SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30137.Seq
         (875 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

D84273-1|BAA34600.1|  548|Homo sapiens Asparaginyl tRNA Syntheta...   143   6e-34
BC001687-1|AAH01687.1|  548|Homo sapiens asparaginyl-tRNA synthe...   143   6e-34
AK222835-1|BAD96555.1|  548|Homo sapiens asparaginyl-tRNA synthe...   143   6e-34
AJ000334-1|CAA04008.1|  548|Homo sapiens asparaginyl-tRNA synthe...   143   6e-34
AF269088-1|AAK27326.1| 1011|Homo sapiens breast cancer antigen N...    34   0.59 
BC015031-1|AAH15031.1|  847|Homo sapiens matrin 3 protein.             32   3.1  
AY007157-1|AAG02007.1|  407|Homo sapiens protein ( Homo sapiens ...    32   3.1  
AF117236-1|AAF17217.1|  848|Homo sapiens matrin 3 protein.             32   3.1  
AB018266-1|BAA34443.2|  853|Homo sapiens KIAA0723 protein protein.     32   3.1  
Z84487-2|CAI42674.1| 2492|Homo sapiens alpha thalassemia/mental ...    30   9.6  
Z84487-1|CAI42675.1| 2454|Homo sapiens alpha thalassemia/mental ...    30   9.6  
U97103-1|AAC51657.1| 2375|Homo sapiens X-linked nuclear protein ...    30   9.6  
U75653-1|AAC51655.1| 2492|Homo sapiens zinc finger helicase prot...    30   9.6  
U72938-1|AAB49971.2| 2454|Homo sapiens putative DNA dependent AT...    30   9.6  
U72937-1|AAB49970.2| 2492|Homo sapiens putative DNA dependent AT...    30   9.6  
U72936-1|AAB49969.1| 2288|Homo sapiens putative DNA dependent AT...    30   9.6  
U72935-3|AAB40700.1| 2288|Homo sapiens putative DNA dependent AT...    30   9.6  
U72935-2|AAB40699.1| 2337|Homo sapiens putative DNA dependent AT...    30   9.6  
U72935-1|AAB40698.1| 2375|Homo sapiens putative DNA dependent AT...    30   9.6  
U09820-1|AAC50069.1| 1641|Homo sapiens helicase II protein.            30   9.6  
L34363-1|AAA20872.1| 1298|Homo sapiens X-linked nuclear protein ...    30   9.6  
EF467914-1|ABO43036.1| 2492|Homo sapiens alpha thalassemia/menta...    30   9.6  
AL121874-2|CAI40710.1| 2492|Homo sapiens alpha thalassemia/menta...    30   9.6  
AL121874-1|CAB90351.2| 2454|Homo sapiens alpha thalassemia/menta...    30   9.6  
AL109753-2|CAI43115.1| 2492|Homo sapiens alpha thalassemia/menta...    30   9.6  
AL109753-1|CAI43116.1| 2454|Homo sapiens alpha thalassemia/menta...    30   9.6  
AB209545-1|BAD92782.1| 1224|Homo sapiens transcriptional regulat...    30   9.6  
AB102641-1|BAC81110.1| 2492|Homo sapiens ATRX protein.                 30   9.6  

>D84273-1|BAA34600.1|  548|Homo sapiens Asparaginyl tRNA Synthetase
           protein.
          Length = 548

 Score =  143 bits (347), Expect = 6e-34
 Identities = 66/109 (60%), Positives = 81/109 (74%)
 Frame = +1

Query: 511 WVHRLRRQGKSLAFLTLRDGTGYLQCVLHGLLCQTYNALVLSTESSVVLYGKLEAVPEGK 690
           WVHRLRRQGK+L FL LRDGTGYLQCVL   LCQ YN ++LSTESSV +YG L   P+GK
Sbjct: 133 WVHRLRRQGKNLMFLVLRDGTGYLQCVLADELCQCYNGVLLSTESSVAVYGMLNLTPKGK 192

Query: 691 KAPGGHELTADYWGIDWTRTTRWCDAILNEEALPDVQLDHRXIMIRXEN 837
           +APGGHEL+ D+W +         D ++NEE+  DVQL++R +MIR EN
Sbjct: 193 QAPGGHELSCDFWELIGLAPAGGADNLINEESDVDVQLNNRHMMIRGEN 241



 Score = 77.4 bits (182), Expect = 6e-14
 Identities = 36/81 (44%), Positives = 56/81 (69%)
 Frame = +2

Query: 257 SKDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDP 436
           S+ + + ++V +KSQLK I+K+W RE  K+  + K E E++ +R +NL+EAKKI ++ DP
Sbjct: 48  SQKENERWNVISKSQLKNIKKMWHREQMKSESREKKEAEDSLRREKNLEEAKKITIKNDP 107

Query: 437 SLPKATVVKICETTEHRGQRI 499
           SLP+   VKI     +RGQR+
Sbjct: 108 SLPEPKCVKIGALEGYRGQRV 128



 Score = 46.8 bits (106), Expect = 1e-04
 Identities = 23/44 (52%), Positives = 26/44 (59%)
 Frame = +3

Query: 123 LSEIYTSXXXXXXXXXXXXXEKPFKTILKAMHHAGKEPFPTIYV 254
           L+E+Y S             EKPFKT LKA+   GKEPFPTIYV
Sbjct: 3   LAELYVSDREGSDATGDGTKEKPFKTGLKALMTVGKEPFPTIYV 46


>BC001687-1|AAH01687.1|  548|Homo sapiens asparaginyl-tRNA
           synthetase protein.
          Length = 548

 Score =  143 bits (347), Expect = 6e-34
 Identities = 66/109 (60%), Positives = 81/109 (74%)
 Frame = +1

Query: 511 WVHRLRRQGKSLAFLTLRDGTGYLQCVLHGLLCQTYNALVLSTESSVVLYGKLEAVPEGK 690
           WVHRLRRQGK+L FL LRDGTGYLQCVL   LCQ YN ++LSTESSV +YG L   P+GK
Sbjct: 133 WVHRLRRQGKNLMFLVLRDGTGYLQCVLADELCQCYNGVLLSTESSVAVYGMLNLTPKGK 192

Query: 691 KAPGGHELTADYWGIDWTRTTRWCDAILNEEALPDVQLDHRXIMIRXEN 837
           +APGGHEL+ D+W +         D ++NEE+  DVQL++R +MIR EN
Sbjct: 193 QAPGGHELSCDFWELIGLAPAGGADNLINEESDVDVQLNNRHMMIRGEN 241



 Score = 77.4 bits (182), Expect = 6e-14
 Identities = 36/81 (44%), Positives = 56/81 (69%)
 Frame = +2

Query: 257 SKDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDP 436
           S+ + + ++V +KSQLK I+K+W RE  K+  + K E E++ +R +NL+EAKKI ++ DP
Sbjct: 48  SQKENERWNVISKSQLKNIKKMWHREQMKSESREKKEAEDSLRREKNLEEAKKITIKNDP 107

Query: 437 SLPKATVVKICETTEHRGQRI 499
           SLP+   VKI     +RGQR+
Sbjct: 108 SLPEPKCVKIGALEGYRGQRV 128



 Score = 46.8 bits (106), Expect = 1e-04
 Identities = 23/44 (52%), Positives = 26/44 (59%)
 Frame = +3

Query: 123 LSEIYTSXXXXXXXXXXXXXEKPFKTILKAMHHAGKEPFPTIYV 254
           L+E+Y S             EKPFKT LKA+   GKEPFPTIYV
Sbjct: 3   LAELYVSDREGSDATGDGTKEKPFKTGLKALMTVGKEPFPTIYV 46


>AK222835-1|BAD96555.1|  548|Homo sapiens asparaginyl-tRNA
           synthetase variant protein.
          Length = 548

 Score =  143 bits (347), Expect = 6e-34
 Identities = 66/109 (60%), Positives = 81/109 (74%)
 Frame = +1

Query: 511 WVHRLRRQGKSLAFLTLRDGTGYLQCVLHGLLCQTYNALVLSTESSVVLYGKLEAVPEGK 690
           WVHRLRRQGK+L FL LRDGTGYLQCVL   LCQ YN ++LSTESSV +YG L   P+GK
Sbjct: 133 WVHRLRRQGKNLMFLVLRDGTGYLQCVLADELCQCYNGVLLSTESSVAVYGMLNLTPKGK 192

Query: 691 KAPGGHELTADYWGIDWTRTTRWCDAILNEEALPDVQLDHRXIMIRXEN 837
           +APGGHEL+ D+W +         D ++NEE+  DVQL++R +MIR EN
Sbjct: 193 QAPGGHELSCDFWELIGLAPAGGADNLINEESDVDVQLNNRHMMIRGEN 241



 Score = 77.4 bits (182), Expect = 6e-14
 Identities = 36/81 (44%), Positives = 56/81 (69%)
 Frame = +2

Query: 257 SKDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDP 436
           S+ + + ++V +KSQLK I+K+W RE  K+  + K E E++ +R +NL+EAKKI ++ DP
Sbjct: 48  SQKENERWNVISKSQLKNIKKMWHREQMKSESREKKEAEDSLRREKNLEEAKKITIKNDP 107

Query: 437 SLPKATVVKICETTEHRGQRI 499
           SLP+   VKI     +RGQR+
Sbjct: 108 SLPEPKCVKIGALEGYRGQRV 128



 Score = 46.8 bits (106), Expect = 1e-04
 Identities = 23/44 (52%), Positives = 26/44 (59%)
 Frame = +3

Query: 123 LSEIYTSXXXXXXXXXXXXXEKPFKTILKAMHHAGKEPFPTIYV 254
           L+E+Y S             EKPFKT LKA+   GKEPFPTIYV
Sbjct: 3   LAELYVSDREGSDATGDGTKEKPFKTGLKALMTVGKEPFPTIYV 46


>AJ000334-1|CAA04008.1|  548|Homo sapiens asparaginyl-tRNA
           synthetase protein.
          Length = 548

 Score =  143 bits (347), Expect = 6e-34
 Identities = 66/109 (60%), Positives = 81/109 (74%)
 Frame = +1

Query: 511 WVHRLRRQGKSLAFLTLRDGTGYLQCVLHGLLCQTYNALVLSTESSVVLYGKLEAVPEGK 690
           WVHRLRRQGK+L FL LRDGTGYLQCVL   LCQ YN ++LSTESSV +YG L   P+GK
Sbjct: 133 WVHRLRRQGKNLMFLVLRDGTGYLQCVLADELCQCYNGVLLSTESSVAVYGMLNLTPKGK 192

Query: 691 KAPGGHELTADYWGIDWTRTTRWCDAILNEEALPDVQLDHRXIMIRXEN 837
           +APGGHEL+ D+W +         D ++NEE+  DVQL++R +MIR EN
Sbjct: 193 QAPGGHELSCDFWELIGLAPAGGADNLINEESDVDVQLNNRHMMIRGEN 241



 Score = 77.4 bits (182), Expect = 6e-14
 Identities = 36/81 (44%), Positives = 56/81 (69%)
 Frame = +2

Query: 257 SKDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDP 436
           S+ + + ++V +KSQLK I+K+W RE  K+  + K E E++ +R +NL+EAKKI ++ DP
Sbjct: 48  SQKENERWNVISKSQLKNIKKMWHREQMKSESREKKEAEDSLRREKNLEEAKKITIKNDP 107

Query: 437 SLPKATVVKICETTEHRGQRI 499
           SLP+   VKI     +RGQR+
Sbjct: 108 SLPEPKCVKIGALEGYRGQRV 128



 Score = 46.8 bits (106), Expect = 1e-04
 Identities = 23/44 (52%), Positives = 26/44 (59%)
 Frame = +3

Query: 123 LSEIYTSXXXXXXXXXXXXXEKPFKTILKAMHHAGKEPFPTIYV 254
           L+E+Y S             EKPFKT LKA+   GKEPFPTIYV
Sbjct: 3   LAELYVSDREGSDATGDGTKEKPFKTGLKALMTVGKEPFPTIYV 46


>AF269088-1|AAK27326.1| 1011|Homo sapiens breast cancer antigen
           NY-BR-1.1 protein.
          Length = 1011

 Score = 34.3 bits (75), Expect = 0.59
 Identities = 23/76 (30%), Positives = 42/76 (55%), Gaps = 4/76 (5%)
 Frame = +2

Query: 329 RENYKA--MDKAKAEEENTEKRSQNLDEAKKILLQEDPSLPKATVVKICETTEHRGQRIC 502
           RE +KA  M  +++++++ E+ S + +   + LLQ D  LPKAT  K  +T   + +   
Sbjct: 552 RETFKAAQMFPSESKQKDDEENSWDFESFLETLLQNDVCLPKATHQKEFDTLSGKLEESP 611

Query: 503 IRDGYI--VSGAKVNL 544
            +DG +    G K++L
Sbjct: 612 DKDGLLKPTCGMKISL 627



 Score = 31.1 bits (67), Expect = 5.5
 Identities = 24/84 (28%), Positives = 42/84 (50%), Gaps = 2/84 (2%)
 Frame = +2

Query: 299 QLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDPSLPKATVVKICETT 478
           +LK  Q +   + + +  K K +EEN    S + +   + + Q+D  LPKAT  K  +T 
Sbjct: 395 ELKNEQTLRAAQMFPSESKQKDDEEN----SWDSESPCETVSQKDVYLPKATHQKEFDTL 450

Query: 479 EHRGQRICIRDGYI--VSGAKVNL 544
             + +   ++DG +    G KV+L
Sbjct: 451 SGKLEESPVKDGLLKPTCGRKVSL 474


>BC015031-1|AAH15031.1|  847|Homo sapiens matrin 3 protein.
          Length = 847

 Score = 31.9 bits (69), Expect = 3.1
 Identities = 20/48 (41%), Positives = 28/48 (58%), Gaps = 5/48 (10%)
 Frame = +2

Query: 287 AAKSQLKKIQKIWV--RENYKAMDKAKAEEENTE---KRSQNLDEAKK 415
           AAK +LKK+ KI    +EN  A++     EENTE   + S+N D+  K
Sbjct: 709 AAKKKLKKVDKIEELDQENEAALENGIKNEENTEPGAESSENADDPNK 756


>AY007157-1|AAG02007.1|  407|Homo sapiens protein ( Homo sapiens
           clone CDABP0107 mRNA sequence. ).
          Length = 407

 Score = 31.9 bits (69), Expect = 3.1
 Identities = 20/48 (41%), Positives = 28/48 (58%), Gaps = 5/48 (10%)
 Frame = +2

Query: 287 AAKSQLKKIQKIWV--RENYKAMDKAKAEEENTE---KRSQNLDEAKK 415
           AAK +LKK+ KI    +EN  A++     EENTE   + S+N D+  K
Sbjct: 269 AAKKKLKKVDKIEELDQENEAALENGIKNEENTEPGAESSENADDPNK 316


>AF117236-1|AAF17217.1|  848|Homo sapiens matrin 3 protein.
          Length = 848

 Score = 31.9 bits (69), Expect = 3.1
 Identities = 20/48 (41%), Positives = 28/48 (58%), Gaps = 5/48 (10%)
 Frame = +2

Query: 287 AAKSQLKKIQKIWV--RENYKAMDKAKAEEENTE---KRSQNLDEAKK 415
           AAK +LKK+ KI    +EN  A++     EENTE   + S+N D+  K
Sbjct: 710 AAKKKLKKVDKIEELDQENEAALENGIKNEENTEPGAESSENADDPNK 757


>AB018266-1|BAA34443.2|  853|Homo sapiens KIAA0723 protein protein.
          Length = 853

 Score = 31.9 bits (69), Expect = 3.1
 Identities = 20/48 (41%), Positives = 28/48 (58%), Gaps = 5/48 (10%)
 Frame = +2

Query: 287 AAKSQLKKIQKIWV--RENYKAMDKAKAEEENTE---KRSQNLDEAKK 415
           AAK +LKK+ KI    +EN  A++     EENTE   + S+N D+  K
Sbjct: 715 AAKKKLKKVDKIEELDQENEAALENGIKNEENTEPGAESSENADDPNK 762


>Z84487-2|CAI42674.1| 2492|Homo sapiens alpha thalassemia/mental
            retardation syndrome X-linked (RAD54 homolog, S. cerev
            protein.
          Length = 2492

 Score = 30.3 bits (65), Expect = 9.6
 Identities = 15/45 (33%), Positives = 28/45 (62%)
 Frame = +2

Query: 299  QLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQED 433
            Q KK ++I V+E+  + +K+ +EEE  EK  +  +E ++   +ED
Sbjct: 1421 QKKKRRRIKVQEDSSSENKSNSEEEEEEKEEEEEEEEEEEEEEED 1465


>Z84487-1|CAI42675.1| 2454|Homo sapiens alpha thalassemia/mental
            retardation syndrome X-linked (RAD54 homolog, S. cerev
            protein.
          Length = 2454

 Score = 30.3 bits (65), Expect = 9.6
 Identities = 15/45 (33%), Positives = 28/45 (62%)
 Frame = +2

Query: 299  QLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQED 433
            Q KK ++I V+E+  + +K+ +EEE  EK  +  +E ++   +ED
Sbjct: 1383 QKKKRRRIKVQEDSSSENKSNSEEEEEEKEEEEEEEEEEEEEEED 1427


>U97103-1|AAC51657.1| 2375|Homo sapiens X-linked nuclear protein
            protein.
          Length = 2375

 Score = 30.3 bits (65), Expect = 9.6
 Identities = 15/45 (33%), Positives = 28/45 (62%)
 Frame = +2

Query: 299  QLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQED 433
            Q KK ++I V+E+  + +K+ +EEE  EK  +  +E ++   +ED
Sbjct: 1304 QKKKRRRIKVQEDSSSENKSNSEEEEEEKEEEEEEEEEEEEEEED 1348


>U75653-1|AAC51655.1| 2492|Homo sapiens zinc finger helicase protein.
          Length = 2492

 Score = 30.3 bits (65), Expect = 9.6
 Identities = 15/45 (33%), Positives = 28/45 (62%)
 Frame = +2

Query: 299  QLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQED 433
            Q KK ++I V+E+  + +K+ +EEE  EK  +  +E ++   +ED
Sbjct: 1421 QKKKRRRIKVQEDSSSENKSNSEEEEEEKEEEEEEEEEEEEEEED 1465


>U72938-1|AAB49971.2| 2454|Homo sapiens putative DNA dependent ATPase
            and helicase protein.
          Length = 2454

 Score = 30.3 bits (65), Expect = 9.6
 Identities = 15/45 (33%), Positives = 28/45 (62%)
 Frame = +2

Query: 299  QLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQED 433
            Q KK ++I V+E+  + +K+ +EEE  EK  +  +E ++   +ED
Sbjct: 1383 QKKKRRRIKVQEDSSSENKSNSEEEEEEKEEEEEEEEEEEEEEED 1427


>U72937-1|AAB49970.2| 2492|Homo sapiens putative DNA dependent ATPase
            and helicase protein.
          Length = 2492

 Score = 30.3 bits (65), Expect = 9.6
 Identities = 15/45 (33%), Positives = 28/45 (62%)
 Frame = +2

Query: 299  QLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQED 433
            Q KK ++I V+E+  + +K+ +EEE  EK  +  +E ++   +ED
Sbjct: 1421 QKKKRRRIKVQEDSSSENKSNSEEEEEEKEEEEEEEEEEEEEEED 1465


>U72936-1|AAB49969.1| 2288|Homo sapiens putative DNA dependent ATPase
            and helicase protein.
          Length = 2288

 Score = 30.3 bits (65), Expect = 9.6
 Identities = 15/45 (33%), Positives = 28/45 (62%)
 Frame = +2

Query: 299  QLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQED 433
            Q KK ++I V+E+  + +K+ +EEE  EK  +  +E ++   +ED
Sbjct: 1217 QKKKRRRIKVQEDSSSENKSNSEEEEEEKEEEEEEEEEEEEEEED 1261


>U72935-3|AAB40700.1| 2288|Homo sapiens putative DNA dependent ATPase
            and helicase protein.
          Length = 2288

 Score = 30.3 bits (65), Expect = 9.6
 Identities = 15/45 (33%), Positives = 28/45 (62%)
 Frame = +2

Query: 299  QLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQED 433
            Q KK ++I V+E+  + +K+ +EEE  EK  +  +E ++   +ED
Sbjct: 1217 QKKKRRRIKVQEDSSSENKSNSEEEEEEKEEEEEEEEEEEEEEED 1261


>U72935-2|AAB40699.1| 2337|Homo sapiens putative DNA dependent ATPase
            and helicase protein.
          Length = 2337

 Score = 30.3 bits (65), Expect = 9.6
 Identities = 15/45 (33%), Positives = 28/45 (62%)
 Frame = +2

Query: 299  QLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQED 433
            Q KK ++I V+E+  + +K+ +EEE  EK  +  +E ++   +ED
Sbjct: 1266 QKKKRRRIKVQEDSSSENKSNSEEEEEEKEEEEEEEEEEEEEEED 1310


>U72935-1|AAB40698.1| 2375|Homo sapiens putative DNA dependent ATPase
            and helicase protein.
          Length = 2375

 Score = 30.3 bits (65), Expect = 9.6
 Identities = 15/45 (33%), Positives = 28/45 (62%)
 Frame = +2

Query: 299  QLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQED 433
            Q KK ++I V+E+  + +K+ +EEE  EK  +  +E ++   +ED
Sbjct: 1304 QKKKRRRIKVQEDSSSENKSNSEEEEEEKEEEEEEEEEEEEEEED 1348


>U09820-1|AAC50069.1| 1641|Homo sapiens helicase II protein.
          Length = 1641

 Score = 30.3 bits (65), Expect = 9.6
 Identities = 15/45 (33%), Positives = 28/45 (62%)
 Frame = +2

Query: 299 QLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQED 433
           Q KK ++I V+E+  + +K+ +EEE  EK  +  +E ++   +ED
Sbjct: 562 QKKKRRRIKVQEDSSSENKSNSEEEEEEKEEEEEEEEEEEEEEED 606


>L34363-1|AAA20872.1| 1298|Homo sapiens X-linked nuclear protein
           protein.
          Length = 1298

 Score = 30.3 bits (65), Expect = 9.6
 Identities = 15/45 (33%), Positives = 28/45 (62%)
 Frame = +2

Query: 299 QLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQED 433
           Q KK ++I V+E+  + +K+ +EEE  EK  +  +E ++   +ED
Sbjct: 301 QKKKRRRIKVQEDSSSENKSNSEEEEEEKEEEEEEEEEEEEEEED 345


>EF467914-1|ABO43036.1| 2492|Homo sapiens alpha thalassemia/mental
            retardation syndrome X-linked protein.
          Length = 2492

 Score = 30.3 bits (65), Expect = 9.6
 Identities = 15/45 (33%), Positives = 28/45 (62%)
 Frame = +2

Query: 299  QLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQED 433
            Q KK ++I V+E+  + +K+ +EEE  EK  +  +E ++   +ED
Sbjct: 1421 QKKKRRRIKVQEDSSSENKSNSEEEEEEKEEEEEEEEEEEEEEED 1465


>AL121874-2|CAI40710.1| 2492|Homo sapiens alpha thalassemia/mental
            retardation syndrome X-linked (RAD54 homolog, S. cerev
            protein.
          Length = 2492

 Score = 30.3 bits (65), Expect = 9.6
 Identities = 15/45 (33%), Positives = 28/45 (62%)
 Frame = +2

Query: 299  QLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQED 433
            Q KK ++I V+E+  + +K+ +EEE  EK  +  +E ++   +ED
Sbjct: 1421 QKKKRRRIKVQEDSSSENKSNSEEEEEEKEEEEEEEEEEEEEEED 1465


>AL121874-1|CAB90351.2| 2454|Homo sapiens alpha thalassemia/mental
            retardation syndrome X-linked (RAD54 homolog, S. cerev
            protein.
          Length = 2454

 Score = 30.3 bits (65), Expect = 9.6
 Identities = 15/45 (33%), Positives = 28/45 (62%)
 Frame = +2

Query: 299  QLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQED 433
            Q KK ++I V+E+  + +K+ +EEE  EK  +  +E ++   +ED
Sbjct: 1383 QKKKRRRIKVQEDSSSENKSNSEEEEEEKEEEEEEEEEEEEEEED 1427


>AL109753-2|CAI43115.1| 2492|Homo sapiens alpha thalassemia/mental
            retardation syndrome X-linked (RAD54 homolog, S. cerev
            protein.
          Length = 2492

 Score = 30.3 bits (65), Expect = 9.6
 Identities = 15/45 (33%), Positives = 28/45 (62%)
 Frame = +2

Query: 299  QLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQED 433
            Q KK ++I V+E+  + +K+ +EEE  EK  +  +E ++   +ED
Sbjct: 1421 QKKKRRRIKVQEDSSSENKSNSEEEEEEKEEEEEEEEEEEEEEED 1465


>AL109753-1|CAI43116.1| 2454|Homo sapiens alpha thalassemia/mental
            retardation syndrome X-linked (RAD54 homolog, S. cerev
            protein.
          Length = 2454

 Score = 30.3 bits (65), Expect = 9.6
 Identities = 15/45 (33%), Positives = 28/45 (62%)
 Frame = +2

Query: 299  QLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQED 433
            Q KK ++I V+E+  + +K+ +EEE  EK  +  +E ++   +ED
Sbjct: 1383 QKKKRRRIKVQEDSSSENKSNSEEEEEEKEEEEEEEEEEEEEEED 1427


>AB209545-1|BAD92782.1| 1224|Homo sapiens transcriptional regulator
           ATRX isoform 1 variant protein.
          Length = 1224

 Score = 30.3 bits (65), Expect = 9.6
 Identities = 15/45 (33%), Positives = 28/45 (62%)
 Frame = +2

Query: 299 QLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQED 433
           Q KK ++I V+E+  + +K+ +EEE  EK  +  +E ++   +ED
Sbjct: 718 QKKKRRRIKVQEDSSSENKSNSEEEEEEKEEEEEEEEEEEEEEED 762


>AB102641-1|BAC81110.1| 2492|Homo sapiens ATRX protein.
          Length = 2492

 Score = 30.3 bits (65), Expect = 9.6
 Identities = 15/45 (33%), Positives = 28/45 (62%)
 Frame = +2

Query: 299  QLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQED 433
            Q KK ++I V+E+  + +K+ +EEE  EK  +  +E ++   +ED
Sbjct: 1421 QKKKRRRIKVQEDSSSENKSNSEEEEEEKEEEEEEEEEEEEEEED 1465


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 129,262,497
Number of Sequences: 237096
Number of extensions: 2893353
Number of successful extensions: 7065
Number of sequences better than 10.0: 28
Number of HSP's better than 10.0 without gapping: 6524
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7061
length of database: 76,859,062
effective HSP length: 90
effective length of database: 55,520,422
effective search space used: 11159604822
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -