIP 
Sbjct: 421 VLKKAQVLSAGSRRRKEQRYRSVISDIFDGSILSLVQCLTCDRVSTTVETFQDLSLPIPG 480

Query: 184 REHLAVL 204
           +E LA L
Sbjct: 481 KEDLAKL 487


>AY074877-1|AAL79676.1|  913|Homo sapiens pVHL-interacting
           deubiquitinating enzyme 2 protein.
          Length = 913

 Score =  130 bits (315), Expect = 4e-30
 Identities = 60/111 (54%), Positives = 75/111 (67%)
 Frame = +3

Query: 294 FYGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH 473
           F+GPVV+L+DCLAAFF+ADELKGDNMYSC RCKKLRNGVK   ++ LP +LC+HLKRFRH
Sbjct: 531 FWGPVVTLEDCLAAFFAADELKGDNMYSCERCKKLRNGVKYCKVLRLPEILCIHLKRFRH 590

Query: 474 ELLFSAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
           E+++S K+             R    K     ++ Y L +VI H GT G G
Sbjct: 591 EVMYSFKINSHVSFPLEGLDLRPFLAKECTSQITTYDLLSVICHHGTAGSG 641



 Score = 81.0 bits (191), Expect = 4e-15
 Identities = 39/67 (58%), Positives = 46/67 (68%)
 Frame = +1

Query: 4   VPNSARAKSGSSGDGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPS 183
           V   A+  S  S      +YRS+ISD+F G +LS VQCL CDRVST +ETFQDLSLPIP 
Sbjct: 421 VLKKAQVLSAGSRRRKEQRYRSVISDIFDGSILSLVQCLTCDRVSTTVETFQDLSLPIPG 480

Query: 184 REHLAVL 204
           +E LA L
Sbjct: 481 KEDLAKL 487


>AL158207-6|CAC88170.1|  914|Homo sapiens ubiquitin specific
           peptidase 20 protein.
          Length = 914

 Score =  130 bits (315), Expect = 4e-30
 Identities = 60/111 (54%), Positives = 75/111 (67%)
 Frame = +3

Query: 294 FYGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH 473
           F+GPVV+L+DCLAAFF+ADELKGDNMYSC RCKKLRNGVK   ++ LP +LC+HLKRFRH
Sbjct: 532 FWGPVVTLEDCLAAFFAADELKGDNMYSCERCKKLRNGVKYCKVLRLPEILCIHLKRFRH 591

Query: 474 ELLFSAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
           E+++S K+             R    K     ++ Y L +VI H GT G G
Sbjct: 592 EVMYSFKINSHVSFPLEGLDLRPFLAKECTSQITTYDLLSVICHHGTAGSG 642



 Score = 81.0 bits (191), Expect = 4e-15
 Identities = 39/67 (58%), Positives = 46/67 (68%)
 Frame = +1

Query: 4   VPNSARAKSGSSGDGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPS 183
           V   A+  S  S      +YRS+ISD+F G +LS VQCL CDRVST +ETFQDLSLPIP 
Sbjct: 422 VLKKAQVLSAGSRRRKEQRYRSVISDIFDGSILSLVQCLTCDRVSTTVETFQDLSLPIPG 481

Query: 184 REHLAVL 204
           +E LA L
Sbjct: 482 KEDLAKL 488


>AB023220-1|BAA76847.2|  917|Homo sapiens KIAA1003 protein protein.
          Length = 917

 Score =  130 bits (315), Expect = 4e-30
 Identities = 60/111 (54%), Positives = 75/111 (67%)
 Frame = +3

Query: 294 FYGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH 473
           F+GPVV+L+DCLAAFF+ADELKGDNMYSC RCKKLRNGVK   ++ LP +LC+HLKRFRH
Sbjct: 535 FWGPVVTLEDCLAAFFAADELKGDNMYSCERCKKLRNGVKYCKVLRLPEILCIHLKRFRH 594

Query: 474 ELLFSAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
           E+++S K+             R    K     ++ Y L +VI H GT G G
Sbjct: 595 EVMYSFKINSHVSFPLEGLDLRPFLAKECTSQITTYDLLSVICHHGTAGSG 645



 Score = 81.0 bits (191), Expect = 4e-15
 Identities = 39/67 (58%), Positives = 46/67 (68%)
 Frame = +1

Query: 4   VPNSARAKSGSSGDGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPS 183
           V   A+  S  S      +YRS+ISD+F G +LS VQCL CDRVST +ETFQDLSLPIP 
Sbjct: 425 VLKKAQVLSAGSRRRKEQRYRSVISDIFDGSILSLVQCLTCDRVSTTVETFQDLSLPIPG 484

Query: 184 REHLAVL 204
           +E LA L
Sbjct: 485 KEDLAKL 491


>BC016663-1|AAH16663.1|  828|Homo sapiens ubiquitin specific
           peptidase 33 protein.
          Length = 828

 Score =  128 bits (308), Expect = 2e-29
 Identities = 59/111 (53%), Positives = 72/111 (64%)
 Frame = +3

Query: 294 FYGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH 473
           F+GPVV+LQDCLAAFF+ DELKGDNMYSC +CKKLRNGVK   +   P +LC+HLKRFRH
Sbjct: 554 FWGPVVTLQDCLAAFFARDELKGDNMYSCEKCKKLRNGVKFCKVQNFPEILCIHLKRFRH 613

Query: 474 ELLFSAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
           EL+FS K+             +    K +P  +  Y L +VI H GT   G
Sbjct: 614 ELMFSTKISTHVSFPLEGLDLQPFLAKDSPAQIVTYDLLSVICHHGTASSG 664



 Score = 79.8 bits (188), Expect = 9e-15
 Identities = 39/69 (56%), Positives = 49/69 (71%), Gaps = 1/69 (1%)
 Frame = +1

Query: 1   LVPNSARAKSGS-SGDGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           L P   +A+S S      + KYRS+ISD+F G ++S+VQCL CDRVS  +ETFQDLSLPI
Sbjct: 450 LAPPHKKAQSASPKRKKQHKKYRSVISDIFDGTIISSVQCLTCDRVSVTLETFQDLSLPI 509

Query: 178 PSREHLAVL 204
           P +E LA L
Sbjct: 510 PGKEDLAKL 518


>AF383173-1|AAL78315.1|  911|Homo sapiens pVHL-interacting
           deubiquitinating enzyme 1 type II protein.
          Length = 911

 Score =  128 bits (308), Expect = 2e-29
 Identities = 59/111 (53%), Positives = 72/111 (64%)
 Frame = +3

Query: 294 FYGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH 473
           F+GPVV+LQDCLAAFF+ DELKGDNMYSC +CKKLRNGVK   +   P +LC+HLKRFRH
Sbjct: 531 FWGPVVTLQDCLAAFFARDELKGDNMYSCEKCKKLRNGVKFCKVQNFPEILCIHLKRFRH 590

Query: 474 ELLFSAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
           EL+FS K+             +    K +P  +  Y L +VI H GT   G
Sbjct: 591 ELMFSTKISTHVSFPLEGLDLQPFLAKDSPAQIVTYDLLSVICHHGTASSG 641



 Score = 79.8 bits (188), Expect = 9e-15
 Identities = 39/69 (56%), Positives = 49/69 (71%), Gaps = 1/69 (1%)
 Frame = +1

Query: 1   LVPNSARAKSGS-SGDGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           L P   +A+S S      + KYRS+ISD+F G ++S+VQCL CDRVS  +ETFQDLSLPI
Sbjct: 419 LAPPHKKAQSASPKRKKQHKKYRSVISDIFDGTIISSVQCLTCDRVSVTLETFQDLSLPI 478

Query: 178 PSREHLAVL 204
           P +E LA L
Sbjct: 479 PGKEDLAKL 487


>AF383172-1|AAL78314.1|  942|Homo sapiens pVHL-interacting
           deubiquitinating enzyme 1 type I protein.
          Length = 942

 Score =  128 bits (308), Expect = 2e-29
 Identities = 59/111 (53%), Positives = 72/111 (64%)
 Frame = +3

Query: 294 FYGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH 473
           F+GPVV+LQDCLAAFF+ DELKGDNMYSC +CKKLRNGVK   +   P +LC+HLKRFRH
Sbjct: 562 FWGPVVTLQDCLAAFFARDELKGDNMYSCEKCKKLRNGVKFCKVQNFPEILCIHLKRFRH 621

Query: 474 ELLFSAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
           EL+FS K+             +    K +P  +  Y L +VI H GT   G
Sbjct: 622 ELMFSTKISTHVSFPLEGLDLQPFLAKDSPAQIVTYDLLSVICHHGTASSG 672



 Score = 79.8 bits (188), Expect = 9e-15
 Identities = 39/69 (56%), Positives = 49/69 (71%), Gaps = 1/69 (1%)
 Frame = +1

Query: 1   LVPNSARAKSGS-SGDGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           L P   +A+S S      + KYRS+ISD+F G ++S+VQCL CDRVS  +ETFQDLSLPI
Sbjct: 450 LAPPHKKAQSASPKRKKQHKKYRSVISDIFDGTIISSVQCLTCDRVSVTLETFQDLSLPI 509

Query: 178 PSREHLAVL 204
           P +E LA L
Sbjct: 510 PGKEDLAKL 518


>AB029020-1|BAA83049.1|  980|Homo sapiens KIAA1097 protein protein.
          Length = 980

 Score =  128 bits (308), Expect = 2e-29
 Identities = 59/111 (53%), Positives = 72/111 (64%)
 Frame = +3

Query: 294 FYGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH 473
           F+GPVV+LQDCLAAFF+ DELKGDNMYSC +CKKLRNGVK   +   P +LC+HLKRFRH
Sbjct: 600 FWGPVVTLQDCLAAFFARDELKGDNMYSCEKCKKLRNGVKFCKVQNFPEILCIHLKRFRH 659

Query: 474 ELLFSAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
           EL+FS K+             +    K +P  +  Y L +VI H GT   G
Sbjct: 660 ELMFSTKISTHVSFPLEGLDLQPFLAKDSPAQIVTYDLLSVICHHGTASSG 710



 Score = 79.8 bits (188), Expect = 9e-15
 Identities = 39/69 (56%), Positives = 49/69 (71%), Gaps = 1/69 (1%)
 Frame = +1

Query: 1   LVPNSARAKSGS-SGDGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           L P   +A+S S      + KYRS+ISD+F G ++S+VQCL CDRVS  +ETFQDLSLPI
Sbjct: 488 LAPPHKKAQSASPKRKKQHKKYRSVISDIFDGTIISSVQCLTCDRVSVTLETFQDLSLPI 547

Query: 178 PSREHLAVL 204
           P +E LA L
Sbjct: 548 PGKEDLAKL 556


>AK022864-1|BAB14279.1|  828|Homo sapiens protein ( Homo sapiens
           cDNA FLJ12802 fis, clone NT2RP2002124, weakly similar to
           UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 4 (EC 3.1.2.15).
           ).
          Length = 828

 Score =  126 bits (305), Expect = 6e-29
 Identities = 58/111 (52%), Positives = 72/111 (64%)
 Frame = +3

Query: 294 FYGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH 473
           F+GPVV+LQDCLAAFF+ DELKGDNMYSC +CKKLRNGVK   +   P +LC+HL+RFRH
Sbjct: 554 FWGPVVTLQDCLAAFFARDELKGDNMYSCEKCKKLRNGVKFCKVQNFPEILCIHLRRFRH 613

Query: 474 ELLFSAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
           EL+FS K+             +    K +P  +  Y L +VI H GT   G
Sbjct: 614 ELMFSTKISTHVSFPLEGLDLQPFLAKDSPAQIVTYDLLSVICHHGTASSG 664



 Score = 79.8 bits (188), Expect = 9e-15
 Identities = 39/69 (56%), Positives = 49/69 (71%), Gaps = 1/69 (1%)
 Frame = +1

Query: 1   LVPNSARAKSGS-SGDGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           L P   +A+S S      + KYRS+ISD+F G ++S+VQCL CDRVS  +ETFQDLSLPI
Sbjct: 450 LAPPHKKAQSASPKRKKQHKKYRSVISDIFDGTIISSVQCLTCDRVSVTLETFQDLSLPI 509

Query: 178 PSREHLAVL 204
           P +E LA L
Sbjct: 510 PGKEDLAKL 518


>BT007269-1|AAP35933.1|  520|Homo sapiens ubiquitin specific
           protease 3 protein.
          Length = 520

 Score = 63.3 bits (147), Expect = 8e-10
 Identities = 40/112 (35%), Positives = 53/112 (47%), Gaps = 3/112 (2%)
 Frame = +3

Query: 300 GPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHEL 479
           GPV SL+DCL +F   +EL    +Y C +CKK +   K   I  LP VLC+HLKRF    
Sbjct: 359 GPVCSLRDCLRSFTDLEELDETELYMCHKCKKKQKSTKKFWIQKLPKVLCLHLKRFHWTA 418

Query: 480 LFSAKVXXXXXXXXTIWT*R--LTRTKSAPRXVSRYSLXAVISHMGT-VGGG 626
               KV             +  L   +++      Y L AV+ H G+ VG G
Sbjct: 419 YLRNKVDTYVEFPLRGLDMKCYLLEPENSGPESCLYDLAAVVVHHGSGVGSG 470



 Score = 39.5 bits (88), Expect = 0.011
 Identities = 17/40 (42%), Positives = 26/40 (65%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           ++++ +F G L + V CLIC   S + + F DLSL IPS+
Sbjct: 308 TVVTAIFGGILQNEVNCLICGTESRKFDPFLDLSLDIPSQ 347


>BC107138-1|AAI07139.1|  520|Homo sapiens ubiquitin specific
           peptidase 3 protein.
          Length = 520

 Score = 63.3 bits (147), Expect = 8e-10
 Identities = 40/112 (35%), Positives = 53/112 (47%), Gaps = 3/112 (2%)
 Frame = +3

Query: 300 GPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHEL 479
           GPV SL+DCL +F   +EL    +Y C +CKK +   K   I  LP VLC+HLKRF    
Sbjct: 359 GPVCSLRDCLRSFTDLEELDETELYMCHKCKKKQKSTKKFWIQKLPKVLCLHLKRFHWTA 418

Query: 480 LFSAKVXXXXXXXXTIWT*R--LTRTKSAPRXVSRYSLXAVISHMGT-VGGG 626
               KV             +  L   +++      Y L AV+ H G+ VG G
Sbjct: 419 YLRNKVDTYVEFPLRGLDMKCYLLEPENSGPESCLYDLAAVVVHHGSGVGSG 470



 Score = 39.5 bits (88), Expect = 0.011
 Identities = 17/40 (42%), Positives = 26/40 (65%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           ++++ +F G L + V CLIC   S + + F DLSL IPS+
Sbjct: 308 TVVTAIFGGILQNEVNCLICGTESRKFDPFLDLSLDIPSQ 347


>BC107137-1|AAI07138.1|  520|Homo sapiens ubiquitin specific
           peptidase 3 protein.
          Length = 520

 Score = 63.3 bits (147), Expect = 8e-10
 Identities = 40/112 (35%), Positives = 53/112 (47%), Gaps = 3/112 (2%)
 Frame = +3

Query: 300 GPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHEL 479
           GPV SL+DCL +F   +EL    +Y C +CKK +   K   I  LP VLC+HLKRF    
Sbjct: 359 GPVCSLRDCLRSFTDLEELDETELYMCHKCKKKQKSTKKFWIQKLPKVLCLHLKRFHWTA 418

Query: 480 LFSAKVXXXXXXXXTIWT*R--LTRTKSAPRXVSRYSLXAVISHMGT-VGGG 626
               KV             +  L   +++      Y L AV+ H G+ VG G
Sbjct: 419 YLRNKVDTYVEFPLRGLDMKCYLLEPENSGPESCLYDLAAVVVHHGSGVGSG 470



 Score = 39.5 bits (88), Expect = 0.011
 Identities = 17/40 (42%), Positives = 26/40 (65%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           ++++ +F G L + V CLIC   S + + F DLSL IPS+
Sbjct: 308 TVVTAIFGGILQNEVNCLICGTESRKFDPFLDLSLDIPSQ 347


>BC065300-1|AAH65300.1|  520|Homo sapiens ubiquitin specific
           peptidase 3 protein.
          Length = 520

 Score = 63.3 bits (147), Expect = 8e-10
 Identities = 40/112 (35%), Positives = 53/112 (47%), Gaps = 3/112 (2%)
 Frame = +3

Query: 300 GPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHEL 479
           GPV SL+DCL +F   +EL    +Y C +CKK +   K   I  LP VLC+HLKRF    
Sbjct: 359 GPVCSLRDCLRSFTDLEELDETELYMCHKCKKKQKSTKKFWIQKLPKVLCLHLKRFHWTA 418

Query: 480 LFSAKVXXXXXXXXTIWT*R--LTRTKSAPRXVSRYSLXAVISHMGT-VGGG 626
               KV             +  L   +++      Y L AV+ H G+ VG G
Sbjct: 419 YLRNKVDTYVEFPLRGLDMKCYLLEPENSGPESCLYDLAAVVVHHGSGVGSG 470



 Score = 39.5 bits (88), Expect = 0.011
 Identities = 17/40 (42%), Positives = 26/40 (65%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           ++++ +F G L + V CLIC   S + + F DLSL IPS+
Sbjct: 308 TVVTAIFGGILQNEVNCLICGTESRKFDPFLDLSLDIPSQ 347


>BC018113-1|AAH18113.1|  520|Homo sapiens ubiquitin specific
           peptidase 3 protein.
          Length = 520

 Score = 63.3 bits (147), Expect = 8e-10
 Identities = 40/112 (35%), Positives = 53/112 (47%), Gaps = 3/112 (2%)
 Frame = +3

Query: 300 GPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHEL 479
           GPV SL+DCL +F   +EL    +Y C +CKK +   K   I  LP VLC+HLKRF    
Sbjct: 359 GPVCSLRDCLRSFTDLEELDETELYMCHKCKKKQKSTKKFWIQKLPKVLCLHLKRFHWTA 418

Query: 480 LFSAKVXXXXXXXXTIWT*R--LTRTKSAPRXVSRYSLXAVISHMGT-VGGG 626
               KV             +  L   +++      Y L AV+ H G+ VG G
Sbjct: 419 YLRNKVDTYVEFPLRGLDMKCYLLEPENSGPESCLYDLAAVVVHHGSGVGSG 470



 Score = 39.5 bits (88), Expect = 0.011
 Identities = 17/40 (42%), Positives = 26/40 (65%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           ++++ +F G L + V CLIC   S + + F DLSL IPS+
Sbjct: 308 TVVTAIFGGILQNEVNCLICGTESRKFDPFLDLSLDIPSQ 347


>AY461579-1|AAT37507.1|  498|Homo sapiens UBP protein protein.
          Length = 498

 Score = 63.3 bits (147), Expect = 8e-10
 Identities = 40/112 (35%), Positives = 53/112 (47%), Gaps = 3/112 (2%)
 Frame = +3

Query: 300 GPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHEL 479
           GPV SL+DCL +F   +EL    +Y C +CKK +   K   I  LP VLC+HLKRF    
Sbjct: 337 GPVCSLRDCLRSFTDLEELDETELYMCHKCKKKQKSTKKFWIQKLPKVLCLHLKRFHWTA 396

Query: 480 LFSAKVXXXXXXXXTIWT*R--LTRTKSAPRXVSRYSLXAVISHMGT-VGGG 626
               KV             +  L   +++      Y L AV+ H G+ VG G
Sbjct: 397 YLRNKVDTYVEFPLRGLDMKCYLLEPENSGPESCLYDLAAVVVHHGSGVGSG 448



 Score = 39.5 bits (88), Expect = 0.011
 Identities = 17/40 (42%), Positives = 26/40 (65%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           ++++ +F G L + V CLIC   S + + F DLSL IPS+
Sbjct: 286 TVVTAIFGGILQNEVNCLICGTESRKFDPFLDLSLDIPSQ 325


>AF073344-1|AAD42992.1|  521|Homo sapiens ubiquitin-specific
           protease 3 protein.
          Length = 521

 Score = 63.3 bits (147), Expect = 8e-10
 Identities = 40/112 (35%), Positives = 53/112 (47%), Gaps = 3/112 (2%)
 Frame = +3

Query: 300 GPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHEL 479
           GPV SL+DCL +F   +EL    +Y C +CKK +   K   I  LP VLC+HLKRF    
Sbjct: 360 GPVCSLRDCLRSFTDLEELDETELYMCHKCKKKQKSTKKFWIQKLPKVLCLHLKRFHWTA 419

Query: 480 LFSAKVXXXXXXXXTIWT*R--LTRTKSAPRXVSRYSLXAVISHMGT-VGGG 626
               KV             +  L   +++      Y L AV+ H G+ VG G
Sbjct: 420 YLRNKVDTYVEFPLRGLDMKWYLLEPENSGPESCLYDLAAVVVHHGSGVGSG 471



 Score = 39.5 bits (88), Expect = 0.011
 Identities = 17/40 (42%), Positives = 26/40 (65%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           ++++ +F G L + V CLIC   S + + F DLSL IPS+
Sbjct: 309 TVVTAIFGGILQNEVNCLICGTESRKFDPFLDLSLDIPSQ 348


>D29956-1|BAA06225.2| 1120|Homo sapiens KIAA0055 protein.
          Length = 1120

 Score = 56.8 bits (131), Expect = 7e-08
 Identities = 34/106 (32%), Positives = 56/106 (52%), Gaps = 1/106 (0%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
            +LQDCL  F   ++L  +N + CS C+  R+ +K   I  LP VL VHLKRF ++  +  
Sbjct: 965  TLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQ 1024

Query: 492  KVXXXXXXXXTIWT*RLTRTKSAPR-XVSRYSLXAVISHMGTVGGG 626
            K+         +    L++    P+  + +Y+L +V +H G + GG
Sbjct: 1025 KL--QTSVDFPLENLDLSQYVIGPKNNLKKYNLFSVSNHYGGLDGG 1068



 Score = 39.9 bits (89), Expect = 0.008
 Identities = 20/48 (41%), Positives = 25/48 (52%)
 Frame = +1

Query: 67   SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRC 210
            SII  +F G+  S VQCL C + S   E F  LSLP+ S     +  C
Sbjct: 922  SIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPLASTSKCTLQDC 969


>BX537420-1|CAD97662.1| 1118|Homo sapiens hypothetical protein
            protein.
          Length = 1118

 Score = 56.8 bits (131), Expect = 7e-08
 Identities = 34/106 (32%), Positives = 56/106 (52%), Gaps = 1/106 (0%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
            +LQDCL  F   ++L  +N + CS C+  R+ +K   I  LP VL VHLKRF ++  +  
Sbjct: 963  TLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQ 1022

Query: 492  KVXXXXXXXXTIWT*RLTRTKSAPR-XVSRYSLXAVISHMGTVGGG 626
            K+         +    L++    P+  + +Y+L +V +H G + GG
Sbjct: 1023 KL--QTSVDFPLENLDLSQYVIGPKNNLKKYNLFSVSNHYGGLDGG 1066



 Score = 39.9 bits (89), Expect = 0.008
 Identities = 20/48 (41%), Positives = 25/48 (52%)
 Frame = +1

Query: 67   SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRC 210
            SII  +F G+  S VQCL C + S   E F  LSLP+ S     +  C
Sbjct: 920  SIIVALFQGQFKSTVQCLTCHKKSRAFEAFMYLSLPLASTSKCTLQDC 967


>BC110590-1|AAI10591.1| 1118|Homo sapiens ubiquitin specific peptidase
            8 protein.
          Length = 1118

 Score = 56.8 bits (131), Expect = 7e-08
 Identities = 34/106 (32%), Positives = 56/106 (52%), Gaps = 1/106 (0%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
            +LQDCL  F   ++L  +N + CS C+  R+ +K   I  LP VL VHLKRF ++  +  
Sbjct: 963  TLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQ 1022

Query: 492  KVXXXXXXXXTIWT*RLTRTKSAPR-XVSRYSLXAVISHMGTVGGG 626
            K+         +    L++    P+  + +Y+L +V +H G + GG
Sbjct: 1023 KL--QTSVDFPLENLDLSQYVIGPKNNLKKYNLFSVSNHYGGLDGG 1066



 Score = 39.9 bits (89), Expect = 0.008
 Identities = 20/48 (41%), Positives = 25/48 (52%)
 Frame = +1

Query: 67   SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRC 210
            SII  +F G+  S VQCL C + S   E F  LSLP+ S     +  C
Sbjct: 920  SIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPLASTSKCTLQDC 967


>BC041366-1|AAH41366.1|  362|Homo sapiens USP2 protein protein.
          Length = 362

 Score = 56.8 bits (131), Expect = 7e-08
 Identities = 34/108 (31%), Positives = 51/108 (47%)
 Frame = +3

Query: 303 PVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELL 482
           P V+L DC+  F   D L GD   +C RC+  +  +K   I   P +L +HLKRF    +
Sbjct: 208 PEVTLMDCMRLFTKEDVLDGDEKPTCCRCRGRKRCIKKFSIQRFPKILVLHLKRFSESRI 267

Query: 483 FSAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
            ++K+             R   +++    V  Y+L AV +H GT  GG
Sbjct: 268 RTSKLTTFVNFPLRDLDLREFASENTNHAV--YNLYAVSNHSGTTMGG 313



 Score = 38.3 bits (85), Expect = 0.026
 Identities = 19/40 (47%), Positives = 24/40 (60%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           S I D+F G+L S++ C  C   ST  + F DLSLPI  R
Sbjct: 166 SRIGDLFVGQLKSSLTCTDCGYCSTVFDPFWDLSLPIAKR 205


>BC002955-1|AAH02955.1|  605|Homo sapiens ubiquitin specific
           peptidase 2 protein.
          Length = 605

 Score = 56.8 bits (131), Expect = 7e-08
 Identities = 34/108 (31%), Positives = 51/108 (47%)
 Frame = +3

Query: 303 PVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELL 482
           P V+L DC+  F   D L GD   +C RC+  +  +K   I   P +L +HLKRF    +
Sbjct: 451 PEVTLMDCMRLFTKEDVLDGDEKPTCCRCRGRKRCIKKFSIQRFPKILVLHLKRFSESRI 510

Query: 483 FSAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
            ++K+             R   +++    V  Y+L AV +H GT  GG
Sbjct: 511 RTSKLTTFVNFPLRDLDLREFASENTNHAV--YNLYAVSNHSGTTMGG 556



 Score = 38.3 bits (85), Expect = 0.026
 Identities = 19/40 (47%), Positives = 24/40 (60%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           S I D+F G+L S++ C  C   ST  + F DLSLPI  R
Sbjct: 409 SRIGDLFVGQLKSSLTCTDCGYCSTVFDPFWDLSLPIAKR 448


>BC002854-1|AAH02854.1|  605|Homo sapiens ubiquitin specific
           peptidase 2 protein.
          Length = 605

 Score = 56.8 bits (131), Expect = 7e-08
 Identities = 34/108 (31%), Positives = 51/108 (47%)
 Frame = +3

Query: 303 PVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELL 482
           P V+L DC+  F   D L GD   +C RC+  +  +K   I   P +L +HLKRF    +
Sbjct: 451 PEVTLMDCMRLFTKEDVLDGDEKPTCCRCRGRKRCIKKFSIQRFPKILVLHLKRFSESRI 510

Query: 483 FSAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
            ++K+             R   +++    V  Y+L AV +H GT  GG
Sbjct: 511 RTSKLTTFVNFPLRDLDLREFASENTNHAV--YNLYAVSNHSGTTMGG 556



 Score = 38.3 bits (85), Expect = 0.026
 Identities = 19/40 (47%), Positives = 24/40 (60%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           S I D+F G+L S++ C  C   ST  + F DLSLPI  R
Sbjct: 409 SRIGDLFVGQLKSSLTCTDCGYCSTVFDPFWDLSLPIAKR 448


>AF440755-1|AAN65363.1|  396|Homo sapiens ubiquitin specific
           protease 2b protein.
          Length = 396

 Score = 56.8 bits (131), Expect = 7e-08
 Identities = 34/108 (31%), Positives = 51/108 (47%)
 Frame = +3

Query: 303 PVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELL 482
           P V+L DC+  F   D L GD   +C RC+  +  +K   I   P +L +HLKRF    +
Sbjct: 242 PEVTLMDCMRLFTKEDVLDGDEKPTCCRCRGRKRCIKKFSIQRFPKILVLHLKRFSESRI 301

Query: 483 FSAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
            ++K+             R   +++    V  Y+L AV +H GT  GG
Sbjct: 302 RTSKLTTFVNFPLRDLDLREFASENTNHAV--YNLYAVSNHSGTTMGG 347



 Score = 38.3 bits (85), Expect = 0.026
 Identities = 19/40 (47%), Positives = 24/40 (60%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           S I D+F G+L S++ C  C   ST  + F DLSLPI  R
Sbjct: 200 SRIGDLFVGQLKSSLTCTDCGYCSTVFDPFWDLSLPIAKR 239


>AF079564-1|AAC28392.1|  353|Homo sapiens ubiquitin-specific
           protease UBP41 protein.
          Length = 353

 Score = 56.8 bits (131), Expect = 7e-08
 Identities = 34/108 (31%), Positives = 51/108 (47%)
 Frame = +3

Query: 303 PVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELL 482
           P V+L DC+  F   D L GD   +C RC+  +  +K   I   P +L +HLKRF    +
Sbjct: 199 PEVTLMDCMRLFTKEDVLDGDEKPTCCRCRGRKRCIKKFSIQRFPKILVLHLKRFSESRI 258

Query: 483 FSAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
            ++K+             R   +++    V  Y+L AV +H GT  GG
Sbjct: 259 RTSKLTTFVNFPLRDLDLREFASENTNHAV--YNLYAVSNHSGTTMGG 304



 Score = 38.3 bits (85), Expect = 0.026
 Identities = 19/40 (47%), Positives = 24/40 (60%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           S I D+F G+L S++ C  C   ST  + F DLSLPI  R
Sbjct: 157 SRIGDLFVGQLKSSLTCTDCGYCSTVFDPFWDLSLPIAKR 196


>BC125123-1|AAI25124.1|  952|Homo sapiens ubiquitin specific peptidase
            15 protein.
          Length = 952

 Score = 54.0 bits (124), Expect = 5e-07
 Identities = 34/110 (30%), Positives = 52/110 (47%), Gaps = 2/110 (1%)
 Frame = +3

Query: 303  PVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELL 482
            P V L+DC+  F + ++L  ++ + C  CK+ +   K   +  LP VL VHLKRF +   
Sbjct: 755  PFVKLKDCIELFTTKEKLGAEDPWYCPNCKEHQQATKKLDLWSLPPVLVVHLKRFSYSRY 814

Query: 483  FSAKVXXXXXXXXT--IWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
               K+             +  L    + P    RY+L AV +H G +GGG
Sbjct: 815  MRDKLDTLVDFPINDLDMSEFLINPNAGP---CRYNLIAVSNHYGGMGGG 861



 Score = 34.3 bits (75), Expect = 0.42
 Identities = 15/41 (36%), Positives = 24/41 (58%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSRE 189
           SII D+F G   S + C  C ++S   + F  L+LP+P ++
Sbjct: 403 SIIVDIFHGLFKSTLVCPECAKISVTFDPFCYLTLPLPMKK 443


>AF153604-1|AAD41086.1|  981|Homo sapiens ubiquitin-specific protease
            homolog protein.
          Length = 981

 Score = 54.0 bits (124), Expect = 5e-07
 Identities = 34/110 (30%), Positives = 52/110 (47%), Gaps = 2/110 (1%)
 Frame = +3

Query: 303  PVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELL 482
            P V L+DC+  F + ++L  ++ + C  CK+ +   K   +  LP VL VHLKRF +   
Sbjct: 784  PFVKLKDCIELFTTKEKLGAEDPWYCPNCKEHQQATKKLDLWSLPPVLVVHLKRFSYSRY 843

Query: 483  FSAKVXXXXXXXXT--IWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
               K+             +  L    + P    RY+L AV +H G +GGG
Sbjct: 844  MRDKLDTLVDFPINDLDMSEFLINPNAGP---CRYNLIAVSNHYGGMGGG 890



 Score = 34.3 bits (75), Expect = 0.42
 Identities = 15/41 (36%), Positives = 24/41 (58%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSRE 189
           SII D+F G   S + C  C ++S   + F  L+LP+P ++
Sbjct: 432 SIIVDIFHGLFKSTLVCPECAKISVTFDPFCYLTLPLPMKK 472


>AF106069-1|AAD52099.1|  952|Homo sapiens deubiquitinating enzyme
            protein.
          Length = 952

 Score = 54.0 bits (124), Expect = 5e-07
 Identities = 34/110 (30%), Positives = 52/110 (47%), Gaps = 2/110 (1%)
 Frame = +3

Query: 303  PVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELL 482
            P V L+DC+  F + ++L  ++ + C  CK+ +   K   +  LP VL VHLKRF +   
Sbjct: 755  PFVKLKDCIELFTTKEKLGAEDPWYCPNCKEHQQATKKLDLWSLPPVLVVHLKRFSYSRY 814

Query: 483  FSAKVXXXXXXXXT--IWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
               K+             +  L    + P    RY+L AV +H G +GGG
Sbjct: 815  MRDKLDTLVDFPINDLDMSEFLINPNAGP---CRYNLIAVSNHYGGMGGG 861



 Score = 34.3 bits (75), Expect = 0.42
 Identities = 15/41 (36%), Positives = 24/41 (58%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSRE 189
           SII D+F G   S + C  C ++S   + F  L+LP+P ++
Sbjct: 403 SIIVDIFHGLFKSTLVCPECAKISVTFDPFCYLTLPLPMKK 443


>AF013990-1|AAG28973.1|  902|Homo sapiens ubiquitin C-terminal
            hydrolase protein.
          Length = 902

 Score = 54.0 bits (124), Expect = 5e-07
 Identities = 34/110 (30%), Positives = 52/110 (47%), Gaps = 2/110 (1%)
 Frame = +3

Query: 303  PVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELL 482
            P V L+DC+  F + ++L  ++ + C  CK+ +   K   +  LP VL VHLKRF +   
Sbjct: 705  PFVKLKDCIELFTTKEKLGAEDPWYCPNCKEHQQATKKLDLWSLPPVLVVHLKRFSYSRY 764

Query: 483  FSAKVXXXXXXXXT--IWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
               K+             +  L    + P    RY+L AV +H G +GGG
Sbjct: 765  MRDKLDTLVDFPINDLDMSEFLINPNAGP---CRYNLIAVSNHYGGMGGG 811



 Score = 34.3 bits (75), Expect = 0.42
 Identities = 15/41 (36%), Positives = 24/41 (58%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSRE 189
           SII D+F G   S + C  C ++S   + F  L+LP+P ++
Sbjct: 353 SIIVDIFHGLFKSTLVCPECAKISVTFDPFCYLTLPLPMKK 393


>AB011101-1|BAA25455.2|  952|Homo sapiens KIAA0529 protein protein.
          Length = 952

 Score = 54.0 bits (124), Expect = 5e-07
 Identities = 34/110 (30%), Positives = 52/110 (47%), Gaps = 2/110 (1%)
 Frame = +3

Query: 303  PVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELL 482
            P V L+DC+  F + ++L  ++ + C  CK+ +   K   +  LP VL VHLKRF +   
Sbjct: 755  PFVKLKDCIELFTTKEKLGAEDPWYCPNCKEHQQATKKLDLWSLPPVLVVHLKRFSYSRY 814

Query: 483  FSAKVXXXXXXXXT--IWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
               K+             +  L    + P    RY+L AV +H G +GGG
Sbjct: 815  MRDKLDTLVDFPINDLDMSEFLINPNAGP---CRYNLIAVSNHYGGMGGG 861



 Score = 34.3 bits (75), Expect = 0.42
 Identities = 15/41 (36%), Positives = 24/41 (58%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSRE 189
           SII D+F G   S + C  C ++S   + F  L+LP+P ++
Sbjct: 403 SIIVDIFHGLFKSTLVCPECAKISVTFDPFCYLTLPLPMKK 443


>AK057225-1|BAB71388.1|  605|Homo sapiens protein ( Homo sapiens
           cDNA FLJ32663 fis, clone TESTI1000070, highly similar to
           Rattus norvegicus deubiquitinating enzyme Ubp69 (ubp69)
           mRNA. ).
          Length = 605

 Score = 53.6 bits (123), Expect = 6e-07
 Identities = 33/108 (30%), Positives = 50/108 (46%)
 Frame = +3

Query: 303 PVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELL 482
           P V+L DC+  F   D L GD   +C RC+  +  +K   I   P +L + LKRF    +
Sbjct: 451 PEVTLMDCMRLFTKEDVLDGDEKPTCCRCRGRKRCIKKFSIQRFPKILVLRLKRFSESRI 510

Query: 483 FSAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
            ++K+             R   +++    V  Y+L AV +H GT  GG
Sbjct: 511 RTSKLTTFVNFPLRDLDLREFASENTNHAV--YNLYAVSNHSGTTMGG 556



 Score = 36.7 bits (81), Expect = 0.079
 Identities = 18/40 (45%), Positives = 23/40 (57%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           S I D+F G+L  ++ C  C   ST  + F DLSLPI  R
Sbjct: 409 SRIGDLFVGQLKGSLTCTDCGYCSTVFDPFWDLSLPIAKR 448


>AJ583818-1|CAE47745.2|  339|Homo sapiens ubiquitin specific
           proteinase 50 protein.
          Length = 339

 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 33/106 (31%), Positives = 49/106 (46%), Gaps = 1/106 (0%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           SL+DCL  FF  D L  +N   CS C+  +     + I   P ++  HLKRF  ++  + 
Sbjct: 223 SLRDCLQCFFQQDALTWNNEIHCSFCETKQETAVRASISKAPKIIIFHLKRF--DIQGTT 280

Query: 492 KVXXXXXXXXTIWT*RLT-RTKSAPRXVSRYSLXAVISHMGTVGGG 626
           K          +    LT    S  R   +Y+L AV++H G + GG
Sbjct: 281 KRKLRTDIHYPLTNLDLTPYICSIFRKYPKYNLCAVVNHFGDLDGG 326



 Score = 38.3 bits (85), Expect = 0.026
 Identities = 18/50 (36%), Positives = 30/50 (60%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRCQQ 216
           SII+ +F  +L  ++ CL C++ + + E F   SLPIPS+   ++  C Q
Sbjct: 180 SIITQLFEEQLNYSIVCLKCEKCTYKNEVFTVFSLPIPSKYECSLRDCLQ 229


>BC094680-1|AAH94680.1|  389|Homo sapiens USP32 protein protein.
          Length = 389

 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 23/54 (42%), Positives = 32/54 (59%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR 470
           ++L  CL AF S +EL  + MY CS+CK      K   +  LP +L +HLKRF+
Sbjct: 18  INLDSCLRAFTSEEELGENEMYYCSKCKTHCLATKKLDLWRLPPILIIHLKRFQ 71


>AF533230-1|AAM97922.1| 1604|Homo sapiens ubiquitin-specific protease
            USP32 protein.
          Length = 1604

 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 23/54 (42%), Positives = 32/54 (59%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR 470
            ++L  CL AF S +EL  + MY CS+CK      K   +  LP +L +HLKRF+
Sbjct: 1233 INLDSCLRAFTSEEELGENEMYYCSKCKTHCLATKKLDLWRLPPILIIHLKRFQ 1286



 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 19/44 (43%), Positives = 28/44 (63%)
 Frame = +1

Query: 64   RSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHL 195
            RSI+ D+F G+L S V+C  C  +S R + F  LSLP+P   ++
Sbjct: 876  RSIVVDLFHGQLRSQVKCKTCGHISVRFDPFNFLSLPLPMDSYM 919


>AF350251-1|AAK30207.1| 1274|Homo sapiens ubiquitin specific protease
            protein.
          Length = 1274

 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 23/54 (42%), Positives = 32/54 (59%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR 470
            ++L  CL AF S +EL  + MY CS+CK      K   +  LP +L +HLKRF+
Sbjct: 903  INLDSCLRAFTSEEELGENEMYYCSKCKTHCLATKKLDLWRLPPILIIHLKRFQ 956



 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 19/44 (43%), Positives = 28/44 (63%)
 Frame = +1

Query: 64  RSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHL 195
           RSI+ D+F G+L S V+C  C  +S R + F  LSLP+P   ++
Sbjct: 546 RSIVVDLFRGQLRSQVKCKTCGHISVRFDPFNFLSLPLPMDSYM 589


>AF155116-1|AAD42882.1|  828|Homo sapiens NY-REN-60 antigen protein.
          Length = 828

 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 23/54 (42%), Positives = 32/54 (59%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR 470
           ++L  CL AF S +EL  + MY CS+CK      K   +  LP +L +HLKRF+
Sbjct: 698 INLDSCLRAFTSEEELGENEMYYCSKCKTHCLATKKLDLWRLPPILIIHLKRFQ 751



 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 19/44 (43%), Positives = 28/44 (63%)
 Frame = +1

Query: 64  RSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHL 195
           RSI+ D+F G+L S V+C  C  +S R + F  LSLP+P   ++
Sbjct: 341 RSIVVDLFHGQLRSQVKCKTCGHISVRFDPFNFLSLPLPMDSYM 384


>Y17457-1|CAB44350.1|  223|Homo sapiens LSFR3A protein protein.
          Length = 223

 Score = 48.8 bits (111), Expect = 2e-05
 Identities = 23/62 (37%), Positives = 32/62 (51%)
 Frame = +3

Query: 441 VLCVHLKRFRHELLFSAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVG 620
           +LC+HLKRFRHE+++S K+             R    K     ++ Y L +VI H GT G
Sbjct: 1   ILCIHLKRFRHEVMYSFKINSHVSFPLEGLDLRPFLAKECTSQITTYDLLSVICHHGTAG 60

Query: 621 GG 626
            G
Sbjct: 61  SG 62


>X63547-2|CAA45111.1| 1089|Homo sapiens oncogene protein.
          Length = 1089

 Score = 47.2 bits (107), Expect = 6e-05
 Identities = 23/54 (42%), Positives = 30/54 (55%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR 470
           ++L  CL AF S +EL    MY CS+CK      K   +  LP  L +HLKRF+
Sbjct: 714 INLDSCLRAFTSEEELGESEMYYCSKCKTHCLATKKLDLWRLPPFLIIHLKRFQ 767



 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +1

Query: 64  RSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHL 195
           RSII D+F G+L S V+C  C  +S R + F  LSLP+P   ++
Sbjct: 357 RSIIVDLFHGQLRSQVKCKTCGHISVRFDPFNFLSLPLPMDSYM 400


>X63546-2|CAA45109.1|  586|Homo sapiens oncogene protein.
          Length = 586

 Score = 47.2 bits (107), Expect = 6e-05
 Identities = 23/54 (42%), Positives = 30/54 (55%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR 470
           ++L  CL AF S +EL    MY CS+CK      K   +  LP  L +HLKRF+
Sbjct: 211 INLDSCLRAFTSEEELGESEMYYCSKCKTHCLATKKLDLWRLPPFLIIHLKRFQ 264


>BC030704-1|AAH30704.1|  712|Homo sapiens ubiquitin specific
           peptidase 44 protein.
          Length = 712

 Score = 47.2 bits (107), Expect = 6e-05
 Identities = 20/40 (50%), Positives = 27/40 (67%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           ++++++F G+LLS V CL CD  S  IE F DLSL  P R
Sbjct: 463 NVVNNIFHGQLLSQVTCLACDNKSNTIEPFWDLSLEFPER 502


>AY143550-1|AAN38838.1| 1406|Homo sapiens ubiquitin-specific protease
            USP6 protein.
          Length = 1406

 Score = 47.2 bits (107), Expect = 6e-05
 Identities = 23/54 (42%), Positives = 30/54 (55%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR 470
            ++L  CL AF S +EL    MY CS+CK      K   +  LP  L +HLKRF+
Sbjct: 1031 INLDSCLRAFTSEEELGESEMYYCSKCKTHCLATKKLDLWRLPPFLIIHLKRFQ 1084



 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +1

Query: 64  RSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHL 195
           RSII D+F G+L S V+C  C  +S R + F  LSLP+P   ++
Sbjct: 674 RSIIVDLFHGQLRSQVKCKTCGHISVRFDPFNFLSLPLPMDSYM 717


>AJ586135-1|CAE51935.2| 1352|Homo sapiens ubiquitin-specific
           proteinase 31 protein.
          Length = 1352

 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 20/55 (36%), Positives = 29/55 (52%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
           +L  C   +   + L  D+ + C  CK+L+ G     +  LP VL +HLKRFR E
Sbjct: 597 TLSQCFQLYTKEERLAPDDAWRCPHCKQLQQGSITLSLWTLPDVLIIHLKRFRQE 651


>BC090946-1|AAH90946.1|  565|Homo sapiens ubiquitin specific
           peptidase 21 protein.
          Length = 565

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 21/58 (36%), Positives = 30/58 (51%)
 Frame = +3

Query: 294 FYGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           F G  VSL+DC   F   +EL+ +N   C RC++     K   +   P +L +HL RF
Sbjct: 409 FAGGKVSLRDCFNLFTKEEELESENAPVCDRCRQKTRSTKKLTVQRFPRILVLHLNRF 466



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 20/40 (50%), Positives = 25/40 (62%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           S I D+F G+L S ++C  C   ST  E F DLSLPIP +
Sbjct: 368 SKIVDLFVGQLKSCLKCQACGYRSTTFEVFCDLSLPIPKK 407


>BC070497-1|AAH70497.1|  367|Homo sapiens USP32 protein protein.
          Length = 367

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 22/49 (44%), Positives = 29/49 (59%)
 Frame = +3

Query: 324 CLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR 470
           CL AF S +EL  + MY CS+CK      K   +  LP +L +HLKRF+
Sbjct: 1   CLRAFTSEEELGENEMYYCSKCKTHCLATKKLDLWRLPPILIIHLKRFQ 49


>BC003130-1|AAH03130.2|  477|Homo sapiens USP21 protein protein.
          Length = 477

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 21/58 (36%), Positives = 30/58 (51%)
 Frame = +3

Query: 294 FYGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           F G  VSL+DC   F   +EL+ +N   C RC++     K   +   P +L +HL RF
Sbjct: 321 FAGGKVSLRDCFNLFTKEEELESENAPVCDRCRQKTRSTKKLTVQRFPRILVLHLNRF 378



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 20/40 (50%), Positives = 25/40 (62%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           S I D+F G+L S ++C  C   ST  E F DLSLPIP +
Sbjct: 280 SKIVDLFVGQLKSCLKCQACGYRSTTFEVFCDLSLPIPKK 319


>AL590714-3|CAH72142.1|  551|Homo sapiens ubiquitin specific
           peptidase 21 protein.
          Length = 551

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 21/58 (36%), Positives = 30/58 (51%)
 Frame = +3

Query: 294 FYGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           F G  VSL+DC   F   +EL+ +N   C RC++     K   +   P +L +HL RF
Sbjct: 409 FAGGKVSLRDCFNLFTKEEELESENAPVCDRCRQKTRSTKKLTVQRFPRILVLHLNRF 466



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 20/40 (50%), Positives = 25/40 (62%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           S I D+F G+L S ++C  C   ST  E F DLSLPIP +
Sbjct: 368 SKIVDLFVGQLKSCLKCQACGYRSTTFEVFCDLSLPIPKK 407


>AL590714-2|CAH72143.1|  565|Homo sapiens ubiquitin specific
           peptidase 21 protein.
          Length = 565

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 21/58 (36%), Positives = 30/58 (51%)
 Frame = +3

Query: 294 FYGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           F G  VSL+DC   F   +EL+ +N   C RC++     K   +   P +L +HL RF
Sbjct: 409 FAGGKVSLRDCFNLFTKEEELESENAPVCDRCRQKTRSTKKLTVQRFPRILVLHLNRF 466



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 20/40 (50%), Positives = 25/40 (62%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           S I D+F G+L S ++C  C   ST  E F DLSLPIP +
Sbjct: 368 SKIVDLFVGQLKSCLKCQACGYRSTTFEVFCDLSLPIPKK 407


>AF217979-1|AAG17222.1|  550|Homo sapiens unknown protein.
          Length = 550

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 21/58 (36%), Positives = 30/58 (51%)
 Frame = +3

Query: 294 FYGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           F G  VSL+DC   F   +EL+ +N   C RC++     K   +   P +L +HL RF
Sbjct: 408 FAGGKVSLRDCFNLFTKEEELESENAPVCDRCRQKTRSTKKLTVQRFPRILVLHLNRF 465



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 20/40 (50%), Positives = 25/40 (62%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           S I D+F G+L S ++C  C   ST  E F DLSLPIP +
Sbjct: 367 SKIVDLFVGQLKSCLKCQACGYRSTTFEVFCDLSLPIPKK 406


>AF177758-1|AAD54321.1|  565|Homo sapiens ubiquitin specific
           protease 16 protein.
          Length = 565

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 21/58 (36%), Positives = 30/58 (51%)
 Frame = +3

Query: 294 FYGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           F G  VSL+DC   F   +EL+ +N   C RC++     K   +   P +L +HL RF
Sbjct: 409 FAGGKVSLRDCFNLFTKEEELESENAPVCDRCRQKTRSTKKLTVQRFPRILVLHLNRF 466



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 20/40 (50%), Positives = 25/40 (62%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           S I D+F G+L S ++C  C   ST  E F DLSLPIP +
Sbjct: 368 SKIVDLFVGQLKSCLKCQACGYRSTTFEVFCDLSLPIPKK 407


>X63546-1|CAA45108.1|  786|Homo sapiens oncogene protein.
          Length = 786

 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +1

Query: 64  RSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHL 195
           RSII D+F G+L S V+C  C  +S R + F  LSLP+P   ++
Sbjct: 674 RSIIVDLFHGQLRSQVKCKTCGHISVRFDPFNFLSLPLPMDSYM 717


>U44839-1|AAC50450.1|  690|Homo sapiens UHX1 protein protein.
          Length = 690

 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 19/55 (34%), Positives = 33/55 (60%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH 473
           V LQ+C+  F + + L+ +N + C  CK+ +   K   + +LP +L +HLKRF +
Sbjct: 506 VRLQECIELFTTVETLEKENPWYCPSCKQHQLATKKLDLWMLPEILIIHLKRFSY 560



 Score = 31.9 bits (69), Expect = 2.2
 Identities = 15/38 (39%), Positives = 20/38 (52%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           S+I D F G   S + C  C  VS   + F  LS+P+P
Sbjct: 179 SVIVDTFHGLFKSTLVCPDCGNVSVTFDPFCYLSVPLP 216


>BC063668-1|AAH63668.1|  923|Homo sapiens USP11 protein protein.
          Length = 923

 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 19/55 (34%), Positives = 33/55 (60%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH 473
           V LQ+C+  F + + L+ +N + C  CK+ +   K   + +LP +L +HLKRF +
Sbjct: 739 VRLQECIELFTTVETLEKENPWYCPSCKQHQLATKKLDLWMLPEILIIHLKRFSY 793



 Score = 31.9 bits (69), Expect = 2.2
 Identities = 15/38 (39%), Positives = 20/38 (52%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           S+I D F G   S + C  C  VS   + F  LS+P+P
Sbjct: 412 SVIVDTFHGLFKSTLVCPDCGNVSVTFDPFCYLSVPLP 449


>BC000350-1|AAH00350.4|  921|Homo sapiens USP11 protein protein.
          Length = 921

 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 19/55 (34%), Positives = 33/55 (60%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH 473
           V LQ+C+  F + + L+ +N + C  CK+ +   K   + +LP +L +HLKRF +
Sbjct: 737 VRLQECIELFTTVETLEKENPWYCPSCKQHQLATKKLDLWMLPEILIIHLKRFSY 791


>AL096791-3|CAD20056.1|  690|Homo sapiens ubiquitin specific
           peptidase 11 protein.
          Length = 690

 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 19/55 (34%), Positives = 33/55 (60%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH 473
           V LQ+C+  F + + L+ +N + C  CK+ +   K   + +LP +L +HLKRF +
Sbjct: 506 VRLQECIELFTTVETLEKENPWYCPSCKQHQLATKKLDLWMLPEILIIHLKRFSY 560



 Score = 31.9 bits (69), Expect = 2.2
 Identities = 15/38 (39%), Positives = 20/38 (52%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           S+I D F G   S + C  C  VS   + F  LS+P+P
Sbjct: 179 SVIVDTFHGLFKSTLVCPDCGNVSVTFDPFCYLSVPLP 216


>AK127075-1|BAC86814.1| 1332|Homo sapiens protein ( Homo sapiens cDNA
            FLJ45132 fis, clone BRAWH3037979, highly  similar to
            Ubiquitin carboxyl-terminal hydrolase 24 (EC 3.1.2.15).
            ).
          Length = 1332

 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 23/52 (44%), Positives = 30/52 (57%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
            SL+  L  F   + L+G N Y C +CK+ R  VK + I  LP VL +HL RF
Sbjct: 1087 SLEISLDQFVRGEVLEGSNAYYCEKCKEKRITVKRTCIKSLPSVLVIHLMRF 1138


>AK126752-1|BAC86673.1|  819|Homo sapiens protein ( Homo sapiens
           cDNA FLJ44799 fis, clone BRACE3041059, weakly  similar
           to Ubiquitin carboxyl-terminal hydrolase 4 (EC
           3.1.2.15). ).
          Length = 819

 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 20/55 (36%), Positives = 28/55 (50%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
           +L  C   +   + L  D+ + C  CK L+ G     +  LP VL +HLKRFR E
Sbjct: 459 TLSQCFQLYTKEERLAPDDAWRCPHCKHLQQGSITLSLWTLPDVLIIHLKRFRQE 513


>AB073597-1|BAC20463.1|  921|Homo sapiens deubiquitinating enzyme
           protein.
          Length = 921

 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 19/55 (34%), Positives = 33/55 (60%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH 473
           V LQ+C+  F + + L+ +N + C  CK+ +   K   + +LP +L +HLKRF +
Sbjct: 737 VRLQECIELFTTVETLEKENPWYCPSCKQHQLATKKLDLWMLPEILIIHLKRFSY 791



 Score = 31.9 bits (69), Expect = 2.2
 Identities = 15/38 (39%), Positives = 20/38 (52%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           S+I D F G   S + C  C  VS   + F  LS+P+P
Sbjct: 410 SVIVDTFHGLFKSTLVCPDCGNVSVTFDPFCYLSVPLP 447


>AB028980-1|BAA83009.1|  977|Homo sapiens KIAA1057 protein protein.
          Length = 977

 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 23/52 (44%), Positives = 30/52 (57%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           SL+  L  F   + L+G N Y C +CK+ R  VK + I  LP VL +HL RF
Sbjct: 194 SLEISLDQFVRGEVLEGSNAYYCEKCKEKRITVKRTCIKSLPSVLVIHLMRF 245


>U20657-1|AAB72237.1|  963|Homo sapiens ubiquitin protease protein.
          Length = 963

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 1/107 (0%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            V+L+DC+  F + + L   + + C  CKK +   K   +  LP +L VHLKRF +   + 
Sbjct: 776  VALRDCIELFTTMETLGEHDPWYCPNCKKHQQATKKFDLWSLPKILVVHLKRFSYNRYWR 835

Query: 489  AKVXXXXXXXXT-IWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
             K+          +         SA   V  Y L AV +H G +G G
Sbjct: 836  DKLDTVVEFPIRGLNMSEFVCNLSARPYV--YDLIAVSNHYGAMGVG 880



 Score = 33.1 bits (72), Expect = 0.97
 Identities = 18/61 (29%), Positives = 32/61 (52%)
 Frame = +1

Query: 7   PNSARAKSGSSGDGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           P++  AK   + +   ++  S+I D F G   S + C  C +VS   + F  L+LP+P +
Sbjct: 427 PDAVVAKE--AWENHRLRNDSVIVDTFHGLFKSTLVCPECAKVSVTFDPFCYLTLPLPLK 484

Query: 187 E 189
           +
Sbjct: 485 K 485


>BC125131-1|AAI25132.1|  963|Homo sapiens ubiquitin specific peptidase
            4 (proto-oncogene) protein.
          Length = 963

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 1/107 (0%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            V+L+DC+  F + + L   + + C  CKK +   K   +  LP +L VHLKRF +   + 
Sbjct: 776  VALRDCIELFTTMETLGEHDPWYCPNCKKHQQATKKFDLWSLPKILVVHLKRFSYNRYWR 835

Query: 489  AKVXXXXXXXXT-IWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
             K+          +         SA   V  Y L AV +H G +G G
Sbjct: 836  DKLDTVVEFPIRGLNMSEFVCNLSARPYV--YDLIAVSNHYGAMGVG 880



 Score = 33.1 bits (72), Expect = 0.97
 Identities = 18/61 (29%), Positives = 32/61 (52%)
 Frame = +1

Query: 7   PNSARAKSGSSGDGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           P++  AK   + +   ++  S+I D F G   S + C  C +VS   + F  L+LP+P +
Sbjct: 427 PDAVVAKE--AWENHRLRNDSVIVDTFHGLFKSTLGCPECAKVSVTFDPFCYLTLPLPLK 484

Query: 187 E 189
           +
Sbjct: 485 K 485


>BC125130-1|AAI25131.1|  963|Homo sapiens ubiquitin specific peptidase
            4 (proto-oncogene) protein.
          Length = 963

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 1/107 (0%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            V+L+DC+  F + + L   + + C  CKK +   K   +  LP +L VHLKRF +   + 
Sbjct: 776  VALRDCIELFTTMETLGEHDPWYCPNCKKHQQATKKFDLWSLPKILVVHLKRFSYNRYWR 835

Query: 489  AKVXXXXXXXXT-IWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
             K+          +         SA   V  Y L AV +H G +G G
Sbjct: 836  DKLDTVVEFPIRGLNMSEFVCNLSARPYV--YDLIAVSNHYGAMGVG 880



 Score = 33.1 bits (72), Expect = 0.97
 Identities = 18/61 (29%), Positives = 32/61 (52%)
 Frame = +1

Query: 7   PNSARAKSGSSGDGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           P++  AK   + +   ++  S+I D F G   S + C  C +VS   + F  L+LP+P +
Sbjct: 427 PDAVVAKE--AWENHRLRNDSVIVDTFHGLFKSTLVCPECAKVSVTFDPFCYLTLPLPLK 484

Query: 187 E 189
           +
Sbjct: 485 K 485


>BC104896-1|AAI04897.1|  983|Homo sapiens USP48 protein protein.
          Length = 983

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 18/51 (35%), Positives = 29/51 (56%)
 Frame = +3

Query: 315 LQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           L DC++ F   ++L+GDN Y C  C+  +N  +   ++ LP  L + L RF
Sbjct: 249 LTDCISEFLKEEKLEGDNRYFCENCQSKQNATRKIRLLSLPCTLNLQLMRF 299


>BC103724-1|AAI03725.1|  640|Homo sapiens USP48 protein protein.
          Length = 640

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 18/51 (35%), Positives = 29/51 (56%)
 Frame = +3

Query: 315 LQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           L DC++ F   ++L+GDN Y C  C+  +N  +   ++ LP  L + L RF
Sbjct: 249 LTDCISEFLKEEKLEGDNRYFCENCQSKQNATRKIRLLSLPCTLNLQLMRF 299


>BC067261-1|AAH67261.1|  640|Homo sapiens USP48 protein protein.
          Length = 640

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 18/51 (35%), Positives = 29/51 (56%)
 Frame = +3

Query: 315 LQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           L DC++ F   ++L+GDN Y C  C+  +N  +   ++ LP  L + L RF
Sbjct: 249 LTDCISEFLKEEKLEGDNRYFCENCQSKQNATRKIRLLSLPCTLNLQLMRF 299


>BC011576-1|AAH11576.1|  443|Homo sapiens USP48 protein protein.
          Length = 443

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 18/51 (35%), Positives = 29/51 (56%)
 Frame = +3

Query: 315 LQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           L DC++ F   ++L+GDN Y C  C+  +N  +   ++ LP  L + L RF
Sbjct: 249 LTDCISEFLKEEKLEGDNRYFCENCQSKQNATRKIRLLSLPCTLNLQLMRF 299


>AL590103-4|CAI12127.1| 1035|Homo sapiens ubiquitin specific
           peptidase 48 protein.
          Length = 1035

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 18/51 (35%), Positives = 29/51 (56%)
 Frame = +3

Query: 315 LQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           L DC++ F   ++L+GDN Y C  C+  +N  +   ++ LP  L + L RF
Sbjct: 249 LTDCISEFLKEEKLEGDNRYFCENCQSKQNATRKIRLLSLPCTLNLQLMRF 299


>AL359815-6|CAI16256.1| 1035|Homo sapiens ubiquitin specific
           peptidase 48 protein.
          Length = 1035

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 18/51 (35%), Positives = 29/51 (56%)
 Frame = +3

Query: 315 LQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           L DC++ F   ++L+GDN Y C  C+  +N  +   ++ LP  L + L RF
Sbjct: 249 LTDCISEFLKEEKLEGDNRYFCENCQSKQNATRKIRLLSLPCTLNLQLMRF 299


>AK223292-1|BAD97012.1|  963|Homo sapiens ubiquitin specific protease,
            proto-oncogene isoform a variant protein.
          Length = 963

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 1/107 (0%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            V+L+DC+  F + + L   + + C  CKK +   K   +  LP +L VHLKRF +   + 
Sbjct: 776  VALRDCIELFTTMETLGEHDPWYCPNCKKHQQATKKFDLWSLPKILVVHLKRFSYNRYWR 835

Query: 489  AKVXXXXXXXXT-IWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
             K+          +         SA   V  Y L AV +H G +G G
Sbjct: 836  DKLDTVVEFPIRGLNMSEFVCNLSARPYV--YDLIAVSNHYGAMGVG 880



 Score = 33.1 bits (72), Expect = 0.97
 Identities = 18/61 (29%), Positives = 32/61 (52%)
 Frame = +1

Query: 7   PNSARAKSGSSGDGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           P++  AK   + +   ++  S+I D F G   S + C  C +VS   + F  L+LP+P +
Sbjct: 427 PDAVVAKE--AWENHRLRNDSVIVDTFHGLFKSTLVCPECAKVSVTFDPFCYLTLPLPLK 484

Query: 187 E 189
           +
Sbjct: 485 K 485


>AK222725-1|BAD96445.1|  916|Homo sapiens ubiquitin specific protease,
            proto-oncogene isoform b variant protein.
          Length = 916

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 1/107 (0%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            V+L+DC+  F + + L   + + C  CKK +   K   +  LP +L VHLKRF +   + 
Sbjct: 729  VALRDCIELFTTMETLGEHDPWYCPNCKKHQQATKKFDLWSLPKILVVHLKRFSYNRYWR 788

Query: 489  AKVXXXXXXXXT-IWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
             K+          +         SA   V  Y L AV +H G +G G
Sbjct: 789  DKLDTVVEFPIRGLNMSEFVCNLSARPYV--YDLIAVSNHYGAMGVG 833



 Score = 32.7 bits (71), Expect = 1.3
 Identities = 15/41 (36%), Positives = 23/41 (56%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSRE 189
           S+I D F G   S + C  C +VS   + F  L+LP+P ++
Sbjct: 398 SVIVDTFHGLFKSTLVCPECAKVSVTFDPFCYLTLPLPLKK 438


>AK026930-1|BAB15591.1|  392|Homo sapiens protein ( Homo sapiens
           cDNA: FLJ23277 fis, clone HEP03322. ).
          Length = 392

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 18/51 (35%), Positives = 29/51 (56%)
 Frame = +3

Query: 315 LQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           L DC++ F   ++L+GDN Y C  C+  +N  +   ++ LP  L + L RF
Sbjct: 249 LTDCISEFLKEEKLEGDNRYFCENCQSKQNATRKIRLLSLPCTLNLQLMRF 299


>AF502942-1|AAP30832.1| 1035|Homo sapiens ubiquitin-specific
           protease 31 protein.
          Length = 1035

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 18/51 (35%), Positives = 29/51 (56%)
 Frame = +3

Query: 315 LQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           L DC++ F   ++L+GDN Y C  C+  +N  +   ++ LP  L + L RF
Sbjct: 249 LTDCISEFLKEEKLEGDNRYFCENCQSKQNATRKIRLLSLPCTLNLQLMRF 299


>AF017306-1|AAC27356.1|  916|Homo sapiens UnpES protein.
          Length = 916

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 1/107 (0%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            V+L+DC+  F + + L   + + C  CKK +   K   +  LP +L VHLKRF +   + 
Sbjct: 729  VALRDCIELFTTMETLGEHDPWYCPNCKKHQQATKKFDLWSLPKILVVHLKRFSYNRYWR 788

Query: 489  AKVXXXXXXXXT-IWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
             K+          +         SA   V  Y L AV +H G +G G
Sbjct: 789  DKLDTVVEFPIRGLNMSEFVCNLSARPYV--YDLIAVSNHYGAMGVG 833



 Score = 33.1 bits (72), Expect = 0.97
 Identities = 18/61 (29%), Positives = 32/61 (52%)
 Frame = +1

Query: 7   PNSARAKSGSSGDGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           P++  AK   + +   ++  S+I D F G   S + C  C +VS   + F  L+LP+P +
Sbjct: 380 PDAVVAKE--AWENHRLRNDSVIVDTFHGLFKSTLVCPECAKVSVTFDPFCYLTLPLPLK 437

Query: 187 E 189
           +
Sbjct: 438 K 438


>AF017305-1|AAC27355.1|  963|Homo sapiens UnpEL protein.
          Length = 963

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 1/107 (0%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFS 488
            V+L+DC+  F + + L   + + C  CKK +   K   +  LP +L VHLKRF +   + 
Sbjct: 776  VALRDCIELFTTMETLGEHDPWYCPNCKKHQQATKKFDLWSLPKILVVHLKRFSYNRYWR 835

Query: 489  AKVXXXXXXXXT-IWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
             K+          +         SA   V  Y L AV +H G +G G
Sbjct: 836  DKLDTVVEFPIRGLNMSEFVCNLSARPYV--YDLIAVSNHYGAMGVG 880



 Score = 33.1 bits (72), Expect = 0.97
 Identities = 18/61 (29%), Positives = 32/61 (52%)
 Frame = +1

Query: 7   PNSARAKSGSSGDGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           P++  AK   + +   ++  S+I D F G   S + C  C +VS   + F  L+LP+P +
Sbjct: 427 PDAVVAKE--AWENHRLRNDSVIVDTFHGLFKSTLVCPECAKVSVTFDPFCYLTLPLPLK 484

Query: 187 E 189
           +
Sbjct: 485 K 485


>AJ583823-1|CAE47750.2|  711|Homo sapiens ubiquitin specific
           proteinase 51 protein.
          Length = 711

 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 36/119 (30%), Positives = 49/119 (41%), Gaps = 12/119 (10%)
 Frame = +3

Query: 306 VVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLF 485
           + SL DCL  F   + L       C+ C+  +   K   +  LP V C HLKRF H    
Sbjct: 546 IPSLTDCLQWFTRPEHLGSSAKIKCNSCQSYQESTKQLTMKKLPIVACFHLKRFEHVGKQ 605

Query: 486 SAKVXXXXXXXXTI-WT*RLTRTKSA-------PRXV----SRYSLXAVISHMGTVGGG 626
             K+         +  T  L  TK +       P       ++YSL AVI+H GT+  G
Sbjct: 606 RRKINTFISFPLELDMTPFLASTKESRMKEGQPPTDCVPNENKYSLFAVINHHGTLESG 664



 Score = 35.1 bits (77), Expect = 0.24
 Identities = 17/37 (45%), Positives = 21/37 (56%)
 Frame = +1

Query: 70  IISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           II  +F G L S V C  C  VST I+   D+SL +P
Sbjct: 483 IIDQIFTGGLQSDVTCQACHSVSTTIDPCWDISLDLP 519


>BC014176-1|AAH14176.1|  640|Homo sapiens ubiquitin specific
           peptidase 49 protein.
          Length = 640

 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 19/41 (46%), Positives = 26/41 (63%)
 Frame = +1

Query: 70  IISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREH 192
           +++ +F G+LLS V C+ C+  S  IE F DLSL  P R H
Sbjct: 440 VVNTIFHGQLLSQVTCISCNYKSNTIEPFWDLSLEFPERYH 480


>AL365205-13|CAI13188.1|  640|Homo sapiens ubiquitin specific
           peptidase 49 protein.
          Length = 640

 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 19/41 (46%), Positives = 26/41 (63%)
 Frame = +1

Query: 70  IISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREH 192
           +++ +F G+LLS V C+ C+  S  IE F DLSL  P R H
Sbjct: 440 VVNTIFHGQLLSQVTCISCNYKSNTIEPFWDLSLEFPERYH 480


>AL365205-12|CAI13186.1|  585|Homo sapiens ubiquitin specific
           peptidase 49 protein.
          Length = 585

 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 19/41 (46%), Positives = 26/41 (63%)
 Frame = +1

Query: 70  IISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREH 192
           +++ +F G+LLS V C+ C+  S  IE F DLSL  P R H
Sbjct: 440 VVNTIFHGQLLSQVTCISCNYKSNTIEPFWDLSLEFPERYH 480


>AL365205-11|CAI13187.1|  688|Homo sapiens ubiquitin specific
           peptidase 49 protein.
          Length = 688

 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 19/41 (46%), Positives = 26/41 (63%)
 Frame = +1

Query: 70  IISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREH 192
           +++ +F G+LLS V C+ C+  S  IE F DLSL  P R H
Sbjct: 440 VVNTIFHGQLLSQVTCISCNYKSNTIEPFWDLSLEFPERYH 480


>AJ586139-1|CAE51939.1|  688|Homo sapiens ubiquitin-specific
           proteinase 49 protein.
          Length = 688

 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 19/41 (46%), Positives = 26/41 (63%)
 Frame = +1

Query: 70  IISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREH 192
           +++ +F G+LLS V C+ C+  S  IE F DLSL  P R H
Sbjct: 440 VVNTIFHGQLLSQVTCISCNYKSNTIEPFWDLSLEFPERYH 480


>BX640815-1|CAE45893.1|  453|Homo sapiens hypothetical protein
           protein.
          Length = 453

 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 32/118 (27%), Positives = 46/118 (38%), Gaps = 13/118 (11%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           +L DCL  F   + L       CS C   +   K   +  LP V C HLKRF H      
Sbjct: 289 TLTDCLRRFTRPEHLGSSATIKCSGCHSYQESTKQLTMKKLPIVACFHLKRFEHSAKLRR 348

Query: 492 KVXXXXXXXXTI-WT*RLTRTKSAP------------RXVSRYSLXAVISHMGTVGGG 626
           K+         +  T  +  +K +                ++YSL AV++H GT+  G
Sbjct: 349 KITTYVSFPLELDMTPFMASSKESRMNGQYQQPTDSLNNDNKYSLFAVVNHQGTLESG 406



 Score = 39.5 bits (88), Expect = 0.011
 Identities = 18/37 (48%), Positives = 23/37 (62%)
 Frame = +1

Query: 70  IISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           II  +F G L S V C +C  VST I+ F D+SL +P
Sbjct: 224 IIDQIFTGGLQSDVTCQVCHGVSTTIDPFWDISLDLP 260


>BC126898-1|AAI26899.1|  513|Homo sapiens USP22 protein protein.
          Length = 513

 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 32/118 (27%), Positives = 46/118 (38%), Gaps = 13/118 (11%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           +L DCL  F   + L       CS C   +   K   +  LP V C HLKRF H      
Sbjct: 349 TLTDCLRRFTRPEHLGSSAKIKCSGCHSYQESTKQLTMKKLPIVACFHLKRFEHSAKLRR 408

Query: 492 KVXXXXXXXXTI-WT*RLTRTKSAP------------RXVSRYSLXAVISHMGTVGGG 626
           K+         +  T  +  +K +                ++YSL AV++H GT+  G
Sbjct: 409 KITTYVSFPLELDMTPFMASSKESRMNGQYQQPTDSLNNDNKYSLFAVVNHQGTLESG 466



 Score = 39.5 bits (88), Expect = 0.011
 Identities = 18/37 (48%), Positives = 23/37 (62%)
 Frame = +1

Query: 70  IISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           II  +F G L S V C +C  VST I+ F D+SL +P
Sbjct: 284 IIDQIFTGGLQSDVTCQVCHGVSTTIDPFWDISLDLP 320


>BC110499-1|AAI10500.1|  512|Homo sapiens USP22 protein protein.
          Length = 512

 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 32/118 (27%), Positives = 46/118 (38%), Gaps = 13/118 (11%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           +L DCL  F   + L       CS C   +   K   +  LP V C HLKRF H      
Sbjct: 348 TLTDCLRRFTRPEHLGSSAKIKCSGCHSYQESTKQLTMKKLPIVACFHLKRFEHSAKLRR 407

Query: 492 KVXXXXXXXXTI-WT*RLTRTKSAP------------RXVSRYSLXAVISHMGTVGGG 626
           K+         +  T  +  +K +                ++YSL AV++H GT+  G
Sbjct: 408 KITTYVSFPLELDMTPFMASSKESRMNGQYQQPTDSLNNDNKYSLFAVVNHQGTLESG 465



 Score = 39.5 bits (88), Expect = 0.011
 Identities = 18/37 (48%), Positives = 23/37 (62%)
 Frame = +1

Query: 70  IISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           II  +F G L S V C +C  VST I+ F D+SL +P
Sbjct: 283 IIDQIFTGGLQSDVTCQVCHGVSTTIDPFWDISLDLP 319


>BC025317-1|AAH25317.1|  173|Homo sapiens USP22 protein protein.
          Length = 173

 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 32/118 (27%), Positives = 46/118 (38%), Gaps = 13/118 (11%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           +L DCL  F   + L       CS C   +   K   +  LP V C HLKRF H      
Sbjct: 9   TLTDCLRRFTRPEHLGSSAKIKCSGCHSYQESTKQLTMKKLPIVACFHLKRFEHSAKLRR 68

Query: 492 KVXXXXXXXXTI-WT*RLTRTKSAP------------RXVSRYSLXAVISHMGTVGGG 626
           K+         +  T  +  +K +                ++YSL AV++H GT+  G
Sbjct: 69  KITTYVSFPLELDMTPFMASSKESRMNGQYQQPTDSLNNDNKYSLFAVVNHQGTLESG 126


>BC009452-1|AAH09452.1|  229|Homo sapiens Similar to non-stop
           protein.
          Length = 229

 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 32/118 (27%), Positives = 46/118 (38%), Gaps = 13/118 (11%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           +L DCL  F   + L       CS C   +   K   +  LP V C HLKRF H      
Sbjct: 65  TLTDCLRRFTRPEHLGSSAKIKCSGCHSYQESTKQLTMKKLPIVACFHLKRFEHSAKLRR 124

Query: 492 KVXXXXXXXXTI-WT*RLTRTKSAP------------RXVSRYSLXAVISHMGTVGGG 626
           K+         +  T  +  +K +                ++YSL AV++H GT+  G
Sbjct: 125 KITTYVSFPLELDMTPFMASSKESRMNGQYQQPTDSLNNDNKYSLFAVVNHQGTLESG 182



 Score = 37.9 bits (84), Expect = 0.034
 Identities = 17/36 (47%), Positives = 22/36 (61%)
 Frame = +1

Query: 73  ISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           I  +F G L S V C +C  VST I+ F D+SL +P
Sbjct: 1   IDQIFTGGLQSDVTCQVCHGVSTTIDPFWDISLDLP 36


>BC007196-1|AAH07196.1|  173|Homo sapiens USP22 protein protein.
          Length = 173

 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 32/118 (27%), Positives = 46/118 (38%), Gaps = 13/118 (11%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           +L DCL  F   + L       CS C   +   K   +  LP V C HLKRF H      
Sbjct: 9   TLTDCLRRFTRPEHLGSSAKIKCSGCHSYQESTKQLTMKKLPIVACFHLKRFEHSAKLRR 68

Query: 492 KVXXXXXXXXTI-WT*RLTRTKSAP------------RXVSRYSLXAVISHMGTVGGG 626
           K+         +  T  +  +K +                ++YSL AV++H GT+  G
Sbjct: 69  KITTYVSFPLELDMTPFMASSKESRMNGQYQQPTDSLNNDNKYSLFAVVNHQGTLESG 126


>AL162082-1|CAB82415.1|  264|Homo sapiens hypothetical protein
           protein.
          Length = 264

 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 32/118 (27%), Positives = 46/118 (38%), Gaps = 13/118 (11%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           +L DCL  F   + L       CS C   +   K   +  LP V C HLKRF H      
Sbjct: 100 TLTDCLRRFTRPEHLGSSAKIKCSGCHSYQESTKQLTMKKLPIVACFHLKRFEHSAKLRR 159

Query: 492 KVXXXXXXXXTI-WT*RLTRTKSAP------------RXVSRYSLXAVISHMGTVGGG 626
           K+         +  T  +  +K +                ++YSL AV++H GT+  G
Sbjct: 160 KITTYVSFPLELDMTPFMASSKESRMNGQYQQPTDSLNNDNKYSLFAVVNHQGTLESG 217



 Score = 39.5 bits (88), Expect = 0.011
 Identities = 18/37 (48%), Positives = 23/37 (62%)
 Frame = +1

Query: 70  IISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           II  +F G L S V C +C  VST I+ F D+SL +P
Sbjct: 35  IIDQIFTGGLQSDVTCQVCHGVSTTIDPFWDISLDLP 71


>AB028986-1|BAA83015.1|  593|Homo sapiens KIAA1063 protein protein.
          Length = 593

 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 32/118 (27%), Positives = 46/118 (38%), Gaps = 13/118 (11%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           +L DCL  F   + L       CS C   +   K   +  LP V C HLKRF H      
Sbjct: 429 TLTDCLRRFTRPEHLGSSAKIKCSGCHSYQESTKQLTMKKLPIVACFHLKRFEHSAKLRR 488

Query: 492 KVXXXXXXXXTI-WT*RLTRTKSAP------------RXVSRYSLXAVISHMGTVGGG 626
           K+         +  T  +  +K +                ++YSL AV++H GT+  G
Sbjct: 489 KITTYVSFPLELDMTPFMASSKESRMNGQYQQPTDSLNNDNKYSLFAVVNHQGTLESG 546



 Score = 39.5 bits (88), Expect = 0.011
 Identities = 18/37 (48%), Positives = 23/37 (62%)
 Frame = +1

Query: 70  IISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           II  +F G L S V C +C  VST I+ F D+SL +P
Sbjct: 364 IIDQIFTGGLQSDVTCQVCHGVSTTIDPFWDISLDLP 400


>Y13619-1|CAA73941.1| 2070|Homo sapiens DFFRY protein.
          Length = 2070

 Score = 43.6 bits (98), Expect = 7e-04
 Identities = 22/55 (40%), Positives = 30/55 (54%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
            +L D L  +   D L+G N Y C +C K  + VK   I  LP VL + LKRF ++
Sbjct: 1751 NLLDSLEQYIKGDLLEGANAYHCEKCDKKVDTVKRLLIKKLPRVLAIQLKRFDYD 1805


>Y13618-1|CAA73940.1| 2555|Homo sapiens DFFRY protein.
          Length = 2555

 Score = 43.6 bits (98), Expect = 7e-04
 Identities = 22/55 (40%), Positives = 30/55 (54%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
            +L D L  +   D L+G N Y C +C K  + VK   I  LP VL + LKRF ++
Sbjct: 1751 NLLDSLEQYIKGDLLEGANAYHCEKCDKKVDTVKRLLIKKLPRVLAIQLKRFDYD 1805


>X98296-1|CAA66942.1| 2547|Homo sapiens ubiquitin hydrolase protein.
          Length = 2547

 Score = 43.6 bits (98), Expect = 7e-04
 Identities = 22/55 (40%), Positives = 30/55 (54%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
            +L D L  +   D L+G N Y C +C K  + VK   I  LP VL + LKRF ++
Sbjct: 1742 NLLDSLEQYVKGDLLEGANAYHCEKCNKKVDTVKRLLIKKLPPVLAIQLKRFDYD 1796


>BC063645-1|AAH63645.1|  918|Homo sapiens USP9X protein protein.
          Length = 918

 Score = 43.6 bits (98), Expect = 7e-04
 Identities = 22/55 (40%), Positives = 30/55 (54%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
           +L D L  +   D L+G N Y C +C K  + VK   I  LP VL + LKRF ++
Sbjct: 113 NLLDSLEQYVKGDLLEGANAYHCEKCNKKVDTVKRLLIKKLPPVLAIQLKRFDYD 167


>AL391259-2|CAD13527.2| 2547|Homo sapiens ubiquitin specific peptidase
            9, X-linked protein.
          Length = 2547

 Score = 43.6 bits (98), Expect = 7e-04
 Identities = 22/55 (40%), Positives = 30/55 (54%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
            +L D L  +   D L+G N Y C +C K  + VK   I  LP VL + LKRF ++
Sbjct: 1742 NLLDSLEQYVKGDLLEGANAYHCEKCNKKVDTVKRLLIKKLPPVLAIQLKRFDYD 1796


>AL109797-1|CAD18900.2| 2547|Homo sapiens ubiquitin specific peptidase
            9, X-linked protein.
          Length = 2547

 Score = 43.6 bits (98), Expect = 7e-04
 Identities = 22/55 (40%), Positives = 30/55 (54%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
            +L D L  +   D L+G N Y C +C K  + VK   I  LP VL + LKRF ++
Sbjct: 1742 NLLDSLEQYVKGDLLEGANAYHCEKCNKKVDTVKRLLIKKLPPVLAIQLKRFDYD 1796


>AF233442-1|AAF61308.1|  381|Homo sapiens NEDD8-specific protease
           protein.
          Length = 381

 Score = 43.6 bits (98), Expect = 7e-04
 Identities = 20/58 (34%), Positives = 29/58 (50%)
 Frame = +3

Query: 294 FYGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           F G  V L+DC   F   +EL+ +N   C RC++     K   +   P +L +HL RF
Sbjct: 225 FAGGKVFLRDCFNLFTKEEELESENAPVCDRCRQKTRSTKKLTVQRFPRILVLHLNRF 282



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 20/40 (50%), Positives = 25/40 (62%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           S I D+F G+L S ++C  C   ST  E F DLSLPIP +
Sbjct: 184 SKIVDLFVGQLKSCLKCQACGYRSTTFEVFCDLSLPIPKK 223


>AF000986-1|AAC51833.1| 2555|Homo sapiens ubiquitin specific protease
            9 protein.
          Length = 2555

 Score = 43.6 bits (98), Expect = 7e-04
 Identities = 22/55 (40%), Positives = 30/55 (54%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
            +L D L  +   D L+G N Y C +C K  + VK   I  LP VL + LKRF ++
Sbjct: 1751 NLLDSLEQYIKGDLLEGANAYHCEKCDKKVDTVKRLLIKKLPRVLAIQLKRFDYD 1805


>AB209666-1|BAD92903.1|  867|Homo sapiens USP9X protein variant
           protein.
          Length = 867

 Score = 43.6 bits (98), Expect = 7e-04
 Identities = 22/55 (40%), Positives = 30/55 (54%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
           +L D L  +   D L+G N Y C +C K  + VK   I  LP VL + LKRF ++
Sbjct: 62  NLLDSLEQYVKGDLLEGANAYHCEKCNKKVDTVKRLLIKKLPPVLAIQLKRFDYD 116


>CT841507-1|CAJ86437.1|  372|Homo sapiens Em:AC008079.1 protein.
          Length = 372

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 29/113 (25%), Positives = 48/113 (42%), Gaps = 5/113 (4%)
 Frame = +3

Query: 303 PVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELL 482
           P+ +L+D L  FF   EL   +   C  C K   G ++  +  LP  L +HL RF     
Sbjct: 205 PLKTLEDALHCFFQPRELSSKSKCFCENCGKKTRGKQVLKLTHLPQTLTIHLMRFSIRNS 264

Query: 483 FSAKVXXXXXXXXTIWT*RLTRTK-----SAPRXVSRYSLXAVISHMGTVGGG 626
            + K+        ++   ++   K     +  +   +Y L AVI+H+G    G
Sbjct: 265 QTRKICHSLYFPQSLDFSQILPMKRESCDAEEQSGGQYELFAVIAHVGMADSG 317


>CR457216-1|CAG33497.1|  372|Homo sapiens USP18 protein.
          Length = 372

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 29/113 (25%), Positives = 48/113 (42%), Gaps = 5/113 (4%)
 Frame = +3

Query: 303 PVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELL 482
           P+ +L+D L  FF   EL   +   C  C K   G ++  +  LP  L +HL RF     
Sbjct: 205 PLKTLEDALHCFFQPRELSSKSKCFCENCGKKTRGKQVLKLTHLPQTLTIHLMRFSIRNS 264

Query: 483 FSAKVXXXXXXXXTIWT*RLTRTK-----SAPRXVSRYSLXAVISHMGTVGGG 626
            + K+        ++   ++   K     +  +   +Y L AVI+H+G    G
Sbjct: 265 QTRKICHSLYFPQSLDFSQILPMKRESCDAEEQSGGQYELFAVIAHVGMADSG 317


>BT006835-1|AAP35481.1|  372|Homo sapiens ubiquitin specific
           protease 18 protein.
          Length = 372

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 29/113 (25%), Positives = 48/113 (42%), Gaps = 5/113 (4%)
 Frame = +3

Query: 303 PVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELL 482
           P+ +L+D L  FF   EL   +   C  C K   G ++  +  LP  L +HL RF     
Sbjct: 205 PLKTLEDALHCFFQPRELSSKSKCFCENCGKKTRGKQVLKLTHLPQTLTIHLMRFSIRNS 264

Query: 483 FSAKVXXXXXXXXTIWT*RLTRTK-----SAPRXVSRYSLXAVISHMGTVGGG 626
            + K+        ++   ++   K     +  +   +Y L AVI+H+G    G
Sbjct: 265 QTRKICHSLYFPQSLDFSQILPMKRESCDAEEQSGGQYELFAVIAHVGMADSG 317


>BC014896-1|AAH14896.1|  372|Homo sapiens ubiquitin specific
           peptidase 18 protein.
          Length = 372

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 29/113 (25%), Positives = 48/113 (42%), Gaps = 5/113 (4%)
 Frame = +3

Query: 303 PVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELL 482
           P+ +L+D L  FF   EL   +   C  C K   G ++  +  LP  L +HL RF     
Sbjct: 205 PLKTLEDALHCFFQPRELSSKSKCFCENCGKKTRGKQVLKLTHLPQTLTIHLMRFSIRNS 264

Query: 483 FSAKVXXXXXXXXTIWT*RLTRTK-----SAPRXVSRYSLXAVISHMGTVGGG 626
            + K+        ++   ++   K     +  +   +Y L AVI+H+G    G
Sbjct: 265 QTRKICHSLYFPQSLDFSQILPMKRESCDAEEQSGGQYELFAVIAHVGMADSG 317


>AJ586979-1|CAE52971.1|  306|Homo sapiens ubiquitin-specific
           protease 41 protein.
          Length = 306

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 29/113 (25%), Positives = 48/113 (42%), Gaps = 5/113 (4%)
 Frame = +3

Query: 303 PVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELL 482
           P+ +L+D L  FF   EL   +   C  C K   G ++  +  LP  L +HL RF     
Sbjct: 153 PLKTLEDALHCFFQPRELSSKSKCFCENCGKKTRGKQVLKLTHLPQTLTIHLMRFSIRNS 212

Query: 483 FSAKVXXXXXXXXTIWT*RLTRTK-----SAPRXVSRYSLXAVISHMGTVGGG 626
            + K+        ++   ++   K     +  +   +Y L AVI+H+G    G
Sbjct: 213 QTRKICHSLYFPQSLDFSQILPMKRESCDAEEQSGGQYELFAVIAHVGMADSG 265


>AJ583822-1|CAE47749.1|  327|Homo sapiens ubiquitin specific
           proteinase 41 protein.
          Length = 327

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 29/113 (25%), Positives = 48/113 (42%), Gaps = 5/113 (4%)
 Frame = +3

Query: 303 PVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELL 482
           P+ +L+D L  FF   EL   +   C  C K   G ++  +  LP  L +HL RF     
Sbjct: 174 PLKTLEDALHCFFQPRELSSKSKCFCENCGKKTRGKQVLKLTHLPQTLTIHLMRFSIRNS 233

Query: 483 FSAKVXXXXXXXXTIWT*RLTRTK-----SAPRXVSRYSLXAVISHMGTVGGG 626
            + K+        ++   ++   K     +  +   +Y L AVI+H+G    G
Sbjct: 234 QTRKICHSLYFPQSLDFSQILPMKRESCDAEEQSGGQYELFAVIAHVGMADSG 286


>AJ243526-1|CAB76398.1|  372|Homo sapiens putative deubiquitinazing
           enzyme protein.
          Length = 372

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 29/113 (25%), Positives = 48/113 (42%), Gaps = 5/113 (4%)
 Frame = +3

Query: 303 PVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELL 482
           P+ +L+D L  FF   EL   +   C  C K   G ++  +  LP  L +HL RF     
Sbjct: 205 PLKTLEDALHCFFQPRELSSKSKCFCENCGKKTRGKQVLKLTHLPQTLTIHLMRFSIRNS 264

Query: 483 FSAKVXXXXXXXXTIWT*RLTRTK-----SAPRXVSRYSLXAVISHMGTVGGG 626
            + K+        ++   ++   K     +  +   +Y L AVI+H+G    G
Sbjct: 265 QTRKICHSLYFPQSLDFSQILPMKRESCDAEEQSGGQYELFAVIAHVGMADSG 317


>AF176642-1|AAD49967.1|  372|Homo sapiens ubiquitin-specific
           protease ISG43 protein.
          Length = 372

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 29/113 (25%), Positives = 48/113 (42%), Gaps = 5/113 (4%)
 Frame = +3

Query: 303 PVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELL 482
           P+ +L+D L  FF   EL   +   C  C K   G ++  +  LP  L +HL RF     
Sbjct: 205 PLKTLEDALHCFFQPRELSSKSKCFCENCGKKTRGKQVLKLTHLPQTLTIHLMRFSIRNS 264

Query: 483 FSAKVXXXXXXXXTIWT*RLTRTK-----SAPRXVSRYSLXAVISHMGTVGGG 626
            + K+        ++   ++   K     +  +   +Y L AVI+H+G    G
Sbjct: 265 QTRKICHSLYFPQSLDFSQILPMKRESCDAEEQSGGQYELFAVIAHVGMADSG 317


>AK022614-1|BAB14133.1|  366|Homo sapiens protein ( Homo sapiens
           cDNA FLJ12552 fis, clone NT2RM4000712, moderately
           similar to Homo sapiens ubiquitin hydrolyzing enzyme I
           (UBH1) mRNA. ).
          Length = 366

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 31/104 (29%), Positives = 46/104 (44%), Gaps = 3/104 (2%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH--ELLF 485
           S+  CL  F + + L  +  Y C  C   +   K   +  LP VL +HLKRF++  +L  
Sbjct: 207 SITHCLRDFSNTETLCSEQKYYCETCCSKQEAQKRMRVKKLPMVLALHLKRFKYMEQLRR 266

Query: 486 SAKVXXXXXXXXTIWT*RLTRTKSAPRXVSR-YSLXAVISHMGT 614
             K+         +   RL  T S    + R Y L AV+ H G+
Sbjct: 267 YTKLSYRVVFPLEL---RLFNTSSDAVNLDRMYDLVAVVVHCGS 307



 Score = 35.1 bits (77), Expect = 0.24
 Identities = 15/52 (28%), Positives = 30/52 (57%)
 Frame = +1

Query: 73  ISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRCQQPMLN 228
           + ++F G L +  +CL C+ VS++ E F DLS+ +   ++ ++  C +   N
Sbjct: 168 VHEIFQGTLTNETRCLNCETVSSKDEDFLDLSVDV--EQNTSITHCLRDFSN 217


>AK055188-1|BAB70869.1|  314|Homo sapiens protein ( Homo sapiens
           cDNA FLJ30626 fis, clone CTONG2001911, weakly similar to
           UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 4 (EC 3.1.2.15).
           ).
          Length = 314

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 16/52 (30%), Positives = 29/52 (55%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           +L +C   +   ++L  D+ + C  C+ L+ G+    +  LP +L +HLKRF
Sbjct: 230 TLDECFQFYTKEEQLAQDDAWKCPHCQVLQQGMVKLSLWTLPDILIIHLKRF 281


>AJ583817-1|CAE47744.2| 1124|Homo sapiens ubiquitin specific
           proteinase 43 protein.
          Length = 1124

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 16/52 (30%), Positives = 29/52 (55%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           +L +C   +   ++L  D+ + C  C+ L+ G+    +  LP +L +HLKRF
Sbjct: 542 TLDECFQFYTKEEQLAQDDAWKCPHCQVLQQGMVKLSLWTLPDILIIHLKRF 593


>BC037574-1|AAH37574.1|  366|Homo sapiens ubiquitin specific
           peptidase 46 protein.
          Length = 366

 Score = 41.5 bits (93), Expect = 0.003
 Identities = 30/104 (28%), Positives = 46/104 (44%), Gaps = 3/104 (2%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH--ELLF 485
           S+  CL  F + + L  +  Y C  C   +   K   +  LP +L +HLKRF++  +L  
Sbjct: 207 SITHCLRDFSNTETLCSEQKYYCETCCSKQEAQKRMRVKKLPMILALHLKRFKYMEQLHR 266

Query: 486 SAKVXXXXXXXXTIWT*RLTRTKSAPRXVSR-YSLXAVISHMGT 614
             K+         +   RL  T S    + R Y L AV+ H G+
Sbjct: 267 YTKLSYRVVFPLEL---RLFNTSSDAVNLDRMYDLVAVVVHCGS 307



 Score = 35.1 bits (77), Expect = 0.24
 Identities = 15/52 (28%), Positives = 30/52 (57%)
 Frame = +1

Query: 73  ISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRCQQPMLN 228
           + ++F G L +  +CL C+ VS++ E F DLS+ +   ++ ++  C +   N
Sbjct: 168 VHEIFQGTLTNETRCLNCETVSSKDEDFLDLSVDV--EQNTSITHCLRDFSN 217


>BC026072-1|AAH26072.1|  370|Homo sapiens ubiquitin specific
           peptidase 12 protein.
          Length = 370

 Score = 41.5 bits (93), Expect = 0.003
 Identities = 29/104 (27%), Positives = 45/104 (43%), Gaps = 3/104 (2%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH--ELLF 485
           S+  CL  F + + L  +  Y C  C+  +   K   +  LP +L +HLKRF++  +L  
Sbjct: 211 SITHCLRGFSNTETLCSEYKYYCEECRSKQEAHKRMKVKKLPMILALHLKRFKYMDQLHR 270

Query: 486 SAKVXXXXXXXXTIWT*RLTRTKSAPRXVSR-YSLXAVISHMGT 614
             K+         +   RL  T        R Y L AV+ H G+
Sbjct: 271 YTKLSYRVVFPLEL---RLFNTSGDATNPDRMYDLVAVVVHCGS 311



 Score = 35.5 bits (78), Expect = 0.18
 Identities = 14/52 (26%), Positives = 30/52 (57%)
 Frame = +1

Query: 73  ISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRCQQPMLN 228
           + ++F G L +  +CL C+ +S++ E F DLS+ +   ++ ++  C +   N
Sbjct: 172 VDEIFQGTLTNETRCLTCETISSKDEDFLDLSVDV--EQNTSITHCLRGFSN 221


>AL355473-1|CAI16331.1|  370|Homo sapiens ubiquitin specific
           protease 12 like 1 protein.
          Length = 370

 Score = 41.5 bits (93), Expect = 0.003
 Identities = 29/104 (27%), Positives = 45/104 (43%), Gaps = 3/104 (2%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH--ELLF 485
           S+  CL  F + + L  +  Y C  C+  +   K   +  LP +L +HLKRF++  +L  
Sbjct: 211 SITHCLRGFSNTETLCSEYKYYCEECRSKQEAHKRMKVKKLPMILALHLKRFKYMDQLHR 270

Query: 486 SAKVXXXXXXXXTIWT*RLTRTKSAPRXVSR-YSLXAVISHMGT 614
             K+         +   RL  T        R Y L AV+ H G+
Sbjct: 271 YTKLSYRVVFPLEL---RLFNTSGDATNPDRMYDLVAVVVHCGS 311



 Score = 35.1 bits (77), Expect = 0.24
 Identities = 14/52 (26%), Positives = 30/52 (57%)
 Frame = +1

Query: 73  ISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRCQQPMLN 228
           + ++F G L +  +CL C+ +S++ E F DLS+ +   ++ ++  C +   N
Sbjct: 172 VHEIFQGTLTNETRCLTCETISSKDEDFLDLSVDV--EQNTSITHCLRGFSN 221


>AL158062-1|CAH70555.1|  370|Homo sapiens ubiquitin specific
           protease 12 like 1 protein.
          Length = 370

 Score = 41.5 bits (93), Expect = 0.003
 Identities = 29/104 (27%), Positives = 45/104 (43%), Gaps = 3/104 (2%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH--ELLF 485
           S+  CL  F + + L  +  Y C  C+  +   K   +  LP +L +HLKRF++  +L  
Sbjct: 211 SITHCLRGFSNTETLCSEYKYYCEECRSKQEAHKRMKVKKLPMILALHLKRFKYMDQLHR 270

Query: 486 SAKVXXXXXXXXTIWT*RLTRTKSAPRXVSR-YSLXAVISHMGT 614
             K+         +   RL  T        R Y L AV+ H G+
Sbjct: 271 YTKLSYRVVFPLEL---RLFNTSGDATNPDRMYDLVAVVVHCGS 311



 Score = 35.1 bits (77), Expect = 0.24
 Identities = 14/52 (26%), Positives = 30/52 (57%)
 Frame = +1

Query: 73  ISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRCQQPMLN 228
           + ++F G L +  +CL C+ +S++ E F DLS+ +   ++ ++  C +   N
Sbjct: 172 VHEIFQGTLTNETRCLTCETISSKDEDFLDLSVDV--EQNTSITHCLRGFSN 221


>AK024318-1|BAB14881.1|  366|Homo sapiens protein ( Homo sapiens
           cDNA FLJ14256 fis, clone PLACE1000007, weakly similar to
           PROBABLE UBIQUITIN CARBOXYL-TERMINAL HYDROLASE R10E11.3
           (EC ).
          Length = 366

 Score = 41.5 bits (93), Expect = 0.003
 Identities = 30/104 (28%), Positives = 46/104 (44%), Gaps = 3/104 (2%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH--ELLF 485
           S+  CL  F + + L  +  Y C  C   +   K   +  LP +L +HLKRF++  +L  
Sbjct: 207 SITHCLRDFSNTETLCSEQKYYCETCCSKQEAQKRMRVKKLPMILALHLKRFKYMEQLHR 266

Query: 486 SAKVXXXXXXXXTIWT*RLTRTKSAPRXVSR-YSLXAVISHMGT 614
             K+         +   RL  T S    + R Y L AV+ H G+
Sbjct: 267 YTKLSYRVVFPLEL---RLFNTSSDAVNLDRMYDLVAVVVHCGS 307



 Score = 35.1 bits (77), Expect = 0.24
 Identities = 15/52 (28%), Positives = 30/52 (57%)
 Frame = +1

Query: 73  ISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRCQQPMLN 228
           + ++F G L +  +CL C+ VS++ E F DLS+ +   ++ ++  C +   N
Sbjct: 168 VHEIFQGTLTNETRCLNCETVSSKDEDFLDLSVDV--EQNTSITHCLRDFSN 217


>AF022789-1|AAC23551.1|  355|Homo sapiens ubiquitin hydrolyzing
           enzyme I protein.
          Length = 355

 Score = 41.5 bits (93), Expect = 0.003
 Identities = 29/104 (27%), Positives = 45/104 (43%), Gaps = 3/104 (2%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH--ELLF 485
           S+  CL  F + + L  +  Y C  C+  +   K   +  LP +L +HLKRF++  +L  
Sbjct: 196 SITHCLRGFSNTETLCSEYKYYCEECRSKQEAHKRMKVKKLPMILALHLKRFKYMDQLHR 255

Query: 486 SAKVXXXXXXXXTIWT*RLTRTKSAPRXVSR-YSLXAVISHMGT 614
             K+         +   RL  T        R Y L AV+ H G+
Sbjct: 256 YTKLSYRVVFPLEL---RLFNTSGDATNPDRMYDLVAVVVHCGS 296



 Score = 35.1 bits (77), Expect = 0.24
 Identities = 14/52 (26%), Positives = 30/52 (57%)
 Frame = +1

Query: 73  ISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRCQQPMLN 228
           + ++F G L +  +CL C+ +S++ E F DLS+ +   ++ ++  C +   N
Sbjct: 157 VHEIFQGTLTNETRCLTCETISSKDEDFLDLSVDV--EQNTSITHCLRGFSN 206


>BC100029-1|AAI00030.1|  393|Homo sapiens USP3 protein protein.
          Length = 393

 Score = 40.7 bits (91), Expect = 0.005
 Identities = 16/32 (50%), Positives = 21/32 (65%)
 Frame = +3

Query: 300 GPVVSLQDCLAAFFSADELKGDNMYSCSRCKK 395
           GPV SL+DCL +F   +EL    +Y C +CKK
Sbjct: 359 GPVCSLRDCLRSFTDLEELDETELYMCHKCKK 390



 Score = 39.5 bits (88), Expect = 0.011
 Identities = 17/40 (42%), Positives = 26/40 (65%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
           ++++ +F G L + V CLIC   S + + F DLSL IPS+
Sbjct: 308 TVVTAIFGGILQNEVNCLICGTESRKFDPFLDLSLDIPSQ 347


>AL157417-1|CAB75649.1|  268|Homo sapiens hypothetical protein
           protein.
          Length = 268

 Score = 40.7 bits (91), Expect = 0.005
 Identities = 20/38 (52%), Positives = 24/38 (63%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           S I D+F G+L S ++C  C   ST  E F DLSLPIP
Sbjct: 178 SKIVDLFVGQLKSCLKCQACGYRSTTFEVFCDLSLPIP 215


>AK027362-1|BAB55063.1| 1287|Homo sapiens protein ( Homo sapiens
           cDNA FLJ14456 fis, clone HEMBB1001915, moderately
           similar to UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 64E (EC
           3.1.2.15). ).
          Length = 1287

 Score = 40.3 bits (90), Expect = 0.006
 Identities = 20/52 (38%), Positives = 28/52 (53%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           S+++ L AF   + L G N Y C RCKK  +  K    +  P +L + LKRF
Sbjct: 254 SVEEALHAFIQPEILDGPNQYFCERCKKKCDARKGLRFLHFPYLLTLQLKRF 305



 Score = 32.3 bits (70), Expect = 1.7
 Identities = 14/36 (38%), Positives = 23/36 (63%)
 Frame = +1

Query: 70  IISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           +I++++ GKL   V+CL C     RI+T+ D+ L I
Sbjct: 208 LINELYQGKLKDYVRCLECGYEGWRIDTYLDIPLVI 243


>BC068975-1|AAH68975.1| 1042|Homo sapiens ubiquitin specific
           peptidase 38 protein.
          Length = 1042

 Score = 39.9 bits (89), Expect = 0.008
 Identities = 20/55 (36%), Positives = 27/55 (49%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
           S+ D L  F + + L GDN Y C  C  L+N  K   I   P  L + L RF ++
Sbjct: 717 SVTDLLNYFLAPEILTGDNQYYCENCASLQNAEKTMQITEEPEYLILTLLRFSYD 771



 Score = 39.1 bits (87), Expect = 0.015
 Identities = 18/52 (34%), Positives = 28/52 (53%)
 Frame = +1

Query: 64  RSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRCQQP 219
           +++I  +F GKL + ++CL C   S ++E F DLSL       L  +  Q P
Sbjct: 583 KTLIEKMFGGKLRTHIRCLNCRSTSQKVEAFTDLSLAFCPSSSLENMSVQDP 634


>BC039115-1|AAH39115.1| 1004|Homo sapiens USP38 protein protein.
          Length = 1004

 Score = 39.9 bits (89), Expect = 0.008
 Identities = 20/55 (36%), Positives = 27/55 (49%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
           S+ D L  F + + L GDN Y C  C  L+N  K   I   P  L + L RF ++
Sbjct: 717 SVTDLLNYFLAPEILTGDNQYYCENCASLQNAEKTMQITEEPEYLILTLLRFSYD 771



 Score = 39.1 bits (87), Expect = 0.015
 Identities = 18/52 (34%), Positives = 28/52 (53%)
 Frame = +1

Query: 64  RSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRCQQP 219
           +++I  +F GKL + ++CL C   S ++E F DLSL       L  +  Q P
Sbjct: 583 KTLIEKMFGGKLRTHIRCLNCRSTSQKVEAFTDLSLAFCPSSSLENMSVQDP 634


>AK091712-1|BAC03730.1|  422|Homo sapiens protein ( Homo sapiens
           cDNA FLJ34393 fis, clone HCHON2000271. ).
          Length = 422

 Score = 39.9 bits (89), Expect = 0.008
 Identities = 20/55 (36%), Positives = 27/55 (49%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
           S+ D L  F + + L GDN Y C  C  L+N  K   I   P  L + L RF ++
Sbjct: 129 SVTDLLNYFLAPEILTGDNQYYCENCASLQNAEKTMQITEEPEYLILTLLRFSYD 183



 Score = 35.9 bits (79), Expect = 0.14
 Identities = 17/46 (36%), Positives = 24/46 (52%)
 Frame = +1

Query: 82  VFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRCQQP 219
           +F GKL + ++CL C   S ++E F DLSL       L  +  Q P
Sbjct: 1   MFGGKLRTHIRCLNCRSTSQKVEAFTDLSLAFCPSSSLENMSVQDP 46


>AK057992-1|BAB71627.1|  706|Homo sapiens protein ( Homo sapiens
           cDNA FLJ25263 fis, clone STM05053. ).
          Length = 706

 Score = 39.9 bits (89), Expect = 0.008
 Identities = 20/55 (36%), Positives = 27/55 (49%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
           S+ D L  F + + L GDN Y C  C  L+N  K   I   P  L + L RF ++
Sbjct: 381 SVTDLLNYFLAPEILTGDNQYYCENCASLQNAEKTMQITEEPEYLILTLLRFSYD 435



 Score = 38.7 bits (86), Expect = 0.020
 Identities = 18/52 (34%), Positives = 28/52 (53%)
 Frame = +1

Query: 64  RSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRCQQP 219
           +++I  +F GKL + ++CL C   S ++E F DLSL       L  +  Q P
Sbjct: 247 KTLIEKMFGGKLRTHIRCLNCRSTSQKVEAFTDLSLAFCPSSSLENVSVQDP 298


>AF211481-1|AAK26248.1|  397|Homo sapiens HP43.8KD protein.
          Length = 397

 Score = 39.9 bits (89), Expect = 0.008
 Identities = 20/55 (36%), Positives = 27/55 (49%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
           S+ D L  F + + L GDN Y C  C  L+N  K   I   P  L + L RF ++
Sbjct: 72  SVTDLLNYFLAPEILTGDNQYYCENCASLQNAEKTMQITEEPEYLILTLLRFSYD 126


>AB067478-1|BAB67784.1|  780|Homo sapiens KIAA1891 protein protein.
          Length = 780

 Score = 39.9 bits (89), Expect = 0.008
 Identities = 20/55 (36%), Positives = 27/55 (49%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
           S+ D L  F + + L GDN Y C  C  L+N  K   I   P  L + L RF ++
Sbjct: 455 SVTDLLNYFLAPEILTGDNQYYCENCASLQNAEKTMQITEEPEYLILTLLRFSYD 509



 Score = 39.1 bits (87), Expect = 0.015
 Identities = 18/52 (34%), Positives = 28/52 (53%)
 Frame = +1

Query: 64  RSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRCQQP 219
           +++I  +F GKL + ++CL C   S ++E F DLSL       L  +  Q P
Sbjct: 321 KTLIEKMFGGKLRTHIRCLNCRSTSQKVEAFTDLSLAFCPSSSLENMSVQDP 372


>BC132862-1|AAI32863.1| 1316|Homo sapiens ubiquitin specific
           peptidase 42 protein.
          Length = 1316

 Score = 38.7 bits (86), Expect = 0.020
 Identities = 20/52 (38%), Positives = 27/52 (51%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           S+   L  F   ++L G+N Y CS+CKK+    K   I     VL + LKRF
Sbjct: 269 SVNKALEQFVKPEQLDGENSYKCSKCKKMVPASKRFTIHRSSNVLTLSLKRF 320


>BC131489-1|AAI31490.1|  604|Homo sapiens USP35 protein protein.
          Length = 604

 Score = 38.7 bits (86), Expect = 0.020
 Identities = 17/39 (43%), Positives = 24/39 (61%)
 Frame = +1

Query: 73  ISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSRE 189
           +  +F GK+++ + CL C  VS+R E F DLSL  P  E
Sbjct: 152 VEKMFGGKIVTRICCLCCLNVSSREEAFTDLSLAFPPPE 190


>BC060846-1|AAH60846.2| 1202|Homo sapiens USP42 protein protein.
          Length = 1202

 Score = 38.7 bits (86), Expect = 0.020
 Identities = 20/52 (38%), Positives = 27/52 (51%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           S+   L  F   ++L G+N Y CS+CKK+    K   I     VL + LKRF
Sbjct: 269 SVNKALEQFVKPEQLDGENSYKCSKCKKMVPASKRFTIHRSSNVLTLSLKRF 320


>AY618868-1|AAT67238.1| 1324|Homo sapiens ubiquitin specific
           protease 42 protein.
          Length = 1324

 Score = 38.7 bits (86), Expect = 0.020
 Identities = 20/52 (38%), Positives = 27/52 (51%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           S+   L  F   ++L G+N Y CS+CKK+    K   I     VL + LKRF
Sbjct: 269 SVNKALEQFVKPEQLDGENSYKCSKCKKMVPASKRFTIHRSSNVLTLSLKRF 320


>AK022759-1|BAB14232.1| 1198|Homo sapiens protein ( Homo sapiens
           cDNA FLJ12697 fis, clone NT2RP1000522, weakly similar to
           UBIQUITIN CARBOXYL-TERMINAL HYDROLASE DUB-1 (EC
           3.1.2.15). ).
          Length = 1198

 Score = 38.7 bits (86), Expect = 0.020
 Identities = 20/52 (38%), Positives = 27/52 (51%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           S+   L  F   ++L G+N Y CS+CKK+    K   I     VL + LKRF
Sbjct: 269 SVNKALEQFVKPEQLDGENSYKCSKCKKMVPASKRFTIHRSSNVLTLSLKRF 320


>AJ601395-1|CAE53097.1| 1325|Homo sapiens ubiquitin-specific
           protease 42 protein.
          Length = 1325

 Score = 38.7 bits (86), Expect = 0.020
 Identities = 20/52 (38%), Positives = 27/52 (51%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           S+   L  F   ++L G+N Y CS+CKK+    K   I     VL + LKRF
Sbjct: 269 SVNKALEQFVKPEQLDGENSYKCSKCKKMVPASKRFTIHRSSNVLTLSLKRF 320


>AJ586137-1|CAE51937.1| 1017|Homo sapiens ubiquitin-specific
           proteinase 35 protein.
          Length = 1017

 Score = 38.7 bits (86), Expect = 0.020
 Identities = 17/39 (43%), Positives = 24/39 (61%)
 Frame = +1

Query: 73  ISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSRE 189
           +  +F GK+++ + CL C  VS+R E F DLSL  P  E
Sbjct: 565 VEKMFGGKIVTRICCLCCLNVSSREEAFTDLSLAFPPPE 603


>AB037793-1|BAA92610.1|  773|Homo sapiens KIAA1372 protein protein.
          Length = 773

 Score = 38.7 bits (86), Expect = 0.020
 Identities = 17/39 (43%), Positives = 24/39 (61%)
 Frame = +1

Query: 73  ISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSRE 189
           +  +F GK+++ + CL C  VS+R E F DLSL  P  E
Sbjct: 321 VEKMFGGKIVTRICCLCCLNVSSREEAFTDLSLAFPPPE 359


>BC050525-1|AAH50525.1|  785|Homo sapiens ubiquitin specific
           peptidase 1 protein.
          Length = 785

 Score = 37.5 bits (83), Expect = 0.045
 Identities = 14/40 (35%), Positives = 26/40 (65%)
 Frame = +1

Query: 70  IISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSRE 189
           ++  +F G+L+   +CL C+ ++ R E FQD+S+P+   E
Sbjct: 425 LVEKLFQGQLVLRTRCLECESLTERREDFQDISVPVQEDE 464


>AF117386-1|AAD11441.1|  785|Homo sapiens ubiquitin-specific
           protease protein.
          Length = 785

 Score = 37.5 bits (83), Expect = 0.045
 Identities = 14/40 (35%), Positives = 26/40 (65%)
 Frame = +1

Query: 70  IISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSRE 189
           ++  +F G+L+   +CL C+ ++ R E FQD+S+P+   E
Sbjct: 425 LVEKLFQGQLVLRTRCLECESLTERREDFQDISVPVQEDE 464


>AB208893-1|BAD92130.1|  586|Homo sapiens ubiquitin specific
           protease 1 variant protein.
          Length = 586

 Score = 37.5 bits (83), Expect = 0.045
 Identities = 14/40 (35%), Positives = 26/40 (65%)
 Frame = +1

Query: 70  IISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSRE 189
           ++  +F G+L+   +CL C+ ++ R E FQD+S+P+   E
Sbjct: 226 LVEKLFQGQLVLRTRCLECESLTERREDFQDISVPVQEDE 265


>AB014458-1|BAA34703.1|  785|Homo sapiens ubiquitin specific
           protease protein.
          Length = 785

 Score = 37.5 bits (83), Expect = 0.045
 Identities = 14/40 (35%), Positives = 26/40 (65%)
 Frame = +1

Query: 70  IISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSRE 189
           ++  +F G+L+   +CL C+ ++ R E FQD+S+P+   E
Sbjct: 425 LVEKLFQGQLVLRTRCLECESLTERREDFQDISVPVQEDE 464


>BC146752-1|AAI46753.1| 1318|Homo sapiens ubiquitin specific peptidase
            19 protein.
          Length = 1318

 Score = 37.1 bits (82), Expect = 0.060
 Identities = 29/106 (27%), Positives = 42/106 (39%), Gaps = 1/106 (0%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR-HELLFS 488
            +L  CL  F   + L  +  + C +CK+ R   K   +  LP VL V LKRF     ++ 
Sbjct: 1059 TLDQCLNLFTRPEVLAPEEAWYCPQCKQHREASKQLLLWRLPNVLIVQLKRFSFRSFIWR 1118

Query: 489  AKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
             K+                        +  Y L AVI+H G + GG
Sbjct: 1119 DKINDLVEFPVRNLDLSKFCIGQKEEQLPSYDLYAVINHYGGMIGG 1164



 Score = 33.9 bits (74), Expect = 0.56
 Identities = 14/41 (34%), Positives = 24/41 (58%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSRE 189
           S I D+F G+  S + C +C +VS   + F  L +P+P ++
Sbjct: 640 SFIVDLFQGQYKSKLVCPVCAKVSITFDPFLYLPVPLPQKQ 680


>BC142727-1|AAI42728.1| 1449|Homo sapiens USP19 protein protein.
          Length = 1449

 Score = 37.1 bits (82), Expect = 0.060
 Identities = 29/106 (27%), Positives = 42/106 (39%), Gaps = 1/106 (0%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR-HELLFS 488
            +L  CL  F   + L  +  + C +CK+ R   K   +  LP VL V LKRF     ++ 
Sbjct: 1227 TLDQCLNLFTRPEVLAPEEAWYCPQCKQHREASKQLLLWRLPNVLIVQLKRFSFRSFIWR 1286

Query: 489  AKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
             K+                        +  Y L AVI+H G + GG
Sbjct: 1287 DKINDLVEFPVRNLDLSKFCIGQKEEQLPSYDLYAVINHYGGMIGG 1332



 Score = 33.9 bits (74), Expect = 0.56
 Identities = 14/41 (34%), Positives = 24/41 (58%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSRE 189
           S I D+F G+  S + C +C +VS   + F  L +P+P ++
Sbjct: 808 SFIVDLFQGQYKSKLVCPVCAKVSITFDPFLYLPVPLPQKQ 848


>BC142660-1|AAI42661.1| 1447|Homo sapiens USP19 protein protein.
          Length = 1447

 Score = 37.1 bits (82), Expect = 0.060
 Identities = 29/106 (27%), Positives = 42/106 (39%), Gaps = 1/106 (0%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR-HELLFS 488
            +L  CL  F   + L  +  + C +CK+ R   K   +  LP VL V LKRF     ++ 
Sbjct: 1225 TLDQCLNLFTRPEVLAPEEAWYCPQCKQHREASKQLLLWRLPNVLIVQLKRFSFRSFIWR 1284

Query: 489  AKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
             K+                        +  Y L AVI+H G + GG
Sbjct: 1285 DKINDLVEFPVRNLDLSKFCIGQKEEQLPSYDLYAVINHYGGMIGG 1330



 Score = 33.9 bits (74), Expect = 0.56
 Identities = 14/41 (34%), Positives = 24/41 (58%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSRE 189
           S I D+F G+  S + C +C +VS   + F  L +P+P ++
Sbjct: 806 SFIVDLFQGQYKSKLVCPVCAKVSITFDPFLYLPVPLPQKQ 846


>BC082241-1|AAH82241.1| 1179|Homo sapiens USP19 protein protein.
          Length = 1179

 Score = 37.1 bits (82), Expect = 0.060
 Identities = 29/106 (27%), Positives = 42/106 (39%), Gaps = 1/106 (0%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR-HELLFS 488
            +L  CL  F   + L  +  + C +CK+ R   K   +  LP VL V LKRF     ++ 
Sbjct: 957  TLDQCLNLFTRPEVLAPEEAWYCPQCKQHREASKQLLLWRLPNVLIVQLKRFSFRSFIWR 1016

Query: 489  AKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
             K+                        +  Y L AVI+H G + GG
Sbjct: 1017 DKINDLVEFPVRNLDLSKFCIGQKEEQLPSYDLYAVINHYGGMIGG 1062



 Score = 33.9 bits (74), Expect = 0.56
 Identities = 14/41 (34%), Positives = 24/41 (58%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSRE 189
           S I D+F G+  S + C +C +VS   + F  L +P+P ++
Sbjct: 538 SFIVDLFQGQYKSKLVCPVCAKVSITFDPFLYLPVPLPQKQ 578


>BC065909-1|AAH65909.1|  784|Homo sapiens USP19 protein protein.
          Length = 784

 Score = 37.1 bits (82), Expect = 0.060
 Identities = 29/106 (27%), Positives = 42/106 (39%), Gaps = 1/106 (0%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR-HELLFS 488
           +L  CL  F   + L  +  + C +CK+ R   K   +  LP VL V LKRF     ++ 
Sbjct: 525 TLDQCLNLFTRPEVLAPEEAWYCPQCKQHREASKQLLLWRLPNVLIVQLKRFSFRSFIWR 584

Query: 489 AKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
            K+                        +  Y L AVI+H G + GG
Sbjct: 585 DKINDLVEFPVRNLDLSKFCIGQKEEQLPSYDLYAVINHYGGMIGG 630



 Score = 33.9 bits (74), Expect = 0.56
 Identities = 14/41 (34%), Positives = 24/41 (58%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSRE 189
           S I D+F G+  S + C +C +VS   + F  L +P+P ++
Sbjct: 106 SFIVDLFQGQYKSKLVCPVCAKVSITFDPFLYLPVPLPQKQ 146


>BC048269-1|AAH48269.1|  436|Homo sapiens USP19 protein protein.
          Length = 436

 Score = 37.1 bits (82), Expect = 0.060
 Identities = 29/106 (27%), Positives = 42/106 (39%), Gaps = 1/106 (0%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR-HELLFS 488
           +L  CL  F   + L  +  + C +CK+ R   K   +  LP VL V LKRF     ++ 
Sbjct: 214 TLDQCLNLFTRPEVLAPEEAWYCPQCKQHREASKQLLLWRLPNVLIVQLKRFSFRSFIWR 273

Query: 489 AKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
            K+                        +  Y L AVI+H G + GG
Sbjct: 274 DKINDLVEFPVRNLDLSKFCIGQKEEQLPSYDLYAVINHYGGMIGG 319


>AB020698-1|BAA74914.1| 1371|Homo sapiens KIAA0891 protein protein.
          Length = 1371

 Score = 37.1 bits (82), Expect = 0.060
 Identities = 29/106 (27%), Positives = 42/106 (39%), Gaps = 1/106 (0%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR-HELLFS 488
            +L  CL  F   + L  +  + C +CK+ R   K   +  LP VL V LKRF     ++ 
Sbjct: 1112 TLDQCLNLFTRPEVLAPEEAWYCPQCKQHREASKQLLLWRLPNVLIVQLKRFSFRSFIWR 1171

Query: 489  AKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
             K+                        +  Y L AVI+H G + GG
Sbjct: 1172 DKINDLVEFPVRNLDLSKFCIGQKEEQLPSYDLYAVINHYGGMIGG 1217



 Score = 33.9 bits (74), Expect = 0.56
 Identities = 14/41 (34%), Positives = 24/41 (58%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSRE 189
           S I D+F G+  S + C +C +VS   + F  L +P+P ++
Sbjct: 693 SFIVDLFQGQYKSKLVCPVCAKVSITFDPFLYLPVPLPQKQ 733


>BC071582-1|AAH71582.1| 1123|Homo sapiens USP36 protein protein.
          Length = 1123

 Score = 36.7 bits (81), Expect = 0.079
 Identities = 20/47 (42%), Positives = 24/47 (51%)
 Frame = +3

Query: 327 LAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           L  F  AD L G+N Y C++CKK     K   I     VL + LKRF
Sbjct: 285 LELFVKADVLSGENAYMCAKCKKKVPASKRFTIHRTSNVLTLSLKRF 331


>BC027992-1|AAH27992.1|  959|Homo sapiens USP36 protein protein.
          Length = 959

 Score = 36.7 bits (81), Expect = 0.079
 Identities = 20/47 (42%), Positives = 24/47 (51%)
 Frame = +3

Query: 327 LAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           L  F  AD L G+N Y C++CKK     K   I     VL + LKRF
Sbjct: 285 LELFVKADVLSGENAYMCAKCKKKVPASKRFTIHRTSNVLTLSLKRF 331


>BC016487-1|AAH16487.1|  963|Homo sapiens Unknown (protein for
           IMAGE:3924730) protein.
          Length = 963

 Score = 36.7 bits (81), Expect = 0.079
 Identities = 20/47 (42%), Positives = 24/47 (51%)
 Frame = +3

Query: 327 LAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           L  F  AD L G+N Y C++CKK     K   I     VL + LKRF
Sbjct: 285 LELFVKADVLSGENAYMCAKCKKKVPASKRFTIHRTSNVLTLSLKRF 331


>AY169386-1|AAO34133.1|  548|Homo sapiens deubiquitinating enzyme 1
           protein.
          Length = 548

 Score = 36.7 bits (81), Expect = 0.079
 Identities = 20/47 (42%), Positives = 24/47 (51%)
 Frame = +3

Query: 327 LAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           L  F  AD L G+N Y C++CKK     K   I     VL + LKRF
Sbjct: 285 LELFVKADVLSGENAYMCAKCKKKVPASKRFTIHRTSNVLTLSLKRF 331


>AK022913-1|BAB14306.1|  548|Homo sapiens protein ( Homo sapiens
           cDNA FLJ12851 fis, clone NT2RP2003401, weakly similar to
           UBIQUITIN CARBOXYL-TERMINAL HYDROLASE DUB-1 (EC
           3.1.2.15). ).
          Length = 548

 Score = 36.7 bits (81), Expect = 0.079
 Identities = 20/47 (42%), Positives = 24/47 (51%)
 Frame = +3

Query: 327 LAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           L  F  AD L G+N Y C++CKK     K   I     VL + LKRF
Sbjct: 285 LELFVKADVLSGENAYMCAKCKKKVPASKRFTIHRTSNVLTLSLKRF 331


>AK001671-1|BAA91825.1|  954|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10809 fis, clone NT2RP4000927, weakly similar to
           UBIQUITIN CARBOXYL-TERMINAL HYDROLASE DUB-1 (EC
           3.1.2.15). ).
          Length = 954

 Score = 36.7 bits (81), Expect = 0.079
 Identities = 20/47 (42%), Positives = 24/47 (51%)
 Frame = +3

Query: 327 LAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           L  F  AD L G+N Y C++CKK     K   I     VL + LKRF
Sbjct: 285 LELFVKADVLSGENAYMCAKCKKKVPASKRFTIHRTSNVLTLSLKRF 331


>AB040886-1|BAA95977.1| 1123|Homo sapiens KIAA1453 protein protein.
          Length = 1123

 Score = 36.7 bits (81), Expect = 0.079
 Identities = 20/47 (42%), Positives = 24/47 (51%)
 Frame = +3

Query: 327 LAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           L  F  AD L G+N Y C++CKK     K   I     VL + LKRF
Sbjct: 287 LELFVKADVLSGENAYMCAKCKKKVPASKRFTIHRTSNVLTLSLKRF 333


>AL831918-1|CAD38579.1|  810|Homo sapiens hypothetical protein
           protein.
          Length = 810

 Score = 36.3 bits (80), Expect = 0.10
 Identities = 17/49 (34%), Positives = 25/49 (51%)
 Frame = +3

Query: 348 DELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSAK 494
           D L+GDNMY+CS C K     K +    LP +L  +  R+   ++   K
Sbjct: 330 DTLEGDNMYTCSHCGKKVRAEKRACFKKLPRILSFNTMRYTFNMVTMMK 378


>AK090821-1|BAC03523.1|  635|Homo sapiens protein ( Homo sapiens
           cDNA FLJ33502 fis, clone BRAMY2004492, weakly similar to
           UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 4 (EC 3.1.2.15).
           ).
          Length = 635

 Score = 36.3 bits (80), Expect = 0.10
 Identities = 15/41 (36%), Positives = 24/41 (58%)
 Frame = +3

Query: 345 ADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           A +L  D+ + C  C+ L+ G+    +  LP +L +HLKRF
Sbjct: 64  AFQLAQDDAWKCPHCQVLQQGMVKLSLWTLPDILIIHLKRF 104


>AJ586138-1|CAE51938.1| 3395|Homo sapiens ubiquitin-specific
            proteinase 34 protein.
          Length = 3395

 Score = 36.3 bits (80), Expect = 0.10
 Identities = 17/49 (34%), Positives = 25/49 (51%)
 Frame = +3

Query: 348  DELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSAK 494
            D L+GDNMY+CS C K     K +    LP +L  +  R+   ++   K
Sbjct: 1901 DTLEGDNMYTCSHCGKKVRAEKRACFKKLPRILSFNTMRYTFNMVTMMK 1949


>AB011142-1|BAA25496.2| 3412|Homo sapiens KIAA0570 protein protein.
          Length = 3412

 Score = 36.3 bits (80), Expect = 0.10
 Identities = 17/49 (34%), Positives = 25/49 (51%)
 Frame = +3

Query: 348  DELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSAK 494
            D L+GDNMY+CS C K     K +    LP +L  +  R+   ++   K
Sbjct: 1918 DTLEGDNMYTCSHCGKKVRAEKRACFKKLPRILSFNTMRYTFNMVTMMK 1966


>Z81365-3|CAI43184.1|  913|Homo sapiens ubiquitin specific peptidase
           26 protein.
          Length = 913

 Score = 35.9 bits (79), Expect = 0.14
 Identities = 19/52 (36%), Positives = 29/52 (55%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           S+Q     FF A+EL+    Y C++C+  +  V +     LP +L VHLKR+
Sbjct: 478 SIQSTFDLFFGAEELE----YKCAKCEH-KTSVGVHSFSRLPRILIVHLKRY 524


>BC101191-1|AAI01192.1|  913|Homo sapiens ubiquitin specific
           peptidase 26 protein.
          Length = 913

 Score = 35.9 bits (79), Expect = 0.14
 Identities = 19/52 (36%), Positives = 29/52 (55%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           S+Q     FF A+EL+    Y C++C+  +  V +     LP +L VHLKR+
Sbjct: 478 SIQSTFDLFFGAEELE----YKCAKCEH-KTSVGVHSFSRLPRILIVHLKRY 524


>BC101190-1|AAI01191.1|  913|Homo sapiens ubiquitin specific
           peptidase 26 protein.
          Length = 913

 Score = 35.9 bits (79), Expect = 0.14
 Identities = 19/52 (36%), Positives = 29/52 (55%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           S+Q     FF A+EL+    Y C++C+  +  V +     LP +L VHLKR+
Sbjct: 478 SIQSTFDLFFGAEELE----YKCAKCEH-KTSVGVHSFSRLPRILIVHLKRY 524


>BC101189-1|AAI01190.1|  913|Homo sapiens ubiquitin specific
           peptidase 26 protein.
          Length = 913

 Score = 35.9 bits (79), Expect = 0.14
 Identities = 19/52 (36%), Positives = 29/52 (55%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           S+Q     FF A+EL+    Y C++C+  +  V +     LP +L VHLKR+
Sbjct: 478 SIQSTFDLFFGAEELE----YKCAKCEH-KTSVGVHSFSRLPRILIVHLKRY 524


>BC069073-1|AAH69073.1|  913|Homo sapiens ubiquitin specific
           peptidase 26 protein.
          Length = 913

 Score = 35.9 bits (79), Expect = 0.14
 Identities = 19/52 (36%), Positives = 29/52 (55%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           S+Q     FF A+EL+    Y C++C+  +  V +     LP +L VHLKR+
Sbjct: 478 SIQSTFDLFFGAEELE----YKCAKCEH-KTSVGVHSFSRLPRILIVHLKRY 524


>AF285593-1|AAK31972.1|  913|Homo sapiens ubiquitin specific
           protease 26 protein.
          Length = 913

 Score = 35.9 bits (79), Expect = 0.14
 Identities = 19/52 (36%), Positives = 29/52 (55%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           S+Q     FF A+EL+    Y C++C+  +  V +     LP +L VHLKR+
Sbjct: 478 SIQSTFDLFFGAEELE----YKCAKCEH-KTSVGVHSFSRLPRILIVHLKRY 524


>BX538024-1|CAD97970.1|  979|Homo sapiens hypothetical protein
           protein.
          Length = 979

 Score = 35.1 bits (77), Expect = 0.24
 Identities = 23/62 (37%), Positives = 32/62 (51%)
 Frame = +3

Query: 303 PVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELL 482
           P  S+QD L  FF A+EL+    YSC +C   +  +       LP VL +HLKR+   + 
Sbjct: 517 PPRSIQDSLDLFFRAEELE----YSCEKCGG-KCALVRHKFNRLPRVLILHLKRYSFNVA 571

Query: 483 FS 488
            S
Sbjct: 572 LS 573


>BC133009-1|AAI33010.1|  979|Homo sapiens ubiquitin specific
           peptidase 37 protein.
          Length = 979

 Score = 35.1 bits (77), Expect = 0.24
 Identities = 23/62 (37%), Positives = 32/62 (51%)
 Frame = +3

Query: 303 PVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELL 482
           P  S+QD L  FF A+EL+    YSC +C   +  +       LP VL +HLKR+   + 
Sbjct: 517 PPRSIQDSLDLFFRAEELE----YSCEKCGG-KCALVRHKFNRLPRVLILHLKRYSFNVA 571

Query: 483 FS 488
            S
Sbjct: 572 LS 573


>BC133007-1|AAI33008.1|  979|Homo sapiens USP37 protein protein.
          Length = 979

 Score = 35.1 bits (77), Expect = 0.24
 Identities = 23/62 (37%), Positives = 32/62 (51%)
 Frame = +3

Query: 303 PVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELL 482
           P  S+QD L  FF A+EL+    YSC +C   +  +       LP VL +HLKR+   + 
Sbjct: 517 PPRSIQDSLDLFFRAEELE----YSCEKCGG-KCALVRHKFNRLPRVLILHLKRYSFNVA 571

Query: 483 FS 488
            S
Sbjct: 572 LS 573


>BC112901-1|AAI12902.1|  885|Homo sapiens USP37 protein protein.
          Length = 885

 Score = 35.1 bits (77), Expect = 0.24
 Identities = 23/62 (37%), Positives = 32/62 (51%)
 Frame = +3

Query: 303 PVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELL 482
           P  S+QD L  FF A+EL+    YSC +C   +  +       LP VL +HLKR+   + 
Sbjct: 445 PPRSIQDSLDLFFRAEELE----YSCEKCGG-KCALVRHKFNRLPRVLILHLKRYSFNVA 499

Query: 483 FS 488
            S
Sbjct: 500 LS 501


>AL832645-1|CAD89955.1|  979|Homo sapiens hypothetical protein
           protein.
          Length = 979

 Score = 35.1 bits (77), Expect = 0.24
 Identities = 23/62 (37%), Positives = 32/62 (51%)
 Frame = +3

Query: 303 PVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELL 482
           P  S+QD L  FF A+EL+    YSC +C   +  +       LP VL +HLKR+   + 
Sbjct: 517 PPRSIQDSLDLFFRAEELE----YSCEKCGG-KCALVRHKFNRLPRVLILHLKRYSFNVA 571

Query: 483 FS 488
            S
Sbjct: 572 LS 573


>AB046814-1|BAB13420.1|  931|Homo sapiens KIAA1594 protein protein.
          Length = 931

 Score = 35.1 bits (77), Expect = 0.24
 Identities = 23/62 (37%), Positives = 32/62 (51%)
 Frame = +3

Query: 303 PVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELL 482
           P  S+QD L  FF A+EL+    YSC +C   +  +       LP VL +HLKR+   + 
Sbjct: 469 PPRSIQDSLDLFFRAEELE----YSCEKCGG-KCALVRHKFNRLPRVLILHLKRYSFNVA 523

Query: 483 FS 488
            S
Sbjct: 524 LS 525


>BC030777-1|AAH30777.1|  822|Homo sapiens ubiquitin specific
           peptidase 16 protein.
          Length = 822

 Score = 34.7 bits (76), Expect = 0.32
 Identities = 16/37 (43%), Positives = 22/37 (59%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           S +  +F G+L S + C  C  VS   E+F DLSLP+
Sbjct: 352 SFVDRIFGGELTSMIMCDQCRTVSLVHESFLDLSLPV 388


>AY333928-1|AAR13293.1|  408|Homo sapiens USP16 protein.
          Length = 408

 Score = 34.7 bits (76), Expect = 0.32
 Identities = 16/37 (43%), Positives = 22/37 (59%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           S +  +F G+L S + C  C  VS   E+F DLSLP+
Sbjct: 353 SFVDRIFGGELTSMIMCDQCRTVSLVHESFLDLSLPV 389


>AL832030-1|CAD91148.1|  567|Homo sapiens hypothetical protein
           protein.
          Length = 567

 Score = 34.7 bits (76), Expect = 0.32
 Identities = 16/37 (43%), Positives = 22/37 (59%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           + I  +F G+L S V C  C  +ST  + F D+SLPI
Sbjct: 101 NFIDRIFIGELTSTVMCEECANISTVKDPFIDISLPI 137


>AL513550-2|CAI17192.1|  772|Homo sapiens ubiquitin specific
           peptidase 45 protein.
          Length = 772

 Score = 34.7 bits (76), Expect = 0.32
 Identities = 16/37 (43%), Positives = 22/37 (59%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           + I  +F G+L S V C  C  +ST  + F D+SLPI
Sbjct: 348 NFIDRIFIGELTSTVMCEECANISTVKDPFIDISLPI 384


>AL163249-3|CAB90432.1|  823|Homo sapiens human ubiquitin processing
           protease, EC 3.1.2.15 protein.
          Length = 823

 Score = 34.7 bits (76), Expect = 0.32
 Identities = 16/37 (43%), Positives = 22/37 (59%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           S +  +F G+L S + C  C  VS   E+F DLSLP+
Sbjct: 353 SFVDRIFGGELTSMIMCDQCRTVSLVHESFLDLSLPV 389


>AL137784-3|CAI19761.1|  772|Homo sapiens ubiquitin specific
           peptidase 45 protein.
          Length = 772

 Score = 34.7 bits (76), Expect = 0.32
 Identities = 16/37 (43%), Positives = 22/37 (59%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           + I  +F G+L S V C  C  +ST  + F D+SLPI
Sbjct: 348 NFIDRIFIGELTSTVMCEECANISTVKDPFIDISLPI 384


>AK222884-1|BAD96604.1|  823|Homo sapiens ubiquitin specific
           protease 16 isoform a variant protein.
          Length = 823

 Score = 34.7 bits (76), Expect = 0.32
 Identities = 16/37 (43%), Positives = 22/37 (59%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           S +  +F G+L S + C  C  VS   E+F DLSLP+
Sbjct: 353 SFVDRIFGGELTSMIMCDQCRTVSLVHESFLDLSLPV 389


>AK222681-1|BAD96401.1|  823|Homo sapiens ubiquitin specific
           protease 16 isoform a variant protein.
          Length = 823

 Score = 34.7 bits (76), Expect = 0.32
 Identities = 16/37 (43%), Positives = 22/37 (59%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           S +  +F G+L S + C  C  VS   E+F DLSLP+
Sbjct: 353 SFVDRIFGGELTSMIMCDQCRTVSLVHESFLDLSLPV 389


>AJ583819-1|CAE47746.2|  814|Homo sapiens ubiquitin specific
           proteinase 45 protein.
          Length = 814

 Score = 34.7 bits (76), Expect = 0.32
 Identities = 16/37 (43%), Positives = 22/37 (59%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           + I  +F G+L S V C  C  +ST  + F D+SLPI
Sbjct: 348 NFIDRIFIGELTSTVMCEECANISTVKDPFIDISLPI 384


>AF126736-1|AAD20949.1|  823|Homo sapiens ubiquitin processing
           protease protein.
          Length = 823

 Score = 34.7 bits (76), Expect = 0.32
 Identities = 16/37 (43%), Positives = 22/37 (59%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           S +  +F G+L S + C  C  VS   E+F DLSLP+
Sbjct: 353 SFVDRIFGGELTSMIMCDQCRTVSLVHESFLDLSLPV 389


>BC067300-1|AAH67300.1|  350|Homo sapiens USP40 protein protein.
          Length = 350

 Score = 33.9 bits (74), Expect = 0.56
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 1/60 (1%)
 Frame = +3

Query: 306 VVSLQDCLAAFFSADELKG-DNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELL 482
           V  L+D L   +  +E+   DN+Y C  C +L    K + +  LP  L V L RF  + +
Sbjct: 227 VSGLEDALWNMYVEEEVFDCDNLYHCGTCDRLVKAAKSAKLRKLPPFLTVSLLRFNFDFV 286


>AK001647-1|BAA91807.1| 1014|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10785 fis, clone NT2RP4000457, weakly similar to
           UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 15 (EC 3.1.2.15).
           ).
          Length = 1014

 Score = 33.9 bits (74), Expect = 0.56
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 1/60 (1%)
 Frame = +3

Query: 306 VVSLQDCLAAFFSADELKG-DNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELL 482
           V  L+D L   +  +E+   DN+Y C  C +L    K + +  LP  L V L RF  + +
Sbjct: 67  VSGLEDALWNMYVEEEVFDCDNLYHCGTCDRLVKAAKSAKLRKLPPFLTVSLLRFNFDFV 126


>AJ583821-1|CAE47748.2| 1247|Homo sapiens ubiquitin specific
           proteinase 40 protein.
          Length = 1247

 Score = 33.9 bits (74), Expect = 0.56
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 1/60 (1%)
 Frame = +3

Query: 306 VVSLQDCLAAFFSADELKG-DNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELL 482
           V  L+D L   +  +E+   DN+Y C  C +L    K + +  LP  L V L RF  + +
Sbjct: 207 VSGLEDALWNMYVEEEVFDCDNLYHCGTCDRLVKAAKSAKLRKLPPFLTVSLLRFNFDFV 266


>AF544011-1|AAQ11741.1|  530|Homo sapiens deubiquitinating enzyme
           DUB1 protein.
          Length = 530

 Score = 32.3 bits (70), Expect = 1.7
 Identities = 17/52 (32%), Positives = 24/52 (46%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           S+Q  L      +EL G+N Y C  C +  +  K   +     VL + LKRF
Sbjct: 232 SVQQALEQLVKPEELNGENAYHCGVCLQRASASKTLTLHTSAKVLILVLKRF 283


>Z72499-1|CAA96580.1| 1102|Homo sapiens herpesvirus associated
           ubiquitin-specific  protease (HAUSP) protein.
          Length = 1102

 Score = 31.1 bits (67), Expect = 3.9
 Identities = 14/41 (34%), Positives = 24/41 (58%)
 Frame = +1

Query: 73  ISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHL 195
           I  +F GK++S +QC   D  S R E + D+ L I  ++++
Sbjct: 320 IPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKNI 360


>BC113428-1|AAI13429.1|  343|Homo sapiens aristaless-like homeobox 3
           protein.
          Length = 343

 Score = 31.1 bits (67), Expect = 3.9
 Identities = 15/33 (45%), Positives = 18/33 (54%), Gaps = 1/33 (3%)
 Frame = +3

Query: 156 PRLVAADPVPGTLGR-AALPAAHAEPPRGPQRT 251
           P + + D  PG  G  AA P  H  PPRGP+ T
Sbjct: 17  PYVASGDEPPGPQGTPAAAPHLHPAPPRGPRLT 49


>BC112007-1|AAI12008.1|  343|Homo sapiens ALX3 protein protein.
          Length = 343

 Score = 31.1 bits (67), Expect = 3.9
 Identities = 15/33 (45%), Positives = 18/33 (54%), Gaps = 1/33 (3%)
 Frame = +3

Query: 156 PRLVAADPVPGTLGR-AALPAAHAEPPRGPQRT 251
           P + + D  PG  G  AA P  H  PPRGP+ T
Sbjct: 17  PYVASGDEPPGPQGTPAAAPHLHPAPPRGPRLT 49


>AY533200-1|AAS59847.1|  398|Homo sapiens deubiquitinating enzyme
           DUB4 protein.
          Length = 398

 Score = 31.1 bits (67), Expect = 3.9
 Identities = 17/52 (32%), Positives = 23/52 (44%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           S+Q  L      +EL G+N Y C  C +     K   +     VL + LKRF
Sbjct: 232 SVQQALEQLVKPEELNGENAYHCGVCLQRAPASKTLTLHTSAKVLILVLKRF 283


>AY188990-1|AAO38845.1|  530|Homo sapiens deubiquitinating enzyme 3
           protein.
          Length = 530

 Score = 31.1 bits (67), Expect = 3.9
 Identities = 17/52 (32%), Positives = 23/52 (44%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           S+Q  L      +EL G+N Y C  C +     K   +     VL + LKRF
Sbjct: 232 SVQQALEQLVKPEELNGENAYHCGVCLQRAPASKTLTLHTSAKVLILVLKRF 283


>AL160006-1|CAI22714.1|  343|Homo sapiens aristaless-like homeobox 3
           protein.
          Length = 343

 Score = 31.1 bits (67), Expect = 3.9
 Identities = 15/33 (45%), Positives = 18/33 (54%), Gaps = 1/33 (3%)
 Frame = +3

Query: 156 PRLVAADPVPGTLGR-AALPAAHAEPPRGPQRT 251
           P + + D  PG  G  AA P  H  PPRGP+ T
Sbjct: 17  PYVASGDEPPGPQGTPAAAPHLHPAPPRGPRLT 49


>AF544012-1|AAQ11742.1|  530|Homo sapiens deubiquitinating enzyme
           DUB2 protein.
          Length = 530

 Score = 31.1 bits (67), Expect = 3.9
 Identities = 17/52 (32%), Positives = 23/52 (44%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           S+Q  L      +EL G+N Y C  C +     K   +     VL + LKRF
Sbjct: 232 SVQQALEQLVKPEELNGENAYHCGVCLQRAPASKTLTLHTSAKVLILVLKRF 283


>AF008203-1|AAD01418.1|  343|Homo sapiens homeobox protein protein.
          Length = 343

 Score = 31.1 bits (67), Expect = 3.9
 Identities = 15/33 (45%), Positives = 18/33 (54%), Gaps = 1/33 (3%)
 Frame = +3

Query: 156 PRLVAADPVPGTLGR-AALPAAHAEPPRGPQRT 251
           P + + D  PG  G  AA P  H  PPRGP+ T
Sbjct: 17  PYVASGDEPPGPQGTPAAAPHLHPAPPRGPRLT 49


>AF008202-1|AAD01417.2|   92|Homo sapiens homeobox protein alx3
           protein.
          Length = 92

 Score = 31.1 bits (67), Expect = 3.9
 Identities = 15/33 (45%), Positives = 18/33 (54%), Gaps = 1/33 (3%)
 Frame = +3

Query: 156 PRLVAADPVPGTLGR-AALPAAHAEPPRGPQRT 251
           P + + D  PG  G  AA P  H  PPRGP+ T
Sbjct: 17  PYVASGDEPPGPQGTPAAAPHLHPAPPRGPRLT 49


>AY376241-1|AAQ82908.1| 1112|Homo sapiens ubiquitin-specific
           protease 7 isoform protein.
          Length = 1112

 Score = 30.7 bits (66), Expect = 5.2
 Identities = 13/41 (31%), Positives = 24/41 (58%)
 Frame = +1

Query: 73  ISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHL 195
           I  +F GK++S +QC   D  S R E + D+ L +  ++++
Sbjct: 330 IPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSVKGKKNI 370


>BC022094-1|AAH22094.2|  400|Homo sapiens USP30 protein protein.
          Length = 400

 Score = 29.9 bits (64), Expect = 9.1
 Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%)
 Frame = +1

Query: 85  FXGKLLSAVQCLICDRVS-TRIETFQDLSLPIPS 183
           F G+L S + C  C+  S  R +TF  LSL IP+
Sbjct: 107 FHGRLTSNMVCKHCEHQSPVRFDTFDSLSLSIPA 140


>BC004868-1|AAH04868.1|  508|Homo sapiens ubiquitin specific
           peptidase 30 protein.
          Length = 508

 Score = 29.9 bits (64), Expect = 9.1
 Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%)
 Frame = +1

Query: 85  FXGKLLSAVQCLICDRVS-TRIETFQDLSLPIPS 183
           F G+L S + C  C+  S  R +TF  LSL IP+
Sbjct: 215 FHGRLTSNMVCKHCEHQSPVRFDTFDSLSLSIPA 248


>AY509884-1|AAR91701.1|  530|Homo sapiens deubiquitinating enzyme 3
           protein.
          Length = 530

 Score = 29.9 bits (64), Expect = 9.1
 Identities = 16/52 (30%), Positives = 23/52 (44%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           S++  L      +EL G+N Y C  C +     K   +     VL + LKRF
Sbjct: 232 SVKQALEQLVKPEELNGENAYHCGLCLQRAPASKTLTLHTSAKVLILVLKRF 283


>AK027820-1|BAB55392.1|  486|Homo sapiens protein ( Homo sapiens
           cDNA FLJ14914 fis, clone PLACE1006829, weakly similar to
           UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 4 (EC 3.1.2.15).
           ).
          Length = 486

 Score = 29.9 bits (64), Expect = 9.1
 Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%)
 Frame = +1

Query: 85  FXGKLLSAVQCLICDRVS-TRIETFQDLSLPIPS 183
           F G+L S + C  C+  S  R +TF  LSL IP+
Sbjct: 193 FHGRLTSNMVCKHCEHQSPVRFDTFDSLSLSIPA 226


>AJ586136-1|CAE51936.1|  517|Homo sapiens ubiquitin-specific
           proteinase 30 protein.
          Length = 517

 Score = 29.9 bits (64), Expect = 9.1
 Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%)
 Frame = +1

Query: 85  FXGKLLSAVQCLICDRVS-TRIETFQDLSLPIPS 183
           F G+L S + C  C+  S  R +TF  LSL IP+
Sbjct: 224 FHGRLTSNMVCKHCEHQSPVRFDTFDSLSLSIPA 257


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 91,239,331
Number of Sequences: 237096
Number of extensions: 1669918
Number of successful extensions: 5618
Number of sequences better than 10.0: 193
Number of HSP's better than 10.0 without gapping: 5066
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5587
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8007229802
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -