SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30135.Seq
         (856 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X04098-1|CAA27723.1|  375|Homo sapiens gamma-actin protein.           185   2e-46
X00351-1|CAA25099.1|  375|Homo sapiens protein ( Human mRNA for ...   185   2e-46
M19283-1|AAA51579.1|  375|Homo sapiens ACTG1 protein.                 185   2e-46
M10277-1|AAA51567.1|  375|Homo sapiens protein ( Human cytoplasm...   185   2e-46
DQ471327-1|ABF01018.1|  375|Homo sapiens PS1TP5-binding protein ...   185   2e-46
BT019856-1|AAV38659.1|  375|Homo sapiens actin, gamma 1 protein.      185   2e-46
BC053572-1|AAH53572.1|  375|Homo sapiens actin, gamma 1 protein.      185   2e-46
BC018774-1|AAH18774.1|  375|Homo sapiens ACTG1 protein protein.       185   2e-46
BC017450-1|AAH17450.1|  363|Homo sapiens Unknown (protein for IM...   185   2e-46
BC015779-1|AAH15779.1|  375|Homo sapiens ACTG1 protein protein.       185   2e-46
BC015695-1|AAH15695.1|  375|Homo sapiens actin, gamma 1 protein.      185   2e-46
BC015005-1|AAH15005.1|  375|Homo sapiens ACTG1 protein protein.       185   2e-46
BC014861-1|AAH14861.1|  375|Homo sapiens actin, beta protein.         185   2e-46
BC013380-1|AAH13380.1|  375|Homo sapiens actin, beta protein.         185   2e-46
BC012050-1|AAH12050.1|  375|Homo sapiens actin, gamma 1 protein.      185   2e-46
BC010999-1|AAH10999.1|  375|Homo sapiens actin, gamma 1 protein.      185   2e-46
BC009848-1|AAH09848.1|  375|Homo sapiens actin, gamma 1 protein.      185   2e-46
BC008633-1|AAH08633.1|  368|Homo sapiens actin, beta protein.         185   2e-46
BC007442-1|AAH07442.1|  375|Homo sapiens actin, gamma 1 protein.      185   2e-46
BC004251-1|AAH04251.1|  375|Homo sapiens actin, beta protein.         185   2e-46
BC002409-1|AAH02409.1|  375|Homo sapiens actin, beta protein.         185   2e-46
BC001920-1|AAH01920.1|  375|Homo sapiens ACTG1 protein protein.       185   2e-46
BC001301-1|AAH01301.1|  375|Homo sapiens actin, beta protein.         185   2e-46
BC000292-1|AAH00292.1|  375|Homo sapiens actin, gamma 1 protein.      185   2e-46
AY582799-1|AAS79319.1|  375|Homo sapiens actin, beta protein.         185   2e-46
AK223055-1|BAD96775.1|  375|Homo sapiens beta actin variant prot...   185   2e-46
AK223032-1|BAD96752.1|  375|Homo sapiens beta actin variant prot...   185   2e-46
AK222925-1|BAD96645.1|  375|Homo sapiens beta actin variant prot...   185   2e-46
AC006483-1|AAP22343.1|  375|Homo sapiens unknown protein.             185   2e-46
X63432-1|CAA45026.1|  375|Homo sapiens mutant beta-actin  (beta'...   184   4e-46
BC016045-1|AAH16045.1|  375|Homo sapiens actin, beta protein.         183   6e-46
BC012854-1|AAH12854.1|  360|Homo sapiens ACTB protein protein.        182   1e-45
M20543-1|AAA60296.1|  377|Homo sapiens ACTA1 protein.                 181   3e-45
J00073-1|AAB59619.1|  377|Homo sapiens alpha-cardiac actin protein.   181   3e-45
J00068-1|AAB59376.1|  377|Homo sapiens ACTA1 protein.                 181   3e-45
CR541796-1|CAG46595.1|  377|Homo sapiens ACTA1 protein.               181   3e-45
CR541795-1|CAG46594.1|  377|Homo sapiens ACTC protein.                181   3e-45
CR536516-1|CAG38754.1|  377|Homo sapiens ACTA1 protein.               181   3e-45
BC012597-1|AAH12597.1|  377|Homo sapiens actin, alpha 1, skeleta...   181   3e-45
BC009978-1|AAH09978.1|  377|Homo sapiens actin, alpha, cardiac m...   181   3e-45
AY280960-1|AAP37280.1|  254|Homo sapiens actin alpha 1 skeletal ...   181   3e-45
AL160004-6|CAI19050.1|  377|Homo sapiens actin, alpha 1, skeleta...   181   3e-45
AF182035-1|AAF02694.1|  377|Homo sapiens skeletal muscle alpha-a...   181   3e-45
EF523384-1|ABP57734.1| 1075|Homo sapiens POTE-2 alpha-actin prot...   180   4e-45
X16940-1|CAA34814.1|  376|Homo sapiens protein ( Human mRNA for ...   180   8e-45
X13839-1|CAA32064.1|  377|Homo sapiens protein ( Human mRNA for ...   180   8e-45
K01747-1|AAA51586.1|  330|Homo sapiens ACTA2 protein.                 180   8e-45
J05192-1|AAA51577.1|  377|Homo sapiens ACTA3 protein.                 180   8e-45
D00654-1|BAA00546.1|  376|Homo sapiens enteric smooth muscle gam...   180   8e-45
CR541794-1|CAG46593.1|  376|Homo sapiens ACTG2 protein.               180   8e-45
CR536518-1|CAG38756.1|  377|Homo sapiens ACTA2 protein.               180   8e-45
BC094877-1|AAH94877.1|  376|Homo sapiens ACTG2 protein protein.       180   8e-45
BC093052-1|AAH93052.1|  377|Homo sapiens actin, alpha 2, smooth ...   180   8e-45
BC017554-1|AAH17554.1|  377|Homo sapiens actin, alpha 2, smooth ...   180   8e-45
BC012617-1|AAH12617.1|  376|Homo sapiens actin, gamma 2, smooth ...   180   8e-45
AY692464-1|AAW29811.1|  377|Homo sapiens growth-inhibiting gene ...   180   8e-45
AL157394-7|CAI13865.1|  151|Homo sapiens actin, alpha 2, smooth ...   180   8e-45
AL157394-6|CAI13864.1|  377|Homo sapiens actin, alpha 2, smooth ...   180   8e-45
AC073046-2|AAX88909.1|  376|Homo sapiens unknown protein.             180   8e-45
CR536515-1|CAG38753.1|  376|Homo sapiens ACTG2 protein.               179   1e-44
EF095209-1|ABL01513.1|  121|Homo sapiens beta-actin protein.          165   1e-40
AY129015-1|AAM98758.1|  109|Homo sapiens unknown protein.             140   6e-33
AL160004-4|CAI19051.1|  287|Homo sapiens actin, alpha 1, skeleta...   134   3e-31
AY970501-1|AAX82307.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970499-1|AAX82305.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970498-1|AAX82304.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970497-1|AAX82303.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970495-1|AAX82301.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970494-1|AAX82300.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970493-1|AAX82299.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970491-1|AAX82297.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970489-1|AAX82295.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970488-1|AAX82294.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970487-1|AAX82293.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970486-1|AAX82292.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970479-1|AAX82285.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970478-1|AAX82284.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970477-1|AAX82283.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970476-1|AAX82282.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970474-1|AAX82280.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970473-1|AAX82279.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970472-1|AAX82278.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970471-1|AAX82277.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970470-1|AAX82276.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970469-1|AAX82275.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970468-1|AAX82274.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970443-1|AAX82252.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970441-1|AAX82250.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970420-1|AAX82229.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970419-1|AAX82228.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970418-1|AAX82227.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970417-1|AAX82226.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970416-1|AAX82225.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970415-1|AAX82224.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970414-1|AAX82223.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970413-1|AAX82222.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970412-1|AAX82221.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970411-1|AAX82220.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970410-1|AAX82219.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970409-1|AAX82218.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970408-1|AAX82217.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970406-1|AAX82215.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970405-1|AAX82214.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970404-1|AAX82213.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970403-1|AAX82212.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970402-1|AAX82211.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970383-1|AAX82192.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970382-1|AAX82191.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970381-1|AAX82190.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970380-1|AAX82189.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970377-1|AAX82186.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970376-1|AAX82185.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970375-1|AAX82184.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970372-1|AAX82182.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970371-1|AAX82181.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970370-1|AAX82180.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970369-1|AAX82179.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970368-1|AAX82178.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970366-1|AAX82176.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970364-1|AAX82174.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970363-1|AAX82173.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
BC023548-1|AAH23548.1|  263|Homo sapiens ACTG1 protein protein.       128   2e-29
AY970502-1|AAX82308.1|  103|Homo sapiens actin-like protein prot...   128   2e-29
AY970480-1|AAX82286.1|  103|Homo sapiens actin-like protein prot...   128   2e-29
AY970464-1|AAX82271.1|  103|Homo sapiens actin-like protein prot...   128   2e-29
AY970460-1|AAX82267.1|  103|Homo sapiens actin-like protein prot...   128   2e-29
AY970457-1|AAX82264.1|  103|Homo sapiens actin-like protein prot...   128   2e-29
AY970446-1|AAX82255.1|  103|Homo sapiens actin-like protein prot...   128   2e-29
AY970431-1|AAX82240.1|  103|Homo sapiens actin-like protein prot...   128   2e-29
AY970430-1|AAX82239.1|  103|Homo sapiens actin-like protein prot...   128   2e-29
AY970428-1|AAX82237.1|  103|Homo sapiens actin-like protein prot...   128   2e-29
AY970421-1|AAX82230.1|  103|Homo sapiens actin-like protein prot...   128   2e-29
AY970390-1|AAX82199.1|  103|Homo sapiens actin-like protein prot...   128   2e-29
AY970389-1|AAX82198.1|  103|Homo sapiens actin-like protein prot...   128   2e-29
AY970386-1|AAX82195.1|  103|Homo sapiens actin-like protein prot...   128   2e-29
AY970378-1|AAX82187.1|  103|Homo sapiens actin-like protein prot...   128   2e-29
AL160004-5|CAI19052.1|  342|Homo sapiens actin, alpha 1, skeleta...   128   3e-29
AY970492-1|AAX82298.1|  103|Homo sapiens actin-like protein prot...   128   3e-29
AY970490-1|AAX82296.1|  103|Homo sapiens actin-like protein prot...   127   4e-29
AY970444-1|AAX82253.1|  103|Homo sapiens actin-like protein prot...   127   4e-29
AY970500-1|AAX82306.1|  103|Homo sapiens actin-like protein prot...   127   6e-29
AY970456-1|AAX82263.1|  103|Homo sapiens actin-like protein prot...   127   6e-29
AY970442-1|AAX82251.1|  103|Homo sapiens actin-like protein prot...   127   6e-29
AY970429-1|AAX82238.1|  103|Homo sapiens actin-like protein prot...   127   6e-29
AY970388-1|AAX82197.1|  103|Homo sapiens actin-like protein prot...   127   6e-29
AY970387-1|AAX82196.1|  103|Homo sapiens actin-like protein prot...   127   6e-29
AY970463-1|AAX82270.1|  103|Homo sapiens actin-like protein prot...   126   8e-29
AY970458-1|AAX82265.1|  103|Homo sapiens actin-like protein prot...   126   8e-29
AY970432-1|AAX82241.1|  103|Homo sapiens actin-like protein prot...   126   8e-29
AY970392-1|AAX82201.1|  103|Homo sapiens actin-like protein prot...   126   8e-29
AY970385-1|AAX82194.1|  103|Homo sapiens actin-like protein prot...   126   8e-29
AY970374-1|AAX82183.1|  103|Homo sapiens actin-like protein prot...   126   8e-29
AY970485-1|AAX82291.1|  103|Homo sapiens actin-like protein prot...   126   1e-28
AY970391-1|AAX82200.1|  103|Homo sapiens actin-like protein prot...   126   1e-28
AY970365-1|AAX82175.1|  103|Homo sapiens actin-like protein prot...   126   1e-28
M16247-1|AAA51580.1|  232|Homo sapiens ACTG1 protein.                 126   1e-28
AY970496-1|AAX82302.1|  103|Homo sapiens actin-like protein prot...   126   1e-28
AY970462-1|AAX82269.1|  103|Homo sapiens actin-like protein prot...   126   1e-28
AY970426-1|AAX82235.1|  103|Homo sapiens actin-like protein prot...   126   1e-28
AY970367-1|AAX82177.1|  103|Homo sapiens actin-like protein prot...   126   1e-28
AY970454-1|AAX82261.1|  103|Homo sapiens actin-like protein prot...   125   2e-28
AY970455-1|AAX82262.1|  103|Homo sapiens actin-like protein prot...   125   2e-28
AY970483-1|AAX82289.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970440-1|AAX82249.1|  103|Homo sapiens actin-like protein prot...   124   5e-28
AY970439-1|AAX82248.1|  103|Homo sapiens actin-like protein prot...   124   5e-28
AY970475-1|AAX82281.1|  103|Homo sapiens actin-like protein prot...   123   7e-28
AY970461-1|AAX82268.1|  103|Homo sapiens actin-like protein prot...   123   7e-28
AY970407-1|AAX82216.1|  103|Homo sapiens actin-like protein prot...   122   2e-27
AY970427-1|AAX82236.1|  103|Homo sapiens actin-like protein prot...   121   3e-27
AY970451-1|AAX82259.1|  103|Homo sapiens actin-like protein prot...   121   4e-27
AY970384-1|AAX82193.1|  103|Homo sapiens actin-like protein prot...   121   4e-27
AY970424-1|AAX82233.1|  103|Homo sapiens actin-like protein prot...   120   7e-27
AY970481-1|AAX82287.1|  103|Homo sapiens actin-like protein prot...   120   9e-27
X82208-1|CAA57692.1|  329|Homo sapiens beta-centractin protein.       119   1e-26
X82207-1|CAA57691.1|  376|Homo sapiens beta-centracetin protein.      119   1e-26
BC010090-1|AAH10090.1|  376|Homo sapiens ARP1 actin-related prot...   119   1e-26
BC006372-1|AAH06372.1|  376|Homo sapiens ARP1 actin-related prot...   119   1e-26
BC004374-1|AAH04374.1|  376|Homo sapiens ARP1 actin-related prot...   119   1e-26
AY970452-1|AAX82260.1|  103|Homo sapiens actin-like protein prot...   119   1e-26
AY970448-1|AAX82257.1|  103|Homo sapiens actin-like protein prot...   119   1e-26
AY970447-1|AAX82256.1|  103|Homo sapiens actin-like protein prot...   119   1e-26
AC017099-2|AAY24280.1|  376|Homo sapiens unknown protein.             119   1e-26
AY970433-1|AAX82242.1|  103|Homo sapiens actin-like protein prot...   118   2e-26
AY970425-1|AAX82234.1|  103|Homo sapiens actin-like protein prot...   118   2e-26
Z14978-1|CAA78701.1|  376|Homo sapiens actin-related protein pro...   118   4e-26
X82206-1|CAA57690.1|  376|Homo sapiens alpha-centractin protein.      118   4e-26
BC026016-1|AAH26016.1|  376|Homo sapiens ARP1 actin-related prot...   118   4e-26
BC000693-1|AAH00693.1|  376|Homo sapiens ARP1 actin-related prot...   118   4e-26
AL121928-12|CAC08404.1|  376|Homo sapiens ARP1 actin-related pro...   118   4e-26
AY970459-1|AAX82266.1|  103|Homo sapiens actin-like protein prot...   117   6e-26
BC113036-1|AAI13037.1|  103|Homo sapiens ACTB protein protein.        114   4e-25
AY970398-1|AAX82207.1|  103|Homo sapiens actin-like protein prot...   113   6e-25
AY970396-1|AAX82205.1|  103|Homo sapiens actin-like protein prot...   113   8e-25
AY970395-1|AAX82204.1|  103|Homo sapiens actin-like protein prot...   113   8e-25
AY970400-1|AAX82209.1|  103|Homo sapiens actin-like protein prot...   111   2e-24
AY970379-1|AAX82188.1|  103|Homo sapiens actin-like protein prot...   111   3e-24
AY970438-1|AAX82247.1|  103|Homo sapiens actin-like protein prot...   110   5e-24
AY970467-1|AAX82273.1|  103|Homo sapiens actin-like protein prot...   110   7e-24
AY970422-1|AAX82231.1|  103|Homo sapiens actin-like protein prot...   110   7e-24
AY970401-1|AAX82210.1|  103|Homo sapiens actin-like protein prot...   110   7e-24
AY970445-1|AAX82254.1|  103|Homo sapiens actin-like protein prot...   109   1e-23
AY970423-1|AAX82232.1|  103|Homo sapiens actin-like protein prot...   108   2e-23
AY970484-1|AAX82290.1|  103|Homo sapiens actin-like protein prot...   108   3e-23
AY970465-1|AAX82272.1|  103|Homo sapiens actin-like protein prot...   106   9e-23
AY970436-1|AAX82245.1|  103|Homo sapiens actin-like protein prot...   105   2e-22
AY970503-1|AAX82309.1|  103|Homo sapiens actin-like protein prot...   105   2e-22
AY970437-1|AAX82246.1|  103|Homo sapiens actin-like protein prot...   105   2e-22
AY970394-1|AAX82203.1|  103|Homo sapiens actin-like protein prot...   105   3e-22
AY970434-1|AAX82243.1|  103|Homo sapiens actin-like protein prot...   103   8e-22
AY970435-1|AAX82244.1|  103|Homo sapiens actin-like protein prot...   102   2e-21
AY970482-1|AAX82288.1|  103|Homo sapiens actin-like protein prot...   101   3e-21
AY970450-1|AAX82258.1|  102|Homo sapiens actin-like protein prot...   101   3e-21
AY970397-1|AAX82206.1|  103|Homo sapiens actin-like protein prot...   100   6e-21
Z74696-1|CAI42428.1|  376|Homo sapiens actin-related protein T1 ...    99   1e-20
BC014597-1|AAH14597.1|  376|Homo sapiens actin-related protein T...    99   1e-20
AF440739-1|AAM00432.1|  376|Homo sapiens actin-related protein T...    99   1e-20
BC029499-1|AAH29499.1|  376|Homo sapiens actin-related protein T...    98   4e-20
AL356984-1|CAH72587.1|  377|Homo sapiens actin-related protein M...    98   4e-20
AK058153-1|BAB71690.1|  328|Homo sapiens protein ( Homo sapiens ...    98   4e-20
AF440740-1|AAM00433.1|  377|Homo sapiens actin-related protein T...    98   4e-20
AB057364-1|BAB85862.1|  377|Homo sapiens actin-related protein h...    98   4e-20
BC014610-1|AAH14610.1|  435|Homo sapiens actin-like 7A protein.        97   7e-20
AL359692-4|CAI40571.1|  435|Homo sapiens actin-like 7A protein.        97   7e-20
AF113526-1|AAD44109.1|  435|Homo sapiens actin-like-7-alpha prot...    97   7e-20
AB284520-1|BAF41971.1|  435|Homo sapiens human t-actin 2 protein.      97   7e-20
AY970393-1|AAX82202.1|  103|Homo sapiens actin-like protein prot...    97   9e-20
AK055346-1|BAB70906.1|  372|Homo sapiens protein ( Homo sapiens ...    96   2e-19
AB049117-1|BAB39481.1|  372|Homo sapiens actin related protein p...    96   2e-19
BC036253-1|AAH36253.1|  339|Homo sapiens ACTR2 protein protein.        94   5e-19
AF006082-1|AAB64187.1|  394|Homo sapiens Arp2 protein.                 94   5e-19
BC014546-1|AAH14546.1|  394|Homo sapiens ARP2 actin-related prot...    93   9e-19
BC033789-1|AAH33789.1|  415|Homo sapiens actin-like 7B protein.        92   2e-18
AL359692-3|CAI40570.1|  415|Homo sapiens actin-like 7B protein.        92   2e-18
AF113527-1|AAD44110.1|  415|Homo sapiens actin-like-7-beta protein.    92   2e-18
AB284521-1|BAF41972.1|  415|Homo sapiens t-actin 1 protein.            92   2e-18
BC044590-1|AAH44590.1|  418|Homo sapiens ARP3 actin-related prot...    92   3e-18
AF127773-1|AAD51904.1|  418|Homo sapiens unknown protein.              92   3e-18
AF006083-1|AAB64188.1|  418|Homo sapiens Arp3 protein.                 92   3e-18
AC110769-1|AAX93226.1|  418|Homo sapiens unknown protein.              92   3e-18
AB209353-1|BAD92590.1|  369|Homo sapiens ARP3 actin-related prot...    92   3e-18
BC015207-1|AAH15207.1|  348|Homo sapiens ARP3 actin-related prot...    91   4e-18
BC008682-1|AAH08682.1|  418|Homo sapiens ARP3 actin-related prot...    91   4e-18
AF086920-1|AAP97150.1|  402|Homo sapiens actin related protein A...    91   4e-18
AF023453-1|AAC98904.1|  418|Homo sapiens actin-related protein 3...    91   4e-18
BC045752-1|AAH45752.1|  416|Homo sapiens hypothetical protein MG...    91   6e-18
BC024028-1|AAH24028.1|  416|Homo sapiens hypothetical protein MG...    91   6e-18
BC007289-1|AAH07289.1|  372|Homo sapiens actin related protein M...    91   6e-18
AY970399-1|AAX82208.1|   97|Homo sapiens actin-like protein prot...    85   3e-16
BC020944-1|AAH20944.1|  426|Homo sapiens actin-like 6B protein.        74   8e-13
AF053356-5|AAC78795.1|  475|Homo sapiens actin like gene protein.      74   8e-13
AF041475-1|AAD54678.1|  426|Homo sapiens BAF53b protein.               74   8e-13
AC099394-1|AAP21874.1|  426|Homo sapiens unknown protein.              74   8e-13
AB015906-1|BAA74576.1|  426|Homo sapiens actin-related protein h...    74   8e-13
BC036371-1|AAH36371.1|  429|Homo sapiens actin-like 6A protein.        73   1e-12
BC001391-1|AAH01391.1|  429|Homo sapiens actin-like 6A protein.        73   1e-12
BC000949-1|AAH00949.1|  387|Homo sapiens actin-like 6A protein.        73   1e-12
AK223212-1|BAD96932.1|  429|Homo sapiens actin-like 6A isoform 1...    73   1e-12
AF041474-1|AAC94991.1|  429|Homo sapiens BAF53a protein.               73   1e-12
AB061315-1|BAB87848.1|  387|Homo sapiens hArpNbeta-s protein.          73   1e-12
AB060168-1|BAB87844.1|  387|Homo sapiens hArpNbeta-s protein.          73   1e-12
AB015907-1|BAA74577.1|  429|Homo sapiens actin-related protein h...    73   1e-12
CR533529-1|CAG38560.1|  429|Homo sapiens BAF53A protein.               73   2e-12
BC028909-1|AAH28909.1|  366|Homo sapiens actin-like 8 protein.         66   2e-10
AL136529-1|CAC15940.1|  366|Homo sapiens actin-like 8 protein.         66   2e-10
AK057339-1|BAB71434.1|  366|Homo sapiens protein ( Homo sapiens ...    66   2e-10
BC092424-1|AAH92424.1|  219|Homo sapiens Unknown (protein for MG...    60   1e-08
AB209174-1|BAD92411.1|  282|Homo sapiens actin-related protein 3...    56   2e-07
AB039791-1|BAB21501.1|  210|Homo sapiens actin-related protein A...    56   2e-07
BC038402-1|AAH38402.1|  607|Homo sapiens ARP5 actin-related prot...    44   7e-04
AY211911-1|AAO65164.1|  280|Homo sapiens sarcoma antigen NY-SAR-...    44   7e-04
AL133519-2|CAD37358.1|  607|Homo sapiens ARP5 actin-related prot...    44   7e-04
AK022847-1|BAB14270.1|  607|Homo sapiens protein ( Homo sapiens ...    44   7e-04
U20582-1|AAA62476.1|  302|Homo sapiens protein ( Human actin-lik...    44   0.001
BC004223-1|AAH04223.2|   32|Homo sapiens ACTG1 protein protein.        41   0.005
BC015107-1|AAH15107.1|  396|Homo sapiens ARP6 actin-related prot...    40   0.009
AK222959-1|BAD96679.1|  396|Homo sapiens ARP6 actin-related prot...    40   0.009
AK023495-1|BAB14588.1|  396|Homo sapiens protein ( Homo sapiens ...    40   0.009
AF212251-1|AAK14934.1|  396|Homo sapiens CDA12 protein.                40   0.009
AB038229-1|BAB20762.1|  396|Homo sapiens hARPX protein.                40   0.009
BC011997-1|AAH11997.1|  417|Homo sapiens actin-related protein 1...    39   0.027
BC005208-1|AAH05208.1|  339|Homo sapiens Unknown (protein for IM...    39   0.027
AK222702-1|BAD96422.1|  417|Homo sapiens uncharacterized hypotha...    39   0.027
AK222624-1|BAD96344.1|  417|Homo sapiens uncharacterized hypotha...    39   0.027
AK022534-1|BAB14083.1|  417|Homo sapiens protein ( Homo sapiens ...    39   0.027
AK000544-1|BAA91243.1|  417|Homo sapiens protein ( Homo sapiens ...    39   0.027
AF220190-1|AAF67655.1|  417|Homo sapiens uncharacterized hypotha...    39   0.027
BC020234-1|AAH20234.1|  195|Homo sapiens Unknown (protein for MG...    37   0.11 
AJ298318-1|CAC83675.1| 1349|Homo sapiens mucin 5 protein.              36   0.25 
L46721-1|AAC41774.1|  164|Homo sapiens mucin protein.                  35   0.33 
K00790-1|AAA51578.1|   17|Homo sapiens ACTB protein.                   34   0.57 
Y11411-1|CAA72214.1|  700|Homo sapiens pristanoyl-CoA oxidase pr...    33   1.0  
M94131-1|AAA59163.1| 1270|Homo sapiens mucin protein.                  33   1.0  
M74027-1|AAA59875.1|  573|Homo sapiens mucin protein.                  33   1.0  
L21998-1|AAB95295.1| 5179|Homo sapiens mucin protein.                  33   1.0  
BC117331-1|AAI17332.1|  346|Homo sapiens selenoprotein V protein.      33   1.0  
BC017053-1|AAH17053.1|  624|Homo sapiens ACOX3 protein protein.        33   1.0  
AY324825-1|AAP85542.1|  346|Homo sapiens selenoprotein V protein.      33   1.0  
AF226732-1|AAG09733.1|  434|Homo sapiens NPD007 protein.               33   1.0  
AK027100-1|BAB15657.1|  363|Homo sapiens protein ( Homo sapiens ...    33   1.3  
AJ298317-1|CAC83674.1| 2448|Homo sapiens mucin 5 protein.              33   1.3  
AF217751-1|AAK51618.1|  587|Homo sapiens protocadherin-psi1 prot...    33   1.7  
M57417-1|AAA63229.2|  294|Homo sapiens mucin protein.                  32   2.3  
BC126315-1|AAI26316.1| 1224|Homo sapiens MUC17 protein protein.        32   2.3  
BC065199-1|AAH65199.1|  453|Homo sapiens family with sequence si...    32   2.3  
BC037572-1|AAH37572.1|  453|Homo sapiens family with sequence si...    32   2.3  
AL445686-3|CAI14683.1|  913|Homo sapiens serine/arginine repetit...    32   2.3  
AL445648-2|CAH73089.1|  913|Homo sapiens serine/arginine repetit...    32   2.3  
AJ606308-1|CAE54436.1| 4262|Homo sapiens secreted mucin MUC17 pr...    32   2.3  
AJ606307-1|CAE54435.1| 4493|Homo sapiens membrane mucin MUC17 pr...    32   2.3  
AF430017-1|AAL89737.1| 1029|Homo sapiens intestinal membrane muc...    32   2.3  
AF123073-1|AAK01477.1|  453|Homo sapiens C/EBP-induced protein p...    32   2.3  
AB183864-1|BAD86792.1| 1271|Homo sapiens diacylglycerol kinase k...    32   3.1  
Z34277-1|CAA84031.1|  477|Homo sapiens mucin protein.                  31   4.0  
M33518-1|AAA35586.1| 2142|Homo sapiens protein ( Human HLA-B-ass...    31   4.0  
M33509-1|AAA35585.1| 2142|Homo sapiens protein ( Human HLA-B-ass...    31   4.0  
M22405-1|AAA36334.1|  278|Homo sapiens protein ( Human intestina...    31   4.0  
BC146794-1|AAI46795.1| 1919|Homo sapiens discs, large homolog 5 ...    31   4.0  
BC073996-1|AAH73996.1|  845|Homo sapiens DLG5 protein protein.         31   4.0  
AL662801-47|CAI18313.1| 2157|Homo sapiens HLA-B associated trans...    31   4.0  
AL450306-3|CAI17324.2| 1919|Homo sapiens discs, large homolog 5 ...    31   4.0  
AL450306-2|CAI17323.1|  880|Homo sapiens discs, large homolog 5 ...    31   4.0  
AL391421-2|CAI12104.2| 1919|Homo sapiens discs, large homolog 5 ...    31   4.0  
AL391421-1|CAI12103.1|  880|Homo sapiens discs, large homolog 5 ...    31   4.0  
AK093503-1|BAC04187.1|  637|Homo sapiens protein ( Homo sapiens ...    31   4.0  
AF352034-1|AAL83938.1| 1809|Homo sapiens DLG5 protein.                 31   4.0  
AF352033-1|AAL83937.1| 1809|Homo sapiens DLG5 protein.                 31   4.0  
AB091676-1|BAC65420.1| 1764|Homo sapiens discs large protein lp-...    31   4.0  
AB089940-1|BAD02449.1|  998|Homo sapiens N-acetylgalactosaminylt...    31   4.0  
AB011155-1|BAA25509.2| 1952|Homo sapiens KIAA0583 protein protein.     31   4.0  
M22406-1|AAA36335.1|   76|Homo sapiens protein ( Human intestina...    31   5.3  
Z34281-1|CAA84035.1|   62|Homo sapiens mucin protein.                  31   7.1  
AK075058-1|BAC11375.1|  149|Homo sapiens protein ( Homo sapiens ...    31   7.1  
Z34278-1|CAA84032.1|  279|Homo sapiens mucin protein.                  30   9.3  
BC146774-1|AAI46775.1| 1114|Homo sapiens GPR124 protein protein.       30   9.3  
AY181242-1|AAO27354.1| 1331|Homo sapiens G protein-coupled recep...    30   9.3  
AK074099-1|BAB84925.1| 1310|Homo sapiens FLJ00170 protein protein.     30   9.3  
AJ298319-1|CAC83676.1|  372|Homo sapiens mucin 5 protein.              30   9.3  
AF378755-1|AAL11992.1| 1331|Homo sapiens tumor endothelial marke...    30   9.3  
AB040964-1|BAA96055.2| 1206|Homo sapiens KIAA1531 protein protein.     30   9.3  

>X04098-1|CAA27723.1|  375|Homo sapiens gamma-actin protein.
          Length = 375

 Score =  185 bits (451), Expect = 2e-46
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 58  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 117

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 118 KMTQIMFETFNTPAMYVAIQAVLSL 142



 Score =  128 bits (310), Expect = 2e-29
 Identities = 63/78 (80%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 143 YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 202

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 203 TAEREIVR-DIKEKLCYV 219



 Score =  122 bits (293), Expect = 2e-27
 Identities = 54/60 (90%), Positives = 59/60 (98%)
 Frame = +1

Query: 88  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE ++K
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>X00351-1|CAA25099.1|  375|Homo sapiens protein ( Human mRNA for
           beta-actin. ).
          Length = 375

 Score =  185 bits (451), Expect = 2e-46
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 58  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 117

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 118 KMTQIMFETFNTPAMYVAIQAVLSL 142



 Score =  128 bits (310), Expect = 2e-29
 Identities = 63/78 (80%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 143 YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 202

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 203 TAEREIVR-DIKEKLCYV 219



 Score =  121 bits (292), Expect = 3e-27
 Identities = 54/60 (90%), Positives = 59/60 (98%)
 Frame = +1

Query: 88  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE ++K
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>M19283-1|AAA51579.1|  375|Homo sapiens ACTG1 protein.
          Length = 375

 Score =  185 bits (451), Expect = 2e-46
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 58  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 117

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 118 KMTQIMFETFNTPAMYVAIQAVLSL 142



 Score =  128 bits (310), Expect = 2e-29
 Identities = 63/78 (80%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 143 YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 202

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 203 TAEREIVR-DIKEKLCYV 219



 Score =  122 bits (293), Expect = 2e-27
 Identities = 54/60 (90%), Positives = 59/60 (98%)
 Frame = +1

Query: 88  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE ++K
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>M10277-1|AAA51567.1|  375|Homo sapiens protein ( Human cytoplasmic
           beta-actin gene, complete cds. ).
          Length = 375

 Score =  185 bits (451), Expect = 2e-46
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 58  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 117

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 118 KMTQIMFETFNTPAMYVAIQAVLSL 142



 Score =  128 bits (310), Expect = 2e-29
 Identities = 63/78 (80%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 143 YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 202

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 203 TAEREIVR-DIKEKLCYV 219



 Score =  121 bits (292), Expect = 3e-27
 Identities = 54/60 (90%), Positives = 59/60 (98%)
 Frame = +1

Query: 88  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE ++K
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>DQ471327-1|ABF01018.1|  375|Homo sapiens PS1TP5-binding protein 1
           protein.
          Length = 375

 Score =  185 bits (451), Expect = 2e-46
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 58  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 117

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 118 KMTQIMFETFNTPAMYVAIQAVLSL 142



 Score =  128 bits (310), Expect = 2e-29
 Identities = 63/78 (80%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 143 YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 202

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 203 TAEREIVR-DIKEKLCYV 219



 Score =  121 bits (292), Expect = 3e-27
 Identities = 54/60 (90%), Positives = 59/60 (98%)
 Frame = +1

Query: 88  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE ++K
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>BT019856-1|AAV38659.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  185 bits (451), Expect = 2e-46
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 58  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 117

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 118 KMTQIMFETFNTPAMYVAIQAVLSL 142



 Score =  128 bits (310), Expect = 2e-29
 Identities = 63/78 (80%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 143 YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 202

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 203 TAEREIVR-DIKEKLCYV 219



 Score =  122 bits (293), Expect = 2e-27
 Identities = 54/60 (90%), Positives = 59/60 (98%)
 Frame = +1

Query: 88  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE ++K
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>BC053572-1|AAH53572.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  185 bits (451), Expect = 2e-46
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 58  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 117

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 118 KMTQIMFETFNTPAMYVAIQAVLSL 142



 Score =  128 bits (310), Expect = 2e-29
 Identities = 63/78 (80%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 143 YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 202

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 203 TAEREIVR-DIKEKLCYV 219



 Score =  122 bits (293), Expect = 2e-27
 Identities = 54/60 (90%), Positives = 59/60 (98%)
 Frame = +1

Query: 88  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE ++K
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>BC018774-1|AAH18774.1|  375|Homo sapiens ACTG1 protein protein.
          Length = 375

 Score =  185 bits (451), Expect = 2e-46
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 58  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 117

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 118 KMTQIMFETFNTPAMYVAIQAVLSL 142



 Score =  128 bits (310), Expect = 2e-29
 Identities = 63/78 (80%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 143 YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 202

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 203 TAEREIVR-DIKEKLCYV 219



 Score =  122 bits (293), Expect = 2e-27
 Identities = 54/60 (90%), Positives = 59/60 (98%)
 Frame = +1

Query: 88  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE ++K
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>BC017450-1|AAH17450.1|  363|Homo sapiens Unknown (protein for
           IMAGE:3538275) protein.
          Length = 363

 Score =  185 bits (451), Expect = 2e-46
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 46  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 105

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 106 KMTQIMFETFNTPAMYVAIQAVLSL 130



 Score =  128 bits (310), Expect = 2e-29
 Identities = 63/78 (80%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 131 YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 190

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 191 TAEREIVR-DIKEKLCYV 207



 Score = 91.5 bits (217), Expect = 4e-18
 Identities = 41/44 (93%), Positives = 43/44 (97%)
 Frame = +1

Query: 136 KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE ++K
Sbjct: 6   KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 49


>BC015779-1|AAH15779.1|  375|Homo sapiens ACTG1 protein protein.
          Length = 375

 Score =  185 bits (451), Expect = 2e-46
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 58  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 117

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 118 KMTQIMFETFNTPAMYVAIQAVLSL 142



 Score =  128 bits (310), Expect = 2e-29
 Identities = 63/78 (80%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 143 YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 202

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 203 TAEREIVR-DIKEKLCYV 219



 Score =  122 bits (293), Expect = 2e-27
 Identities = 54/60 (90%), Positives = 59/60 (98%)
 Frame = +1

Query: 88  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE ++K
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>BC015695-1|AAH15695.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  185 bits (451), Expect = 2e-46
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 58  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 117

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 118 KMTQIMFETFNTPAMYVAIQAVLSL 142



 Score =  128 bits (310), Expect = 2e-29
 Identities = 63/78 (80%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 143 YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 202

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 203 TAEREIVR-DIKEKLCYV 219



 Score =  122 bits (293), Expect = 2e-27
 Identities = 54/60 (90%), Positives = 59/60 (98%)
 Frame = +1

Query: 88  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE ++K
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>BC015005-1|AAH15005.1|  375|Homo sapiens ACTG1 protein protein.
          Length = 375

 Score =  185 bits (451), Expect = 2e-46
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 58  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 117

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 118 KMTQIMFETFNTPAMYVAIQAVLSL 142



 Score =  128 bits (310), Expect = 2e-29
 Identities = 63/78 (80%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 143 YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 202

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 203 TAEREIVR-DIKEKLCYV 219



 Score =  122 bits (293), Expect = 2e-27
 Identities = 54/60 (90%), Positives = 59/60 (98%)
 Frame = +1

Query: 88  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE ++K
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>BC014861-1|AAH14861.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  185 bits (451), Expect = 2e-46
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 58  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 117

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 118 KMTQIMFETFNTPAMYVAIQAVLSL 142



 Score =  128 bits (310), Expect = 2e-29
 Identities = 63/78 (80%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 143 YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 202

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 203 TAEREIVR-DIKEKLCYV 219



 Score =  121 bits (292), Expect = 3e-27
 Identities = 54/60 (90%), Positives = 59/60 (98%)
 Frame = +1

Query: 88  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE ++K
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>BC013380-1|AAH13380.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  185 bits (451), Expect = 2e-46
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 58  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 117

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 118 KMTQIMFETFNTPAMYVAIQAVLSL 142



 Score =  128 bits (310), Expect = 2e-29
 Identities = 63/78 (80%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 143 YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 202

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 203 TAEREIVR-DIKEKLCYV 219



 Score =  121 bits (292), Expect = 3e-27
 Identities = 54/60 (90%), Positives = 59/60 (98%)
 Frame = +1

Query: 88  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE ++K
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>BC012050-1|AAH12050.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  185 bits (451), Expect = 2e-46
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 58  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 117

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 118 KMTQIMFETFNTPAMYVAIQAVLSL 142



 Score =  128 bits (310), Expect = 2e-29
 Identities = 63/78 (80%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 143 YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 202

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 203 TAEREIVR-DIKEKLCYV 219



 Score =  122 bits (293), Expect = 2e-27
 Identities = 54/60 (90%), Positives = 59/60 (98%)
 Frame = +1

Query: 88  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE ++K
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>BC010999-1|AAH10999.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  185 bits (451), Expect = 2e-46
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 58  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 117

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 118 KMTQIMFETFNTPAMYVAIQAVLSL 142



 Score =  128 bits (310), Expect = 2e-29
 Identities = 63/78 (80%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 143 YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 202

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 203 TAEREIVR-DIKEKLCYV 219



 Score =  122 bits (293), Expect = 2e-27
 Identities = 54/60 (90%), Positives = 59/60 (98%)
 Frame = +1

Query: 88  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE ++K
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>BC009848-1|AAH09848.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  185 bits (451), Expect = 2e-46
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 58  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 117

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 118 KMTQIMFETFNTPAMYVAIQAVLSL 142



 Score =  128 bits (310), Expect = 2e-29
 Identities = 63/78 (80%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 143 YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 202

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 203 TAEREIVR-DIKEKLCYV 219



 Score =  122 bits (293), Expect = 2e-27
 Identities = 54/60 (90%), Positives = 59/60 (98%)
 Frame = +1

Query: 88  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE ++K
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>BC008633-1|AAH08633.1|  368|Homo sapiens actin, beta protein.
          Length = 368

 Score =  185 bits (451), Expect = 2e-46
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 51  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 110

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 111 KMTQIMFETFNTPAMYVAIQAVLSL 135



 Score =  128 bits (310), Expect = 2e-29
 Identities = 63/78 (80%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 136 YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 195

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 196 TAEREIVR-DIKEKLCYV 212



 Score =  113 bits (271), Expect = 1e-24
 Identities = 51/54 (94%), Positives = 53/54 (98%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE ++K
Sbjct: 1   LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 54


>BC007442-1|AAH07442.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  185 bits (451), Expect = 2e-46
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 58  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 117

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 118 KMTQIMFETFNTPAMYVAIQAVLSL 142



 Score =  128 bits (310), Expect = 2e-29
 Identities = 63/78 (80%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 143 YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 202

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 203 TAEREIVR-DIKEKLCYV 219



 Score =  122 bits (293), Expect = 2e-27
 Identities = 54/60 (90%), Positives = 59/60 (98%)
 Frame = +1

Query: 88  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE ++K
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>BC004251-1|AAH04251.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  185 bits (451), Expect = 2e-46
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 58  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 117

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 118 KMTQIMFETFNTPAMYVAIQAVLSL 142



 Score =  128 bits (310), Expect = 2e-29
 Identities = 63/78 (80%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 143 YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 202

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 203 TAEREIVR-DIKEKLCYV 219



 Score =  121 bits (292), Expect = 3e-27
 Identities = 54/60 (90%), Positives = 59/60 (98%)
 Frame = +1

Query: 88  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE ++K
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>BC002409-1|AAH02409.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  185 bits (451), Expect = 2e-46
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 58  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 117

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 118 KMTQIMFETFNTPAMYVAIQAVLSL 142



 Score =  128 bits (310), Expect = 2e-29
 Identities = 63/78 (80%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 143 YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 202

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 203 TAEREIVR-DIKEKLCYV 219



 Score =  121 bits (292), Expect = 3e-27
 Identities = 54/60 (90%), Positives = 59/60 (98%)
 Frame = +1

Query: 88  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE ++K
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>BC001920-1|AAH01920.1|  375|Homo sapiens ACTG1 protein protein.
          Length = 375

 Score =  185 bits (451), Expect = 2e-46
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 58  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 117

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 118 KMTQIMFETFNTPAMYVAIQAVLSL 142



 Score =  128 bits (310), Expect = 2e-29
 Identities = 63/78 (80%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 143 YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 202

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 203 TAEREIVR-DIKEKLCYV 219



 Score =  122 bits (293), Expect = 2e-27
 Identities = 54/60 (90%), Positives = 59/60 (98%)
 Frame = +1

Query: 88  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE ++K
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>BC001301-1|AAH01301.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  185 bits (451), Expect = 2e-46
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 58  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 117

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 118 KMTQIMFETFNTPAMYVAIQAVLSL 142



 Score =  128 bits (310), Expect = 2e-29
 Identities = 63/78 (80%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 143 YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 202

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 203 TAEREIVR-DIKEKLCYV 219



 Score =  121 bits (292), Expect = 3e-27
 Identities = 54/60 (90%), Positives = 59/60 (98%)
 Frame = +1

Query: 88  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE ++K
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>BC000292-1|AAH00292.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  185 bits (451), Expect = 2e-46
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 58  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 117

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 118 KMTQIMFETFNTPAMYVAIQAVLSL 142



 Score =  128 bits (310), Expect = 2e-29
 Identities = 63/78 (80%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 143 YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 202

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 203 TAEREIVR-DIKEKLCYV 219



 Score =  122 bits (293), Expect = 2e-27
 Identities = 54/60 (90%), Positives = 59/60 (98%)
 Frame = +1

Query: 88  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE ++K
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>AY582799-1|AAS79319.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  185 bits (451), Expect = 2e-46
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 58  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 117

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 118 KMTQIMFETFNTPAMYVAIQAVLSL 142



 Score =  128 bits (310), Expect = 2e-29
 Identities = 63/78 (80%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 143 YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 202

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 203 TAEREIVR-DIKEKLCYV 219



 Score =  121 bits (292), Expect = 3e-27
 Identities = 54/60 (90%), Positives = 59/60 (98%)
 Frame = +1

Query: 88  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE ++K
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>AK223055-1|BAD96775.1|  375|Homo sapiens beta actin variant
           protein.
          Length = 375

 Score =  185 bits (451), Expect = 2e-46
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 58  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 117

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 118 KMTQIMFETFNTPAMYVAIQAVLSL 142



 Score =  128 bits (310), Expect = 2e-29
 Identities = 63/78 (80%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 143 YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 202

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 203 TAEREIVR-DIKEKLCYV 219



 Score =  121 bits (292), Expect = 3e-27
 Identities = 54/60 (90%), Positives = 59/60 (98%)
 Frame = +1

Query: 88  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE ++K
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>AK223032-1|BAD96752.1|  375|Homo sapiens beta actin variant
           protein.
          Length = 375

 Score =  185 bits (451), Expect = 2e-46
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 58  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 117

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 118 KMTQIMFETFNTPAMYVAIQAVLSL 142



 Score =  128 bits (310), Expect = 2e-29
 Identities = 63/78 (80%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 143 YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 202

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 203 TAEREIVR-DIKEKLCYV 219



 Score =  121 bits (292), Expect = 3e-27
 Identities = 54/60 (90%), Positives = 59/60 (98%)
 Frame = +1

Query: 88  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE ++K
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>AK222925-1|BAD96645.1|  375|Homo sapiens beta actin variant
           protein.
          Length = 375

 Score =  185 bits (451), Expect = 2e-46
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 58  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 117

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 118 KMTQIMFETFNTPAMYVAIQAVLSL 142



 Score =  128 bits (310), Expect = 2e-29
 Identities = 63/78 (80%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 143 YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 202

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 203 TAEREIVR-DIKEKLCYV 219



 Score =  121 bits (292), Expect = 3e-27
 Identities = 54/60 (90%), Positives = 59/60 (98%)
 Frame = +1

Query: 88  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE ++K
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>AC006483-1|AAP22343.1|  375|Homo sapiens unknown protein.
          Length = 375

 Score =  185 bits (451), Expect = 2e-46
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 58  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 117

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 118 KMTQIMFETFNTPAMYVAIQAVLSL 142



 Score =  128 bits (310), Expect = 2e-29
 Identities = 63/78 (80%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 143 YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 202

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 203 TAEREIVR-DIKEKLCYV 219



 Score =  121 bits (292), Expect = 3e-27
 Identities = 54/60 (90%), Positives = 59/60 (98%)
 Frame = +1

Query: 88  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE ++K
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>X63432-1|CAA45026.1|  375|Homo sapiens mutant beta-actin
           (beta'-actin) protein.
          Length = 375

 Score =  184 bits (448), Expect = 4e-46
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 58  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 117

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQA+LSL
Sbjct: 118 KMTQIMFETFNTPAMYVAIQAMLSL 142



 Score =  128 bits (310), Expect = 2e-29
 Identities = 63/78 (80%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 143 YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 202

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 203 TAEREIVR-DIKEKLCYV 219



 Score =  121 bits (292), Expect = 3e-27
 Identities = 54/60 (90%), Positives = 59/60 (98%)
 Frame = +1

Query: 88  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE ++K
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>BC016045-1|AAH16045.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  183 bits (446), Expect = 6e-46
 Identities = 84/85 (98%), Positives = 84/85 (98%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRV PEEHPVLLTEAPLNPKANRE
Sbjct: 58  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVPPEEHPVLLTEAPLNPKANRE 117

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 118 KMTQIMFETFNTPAMYVAIQAVLSL 142



 Score =  128 bits (310), Expect = 2e-29
 Identities = 63/78 (80%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 143 YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 202

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 203 TAEREIVR-DIKEKLCYV 219



 Score =  121 bits (292), Expect = 3e-27
 Identities = 54/60 (90%), Positives = 59/60 (98%)
 Frame = +1

Query: 88  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE ++K
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>BC012854-1|AAH12854.1|  360|Homo sapiens ACTB protein protein.
          Length = 360

 Score =  182 bits (444), Expect = 1e-45
 Identities = 84/85 (98%), Positives = 84/85 (98%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKAN E
Sbjct: 43  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANLE 102

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 103 KMTQIMFETFNTPAMYVAIQAVLSL 127



 Score =  128 bits (310), Expect = 2e-29
 Identities = 63/78 (80%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 128 YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 187

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 188 TAEREIVR-DIKEKLCYV 204



 Score = 97.1 bits (231), Expect = 7e-20
 Identities = 43/46 (93%), Positives = 45/46 (97%)
 Frame = +1

Query: 130 MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE ++K
Sbjct: 1   MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 46


>M20543-1|AAA60296.1|  377|Homo sapiens ACTA1 protein.
          Length = 377

 Score =  181 bits (441), Expect = 3e-45
 Identities = 82/85 (96%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANRE
Sbjct: 60  AQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANRE 119

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 120 KMTQIMFETFNVPAMYVAIQAVLSL 144



 Score =  128 bits (309), Expect = 3e-29
 Identities = 62/78 (79%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RLD +   LTDYLMKILTERGYSF+T
Sbjct: 145 YASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVT 204

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 205 TAEREIVR-DIKEKLCYV 221



 Score =  115 bits (276), Expect = 3e-25
 Identities = 54/63 (85%), Positives = 57/63 (90%), Gaps = 1/63 (1%)
 Frame = +1

Query: 82  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEH 258
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 259 RAK 267
           ++K
Sbjct: 61  QSK 63


>J00073-1|AAB59619.1|  377|Homo sapiens alpha-cardiac actin protein.
          Length = 377

 Score =  181 bits (441), Expect = 3e-45
 Identities = 82/85 (96%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANRE
Sbjct: 60  AQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANRE 119

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 120 KMTQIMFETFNVPAMYVAIQAVLSL 144



 Score =  128 bits (309), Expect = 3e-29
 Identities = 62/78 (79%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RLD +   LTDYLMKILTERGYSF+T
Sbjct: 145 YASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVT 204

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 205 TAEREIVR-DIKEKLCYV 221



 Score =  115 bits (276), Expect = 3e-25
 Identities = 54/63 (85%), Positives = 57/63 (90%), Gaps = 1/63 (1%)
 Frame = +1

Query: 82  MCD-EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEH 258
           MCD EE  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 
Sbjct: 1   MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 259 RAK 267
           ++K
Sbjct: 61  QSK 63


>J00068-1|AAB59376.1|  377|Homo sapiens ACTA1 protein.
          Length = 377

 Score =  181 bits (441), Expect = 3e-45
 Identities = 82/85 (96%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANRE
Sbjct: 60  AQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANRE 119

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 120 KMTQIMFETFNVPAMYVAIQAVLSL 144



 Score =  128 bits (309), Expect = 3e-29
 Identities = 62/78 (79%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RLD +   LTDYLMKILTERGYSF+T
Sbjct: 145 YASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVT 204

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 205 TAEREIVR-DIKEKLCYV 221



 Score =  115 bits (276), Expect = 3e-25
 Identities = 54/63 (85%), Positives = 57/63 (90%), Gaps = 1/63 (1%)
 Frame = +1

Query: 82  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEH 258
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 259 RAK 267
           ++K
Sbjct: 61  QSK 63


>CR541796-1|CAG46595.1|  377|Homo sapiens ACTA1 protein.
          Length = 377

 Score =  181 bits (441), Expect = 3e-45
 Identities = 82/85 (96%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANRE
Sbjct: 60  AQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANRE 119

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 120 KMTQIMFETFNVPAMYVAIQAVLSL 144



 Score =  128 bits (309), Expect = 3e-29
 Identities = 62/78 (79%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RLD +   LTDYLMKILTERGYSF+T
Sbjct: 145 YASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVT 204

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 205 TAEREIVR-DIKEKLCYV 221



 Score =  115 bits (276), Expect = 3e-25
 Identities = 54/63 (85%), Positives = 57/63 (90%), Gaps = 1/63 (1%)
 Frame = +1

Query: 82  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEH 258
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 259 RAK 267
           ++K
Sbjct: 61  QSK 63


>CR541795-1|CAG46594.1|  377|Homo sapiens ACTC protein.
          Length = 377

 Score =  181 bits (441), Expect = 3e-45
 Identities = 82/85 (96%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANRE
Sbjct: 60  AQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANRE 119

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 120 KMTQIMFETFNVPAMYVAIQAVLSL 144



 Score =  128 bits (309), Expect = 3e-29
 Identities = 62/78 (79%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RLD +   LTDYLMKILTERGYSF+T
Sbjct: 145 YASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVT 204

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 205 TAEREIVR-DIKEKLCYV 221



 Score =  115 bits (276), Expect = 3e-25
 Identities = 54/63 (85%), Positives = 57/63 (90%), Gaps = 1/63 (1%)
 Frame = +1

Query: 82  MCD-EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEH 258
           MCD EE  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 
Sbjct: 1   MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 259 RAK 267
           ++K
Sbjct: 61  QSK 63


>CR536516-1|CAG38754.1|  377|Homo sapiens ACTA1 protein.
          Length = 377

 Score =  181 bits (441), Expect = 3e-45
 Identities = 82/85 (96%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANRE
Sbjct: 60  AQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANRE 119

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 120 KMTQIMFETFNVPAMYVAIQAVLSL 144



 Score =  128 bits (309), Expect = 3e-29
 Identities = 62/78 (79%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RLD +   LTDYLMKILTERGYSF+T
Sbjct: 145 YASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVT 204

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 205 TAEREIVR-DIKEKLCYV 221



 Score =  115 bits (276), Expect = 3e-25
 Identities = 54/63 (85%), Positives = 57/63 (90%), Gaps = 1/63 (1%)
 Frame = +1

Query: 82  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEH 258
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 259 RAK 267
           ++K
Sbjct: 61  QSK 63


>BC012597-1|AAH12597.1|  377|Homo sapiens actin, alpha 1, skeletal
           muscle protein.
          Length = 377

 Score =  181 bits (441), Expect = 3e-45
 Identities = 82/85 (96%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANRE
Sbjct: 60  AQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANRE 119

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 120 KMTQIMFETFNVPAMYVAIQAVLSL 144



 Score =  128 bits (309), Expect = 3e-29
 Identities = 62/78 (79%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RLD +   LTDYLMKILTERGYSF+T
Sbjct: 145 YASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVT 204

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 205 TAEREIVR-DIKEKLCYV 221



 Score =  115 bits (276), Expect = 3e-25
 Identities = 54/63 (85%), Positives = 57/63 (90%), Gaps = 1/63 (1%)
 Frame = +1

Query: 82  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEH 258
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 259 RAK 267
           ++K
Sbjct: 61  QSK 63


>BC009978-1|AAH09978.1|  377|Homo sapiens actin, alpha, cardiac
           muscle 1 protein.
          Length = 377

 Score =  181 bits (441), Expect = 3e-45
 Identities = 82/85 (96%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANRE
Sbjct: 60  AQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANRE 119

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 120 KMTQIMFETFNVPAMYVAIQAVLSL 144



 Score =  128 bits (309), Expect = 3e-29
 Identities = 62/78 (79%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RLD +   LTDYLMKILTERGYSF+T
Sbjct: 145 YASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVT 204

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 205 TAEREIVR-DIKEKLCYV 221



 Score =  115 bits (276), Expect = 3e-25
 Identities = 54/63 (85%), Positives = 57/63 (90%), Gaps = 1/63 (1%)
 Frame = +1

Query: 82  MCD-EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEH 258
           MCD EE  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 
Sbjct: 1   MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 259 RAK 267
           ++K
Sbjct: 61  QSK 63


>AY280960-1|AAP37280.1|  254|Homo sapiens actin alpha 1 skeletal
           muscle protein protein.
          Length = 254

 Score =  181 bits (441), Expect = 3e-45
 Identities = 82/85 (96%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANRE
Sbjct: 60  AQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANRE 119

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 120 KMTQIMFETFNVPAMYVAIQAVLSL 144



 Score =  115 bits (276), Expect = 3e-25
 Identities = 54/63 (85%), Positives = 57/63 (90%), Gaps = 1/63 (1%)
 Frame = +1

Query: 82  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEH 258
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 259 RAK 267
           ++K
Sbjct: 61  QSK 63



 Score = 38.7 bits (86), Expect = 0.027
 Identities = 17/17 (100%), Positives = 17/17 (100%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGV 559
           YASGRTTGIVLDSGDGV
Sbjct: 145 YASGRTTGIVLDSGDGV 161


>AL160004-6|CAI19050.1|  377|Homo sapiens actin, alpha 1, skeletal
           muscle protein.
          Length = 377

 Score =  181 bits (441), Expect = 3e-45
 Identities = 82/85 (96%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANRE
Sbjct: 60  AQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANRE 119

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 120 KMTQIMFETFNVPAMYVAIQAVLSL 144



 Score =  128 bits (309), Expect = 3e-29
 Identities = 62/78 (79%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RLD +   LTDYLMKILTERGYSF+T
Sbjct: 145 YASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVT 204

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 205 TAEREIVR-DIKEKLCYV 221



 Score =  115 bits (276), Expect = 3e-25
 Identities = 54/63 (85%), Positives = 57/63 (90%), Gaps = 1/63 (1%)
 Frame = +1

Query: 82  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEH 258
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 259 RAK 267
           ++K
Sbjct: 61  QSK 63


>AF182035-1|AAF02694.1|  377|Homo sapiens skeletal muscle
           alpha-actin precursor protein.
          Length = 377

 Score =  181 bits (441), Expect = 3e-45
 Identities = 82/85 (96%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANRE
Sbjct: 60  AQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANRE 119

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 120 KMTQIMFETFNVPAMYVAIQAVLSL 144



 Score =  128 bits (309), Expect = 3e-29
 Identities = 62/78 (79%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RLD +   LTDYLMKILTERGYSF+T
Sbjct: 145 YASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVT 204

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 205 TAEREIVR-DIKEKLCYV 221



 Score =  115 bits (276), Expect = 3e-25
 Identities = 54/63 (85%), Positives = 57/63 (90%), Gaps = 1/63 (1%)
 Frame = +1

Query: 82  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEH 258
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 259 RAK 267
           ++K
Sbjct: 61  QSK 63


>EF523384-1|ABP57734.1| 1075|Homo sapiens POTE-2 alpha-actin protein.
          Length = 1075

 Score =  180 bits (439), Expect = 4e-45
 Identities = 82/85 (96%), Positives = 84/85 (98%)
 Frame = +3

Query: 255  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
            AQSKRGILTLKYP+EHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPKANRE
Sbjct: 758  AQSKRGILTLKYPMEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEATLNPKANRE 817

Query: 435  KMTQIMFETFNTPAMYVAIQAVLSL 509
            KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 818  KMTQIMFETFNTPAMYVAIQAVLSL 842



 Score =  115 bits (276), Expect = 3e-25
 Identities = 57/78 (73%), Positives = 60/78 (76%)
 Frame = +2

Query: 509  YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
            Y SGRTTGIV+DSGDGV+HTVPIYEG ALPHA LRLD +   L DYLMKILTE GY F T
Sbjct: 843  YTSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELPDYLMKILTEHGYRFTT 902

Query: 689  NAXREIRS*TFKEKLCYV 742
             A REI     KEKLCYV
Sbjct: 903  MAEREIVR-DIKEKLCYV 919



 Score =  103 bits (247), Expect = 8e-22
 Identities = 46/60 (76%), Positives = 53/60 (88%)
 Frame = +1

Query: 88  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           D++ A LV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPR QG+M GM QK+SYVG E ++K
Sbjct: 702 DDDTAVLVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRQQGMMGGMHQKESYVGKEAQSK 761


>X16940-1|CAA34814.1|  376|Homo sapiens protein ( Human mRNA for
           enteric smooth muscle gamma-actin. ).
          Length = 376

 Score =  180 bits (437), Expect = 8e-45
 Identities = 81/85 (95%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANRE
Sbjct: 59  AQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNVPAMYVAIQAVLSL 143



 Score =  128 bits (309), Expect = 3e-29
 Identities = 62/78 (79%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RLD +   LTDYLMKILTERGYSF+T
Sbjct: 144 YASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 204 TAEREIVR-DIKEKLCYV 220



 Score =  122 bits (293), Expect = 2e-27
 Identities = 54/62 (87%), Positives = 58/62 (93%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>X13839-1|CAA32064.1|  377|Homo sapiens protein ( Human mRNA for
           vascular smooth muscle alpha-actin. ).
          Length = 377

 Score =  180 bits (437), Expect = 8e-45
 Identities = 81/85 (95%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANRE
Sbjct: 60  AQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANRE 119

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 120 KMTQIMFETFNVPAMYVAIQAVLSL 144



 Score =  128 bits (309), Expect = 3e-29
 Identities = 62/78 (79%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RLD +   LTDYLMKILTERGYSF+T
Sbjct: 145 YASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVT 204

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 205 TAEREIVR-DIKEKLCYV 221



 Score =  116 bits (280), Expect = 8e-26
 Identities = 54/63 (85%), Positives = 59/63 (93%), Gaps = 1/63 (1%)
 Frame = +1

Query: 82  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEH 258
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 259 RAK 267
           ++K
Sbjct: 61  QSK 63


>K01747-1|AAA51586.1|  330|Homo sapiens ACTA2 protein.
          Length = 330

 Score =  180 bits (437), Expect = 8e-45
 Identities = 81/85 (95%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANRE
Sbjct: 60  AQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANRE 119

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 120 KMTQIMFETFNVPAMYVAIQAVLSL 144



 Score =  128 bits (309), Expect = 3e-29
 Identities = 62/78 (79%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RLD +   LTDYLMKILTERGYSF+T
Sbjct: 145 YASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVT 204

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 205 TAEREIVR-DIKEKLCYV 221



 Score =  113 bits (273), Expect = 6e-25
 Identities = 53/63 (84%), Positives = 58/63 (92%), Gaps = 1/63 (1%)
 Frame = +1

Query: 82  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEH 258
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG E 
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGHEA 60

Query: 259 RAK 267
           ++K
Sbjct: 61  QSK 63


>J05192-1|AAA51577.1|  377|Homo sapiens ACTA3 protein.
          Length = 377

 Score =  180 bits (437), Expect = 8e-45
 Identities = 81/85 (95%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANRE
Sbjct: 60  AQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANRE 119

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 120 KMTQIMFETFNVPAMYVAIQAVLSL 144



 Score =  128 bits (309), Expect = 3e-29
 Identities = 62/78 (79%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RLD +   LTDYLMKILTERGYSF+T
Sbjct: 145 YASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVT 204

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 205 TAEREIVR-DIKEKLCYV 221



 Score =  116 bits (280), Expect = 8e-26
 Identities = 54/63 (85%), Positives = 59/63 (93%), Gaps = 1/63 (1%)
 Frame = +1

Query: 82  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEH 258
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 259 RAK 267
           ++K
Sbjct: 61  QSK 63


>D00654-1|BAA00546.1|  376|Homo sapiens enteric smooth muscle
           gamma-actin protein.
          Length = 376

 Score =  180 bits (437), Expect = 8e-45
 Identities = 81/85 (95%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANRE
Sbjct: 59  AQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNVPAMYVAIQAVLSL 143



 Score =  128 bits (309), Expect = 3e-29
 Identities = 62/78 (79%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RLD +   LTDYLMKILTERGYSF+T
Sbjct: 144 YASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 204 TAEREIVR-DIKEKLCYV 220



 Score =  122 bits (293), Expect = 2e-27
 Identities = 54/62 (87%), Positives = 58/62 (93%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>CR541794-1|CAG46593.1|  376|Homo sapiens ACTG2 protein.
          Length = 376

 Score =  180 bits (437), Expect = 8e-45
 Identities = 81/85 (95%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANRE
Sbjct: 59  AQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNVPAMYVAIQAVLSL 143



 Score =  128 bits (309), Expect = 3e-29
 Identities = 62/78 (79%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RLD +   LTDYLMKILTERGYSF+T
Sbjct: 144 YASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 204 TAEREIVR-DIKEKLCYV 220



 Score =  122 bits (293), Expect = 2e-27
 Identities = 54/62 (87%), Positives = 58/62 (93%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>CR536518-1|CAG38756.1|  377|Homo sapiens ACTA2 protein.
          Length = 377

 Score =  180 bits (437), Expect = 8e-45
 Identities = 81/85 (95%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANRE
Sbjct: 60  AQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANRE 119

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 120 KMTQIMFETFNVPAMYVAIQAVLSL 144



 Score =  128 bits (309), Expect = 3e-29
 Identities = 62/78 (79%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RLD +   LTDYLMKILTERGYSF+T
Sbjct: 145 YASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVT 204

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 205 TAEREIVR-DIKEKLCYV 221



 Score =  116 bits (280), Expect = 8e-26
 Identities = 54/63 (85%), Positives = 59/63 (93%), Gaps = 1/63 (1%)
 Frame = +1

Query: 82  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEH 258
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 259 RAK 267
           ++K
Sbjct: 61  QSK 63


>BC094877-1|AAH94877.1|  376|Homo sapiens ACTG2 protein protein.
          Length = 376

 Score =  180 bits (437), Expect = 8e-45
 Identities = 81/85 (95%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANRE
Sbjct: 59  AQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNVPAMYVAIQAVLSL 143



 Score =  128 bits (309), Expect = 3e-29
 Identities = 62/78 (79%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RLD +   LTDYLMKILTERGYSF+T
Sbjct: 144 YASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 204 TAEREIVR-DIKEKLCYV 220



 Score =  122 bits (293), Expect = 2e-27
 Identities = 54/62 (87%), Positives = 58/62 (93%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>BC093052-1|AAH93052.1|  377|Homo sapiens actin, alpha 2, smooth
           muscle, aorta protein.
          Length = 377

 Score =  180 bits (437), Expect = 8e-45
 Identities = 81/85 (95%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANRE
Sbjct: 60  AQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANRE 119

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 120 KMTQIMFETFNVPAMYVAIQAVLSL 144



 Score =  128 bits (309), Expect = 3e-29
 Identities = 62/78 (79%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RLD +   LTDYLMKILTERGYSF+T
Sbjct: 145 YASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVT 204

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 205 TAEREIVR-DIKEKLCYV 221



 Score =  116 bits (280), Expect = 8e-26
 Identities = 54/63 (85%), Positives = 59/63 (93%), Gaps = 1/63 (1%)
 Frame = +1

Query: 82  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEH 258
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 259 RAK 267
           ++K
Sbjct: 61  QSK 63


>BC017554-1|AAH17554.1|  377|Homo sapiens actin, alpha 2, smooth
           muscle, aorta protein.
          Length = 377

 Score =  180 bits (437), Expect = 8e-45
 Identities = 81/85 (95%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANRE
Sbjct: 60  AQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANRE 119

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 120 KMTQIMFETFNVPAMYVAIQAVLSL 144



 Score =  128 bits (309), Expect = 3e-29
 Identities = 62/78 (79%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RLD +   LTDYLMKILTERGYSF+T
Sbjct: 145 YASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVT 204

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 205 TAEREIVR-DIKEKLCYV 221



 Score =  116 bits (280), Expect = 8e-26
 Identities = 54/63 (85%), Positives = 59/63 (93%), Gaps = 1/63 (1%)
 Frame = +1

Query: 82  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEH 258
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 259 RAK 267
           ++K
Sbjct: 61  QSK 63


>BC012617-1|AAH12617.1|  376|Homo sapiens actin, gamma 2, smooth
           muscle, enteric protein.
          Length = 376

 Score =  180 bits (437), Expect = 8e-45
 Identities = 81/85 (95%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANRE
Sbjct: 59  AQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNVPAMYVAIQAVLSL 143



 Score =  128 bits (309), Expect = 3e-29
 Identities = 62/78 (79%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RLD +   LTDYLMKILTERGYSF+T
Sbjct: 144 YASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 204 TAEREIVR-DIKEKLCYV 220



 Score =  122 bits (293), Expect = 2e-27
 Identities = 54/62 (87%), Positives = 58/62 (93%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>AY692464-1|AAW29811.1|  377|Homo sapiens growth-inhibiting gene 46
           protein.
          Length = 377

 Score =  180 bits (437), Expect = 8e-45
 Identities = 81/85 (95%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANRE
Sbjct: 60  AQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANRE 119

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 120 KMTQIMFETFNVPAMYVAIQAVLSL 144



 Score =  128 bits (309), Expect = 3e-29
 Identities = 62/78 (79%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RLD +   LTDYLMKILTERGYSF+T
Sbjct: 145 YASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVT 204

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 205 TAEREIVR-DIKEKLCYV 221



 Score =  116 bits (280), Expect = 8e-26
 Identities = 54/63 (85%), Positives = 59/63 (93%), Gaps = 1/63 (1%)
 Frame = +1

Query: 82  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEH 258
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 259 RAK 267
           ++K
Sbjct: 61  QSK 63


>AL157394-7|CAI13865.1|  151|Homo sapiens actin, alpha 2, smooth
           muscle, aorta protein.
          Length = 151

 Score =  180 bits (437), Expect = 8e-45
 Identities = 81/85 (95%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANRE
Sbjct: 60  AQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANRE 119

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 120 KMTQIMFETFNVPAMYVAIQAVLSL 144



 Score =  116 bits (280), Expect = 8e-26
 Identities = 54/63 (85%), Positives = 59/63 (93%), Gaps = 1/63 (1%)
 Frame = +1

Query: 82  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEH 258
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 259 RAK 267
           ++K
Sbjct: 61  QSK 63


>AL157394-6|CAI13864.1|  377|Homo sapiens actin, alpha 2, smooth
           muscle, aorta protein.
          Length = 377

 Score =  180 bits (437), Expect = 8e-45
 Identities = 81/85 (95%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANRE
Sbjct: 60  AQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANRE 119

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 120 KMTQIMFETFNVPAMYVAIQAVLSL 144



 Score =  128 bits (309), Expect = 3e-29
 Identities = 62/78 (79%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RLD +   LTDYLMKILTERGYSF+T
Sbjct: 145 YASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVT 204

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 205 TAEREIVR-DIKEKLCYV 221



 Score =  116 bits (280), Expect = 8e-26
 Identities = 54/63 (85%), Positives = 59/63 (93%), Gaps = 1/63 (1%)
 Frame = +1

Query: 82  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEH 258
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 259 RAK 267
           ++K
Sbjct: 61  QSK 63


>AC073046-2|AAX88909.1|  376|Homo sapiens unknown protein.
          Length = 376

 Score =  180 bits (437), Expect = 8e-45
 Identities = 81/85 (95%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANRE
Sbjct: 59  AQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNVPAMYVAIQAVLSL 143



 Score =  128 bits (309), Expect = 3e-29
 Identities = 62/78 (79%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RLD +   LTDYLMKILTERGYSF+T
Sbjct: 144 YASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 204 TAEREIVR-DIKEKLCYV 220



 Score =  122 bits (293), Expect = 2e-27
 Identities = 54/62 (87%), Positives = 58/62 (93%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>CR536515-1|CAG38753.1|  376|Homo sapiens ACTG2 protein.
          Length = 376

 Score =  179 bits (435), Expect = 1e-44
 Identities = 81/85 (95%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANRE
Sbjct: 59  AQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNFPAMYVAIQAVLSL 143



 Score =  128 bits (309), Expect = 3e-29
 Identities = 62/78 (79%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RLD +   LTDYLMKILTERGYSF+T
Sbjct: 144 YASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 204 TAEREIVR-DIKEKLCYV 220



 Score =  122 bits (293), Expect = 2e-27
 Identities = 54/62 (87%), Positives = 58/62 (93%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>EF095209-1|ABL01513.1|  121|Homo sapiens beta-actin protein.
          Length = 121

 Score =  165 bits (402), Expect = 1e-40
 Identities = 74/74 (100%), Positives = 74/74 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 48  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 107

Query: 435 KMTQIMFETFNTPA 476
           KMTQIMFETFNTPA
Sbjct: 108 KMTQIMFETFNTPA 121



 Score =  108 bits (259), Expect = 3e-23
 Identities = 48/51 (94%), Positives = 50/51 (98%)
 Frame = +1

Query: 115 DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE ++K
Sbjct: 1   DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 51


>AY129015-1|AAM98758.1|  109|Homo sapiens unknown protein.
          Length = 109

 Score =  140 bits (339), Expect = 6e-33
 Identities = 70/108 (64%), Positives = 75/108 (69%)
 Frame = +3

Query: 309 VTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVA 488
           +TNWDD+EKIWHHTFY  L +A EEH VLLTE PLN KANREKMTQIMF+TFNT AMYVA
Sbjct: 1   MTNWDDIEKIWHHTFYKGLHMALEEHLVLLTEDPLNLKANREKMTQIMFDTFNTLAMYVA 60

Query: 489 IQAVLSLTRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGR 632
           IQA LSL          W     SPT CPS R T S TP C+WT   R
Sbjct: 61  IQARLSLYTCGCTLALSWALEMGSPTWCPSIRATPSLTPFCIWTWLAR 108


>AL160004-4|CAI19051.1|  287|Homo sapiens actin, alpha 1, skeletal
           muscle protein.
          Length = 287

 Score =  134 bits (325), Expect = 3e-31
 Identities = 59/65 (90%), Positives = 61/65 (93%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANRE
Sbjct: 60  AQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANRE 119

Query: 435 KMTQI 449
            +  I
Sbjct: 120 IVRDI 124



 Score =  115 bits (276), Expect = 3e-25
 Identities = 54/63 (85%), Positives = 57/63 (90%), Gaps = 1/63 (1%)
 Frame = +1

Query: 82  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEH 258
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 259 RAK 267
           ++K
Sbjct: 61  QSK 63


>AY970501-1|AAX82307.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970499-1|AAX82305.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 75.8 bits (178), Expect = 2e-13
 Identities = 35/44 (79%), Positives = 38/44 (86%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+D GDGV+HTV IYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDFGDGVTHTVSIYEGYALPHAILRLDLAGLDLT 103


>AY970498-1|AAX82304.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970497-1|AAX82303.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970495-1|AAX82301.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970494-1|AAX82300.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970493-1|AAX82299.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970491-1|AAX82297.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970489-1|AAX82295.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970488-1|AAX82294.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970487-1|AAX82293.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970486-1|AAX82292.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970479-1|AAX82285.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 75.4 bits (177), Expect = 3e-13
 Identities = 34/44 (77%), Positives = 37/44 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           Y SGRTTGIV+DSGDGV+HTVPIYEG ALPHA LRLD +   LT
Sbjct: 60  YTSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELT 103


>AY970478-1|AAX82284.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970477-1|AAX82283.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGPDLT 103


>AY970476-1|AAX82282.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970474-1|AAX82280.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970473-1|AAX82279.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970472-1|AAX82278.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970471-1|AAX82277.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970470-1|AAX82276.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970469-1|AAX82275.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970468-1|AAX82274.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970443-1|AAX82252.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970441-1|AAX82250.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970420-1|AAX82229.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 78.6 bits (185), Expect = 3e-14
 Identities = 36/44 (81%), Positives = 39/44 (88%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASG TTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGCTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970419-1|AAX82228.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970418-1|AAX82227.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970417-1|AAX82226.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970416-1|AAX82225.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970415-1|AAX82224.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970414-1|AAX82223.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970413-1|AAX82222.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970412-1|AAX82221.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970411-1|AAX82220.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970410-1|AAX82219.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970409-1|AAX82218.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970408-1|AAX82217.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970406-1|AAX82215.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970405-1|AAX82214.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970404-1|AAX82213.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970403-1|AAX82212.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970402-1|AAX82211.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970383-1|AAX82192.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 80.2 bits (189), Expect = 9e-15
 Identities = 35/39 (89%), Positives = 38/39 (97%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFS 625
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLA 98


>AY970382-1|AAX82191.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970381-1|AAX82190.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970380-1|AAX82189.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970377-1|AAX82186.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970376-1|AAX82185.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 79.0 bits (186), Expect = 2e-14
 Identities = 36/44 (81%), Positives = 39/44 (88%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILR D +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRPDLAGRDLT 103


>AY970375-1|AAX82184.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970372-1|AAX82182.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970371-1|AAX82181.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970370-1|AAX82180.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970369-1|AAX82179.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970368-1|AAX82178.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970366-1|AAX82176.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970364-1|AAX82174.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970363-1|AAX82173.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 59/59 (100%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>BC023548-1|AAH23548.1|  263|Homo sapiens ACTG1 protein protein.
          Length = 263

 Score =  128 bits (310), Expect = 2e-29
 Identities = 63/78 (80%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 31  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 90

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 91  TAEREIVR-DIKEKLCYV 107



 Score = 63.3 bits (147), Expect = 1e-09
 Identities = 30/30 (100%), Positives = 30/30 (100%)
 Frame = +3

Query: 420 KANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KANREKMTQIMFETFNTPAMYVAIQAVLSL 30


>AY970502-1|AAX82308.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  128 bits (310), Expect = 2e-29
 Identities = 58/59 (98%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 76.6 bits (180), Expect = 1e-13
 Identities = 35/44 (79%), Positives = 38/44 (86%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           Y SGRTTGIV+DSGDGV+HTVPIYEG ALPHAILRLD +   LT
Sbjct: 60  YTSGRTTGIVMDSGDGVTHTVPIYEGNALPHAILRLDLAGRDLT 103


>AY970480-1|AAX82286.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  128 bits (310), Expect = 2e-29
 Identities = 58/59 (98%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 72.5 bits (170), Expect = 2e-12
 Identities = 33/44 (75%), Positives = 36/44 (81%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           Y SGRTTGIV+DSGDGV+HTVPIYEG ALPHA L LD +   LT
Sbjct: 60  YTSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLPLDLAGRELT 103


>AY970464-1|AAX82271.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  128 bits (310), Expect = 2e-29
 Identities = 58/59 (98%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 73.3 bits (172), Expect = 1e-12
 Identities = 33/44 (75%), Positives = 36/44 (81%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           Y SGRTTGIV+DSGDG +HTVPIYEG ALPHA LRLD +   LT
Sbjct: 60  YTSGRTTGIVMDSGDGFTHTVPIYEGNALPHATLRLDLAGRELT 103


>AY970460-1|AAX82267.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  128 bits (310), Expect = 2e-29
 Identities = 58/59 (98%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 74.5 bits (175), Expect = 4e-13
 Identities = 34/44 (77%), Positives = 37/44 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           Y SGRTTGIV+DSGDGV+HTVPIYEG ALPHA LRLD +   LT
Sbjct: 60  YTSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLRLDLAGRDLT 103


>AY970457-1|AAX82264.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  128 bits (310), Expect = 2e-29
 Identities = 58/59 (98%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 75.4 bits (177), Expect = 3e-13
 Identities = 34/44 (77%), Positives = 37/44 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           Y SGRTTGIV+DSGDGV+HTVPIYEG ALPHA LRLD +   LT
Sbjct: 60  YTSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELT 103


>AY970446-1|AAX82255.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  128 bits (310), Expect = 2e-29
 Identities = 58/59 (98%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 74.9 bits (176), Expect = 3e-13
 Identities = 34/44 (77%), Positives = 37/44 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           Y SGRTTGIV+DSGDGV+HTVPIYEG ALPHA LRLD +   LT
Sbjct: 60  YTSGRTTGIVMDSGDGVTHTVPIYEGDALPHATLRLDLAGRELT 103


>AY970431-1|AAX82240.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  128 bits (310), Expect = 2e-29
 Identities = 58/59 (98%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 75.4 bits (177), Expect = 3e-13
 Identities = 34/44 (77%), Positives = 37/44 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           Y SGRTTGIV+DSGDGV+HTVPIYEG ALPHA LRLD +   LT
Sbjct: 60  YTSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELT 103


>AY970430-1|AAX82239.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  128 bits (310), Expect = 2e-29
 Identities = 58/59 (98%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 75.4 bits (177), Expect = 3e-13
 Identities = 34/44 (77%), Positives = 37/44 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           Y SGRTTGIV+DSGDGV+HTVPIYEG ALPHA LRLD +   LT
Sbjct: 60  YTSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELT 103


>AY970428-1|AAX82237.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  128 bits (310), Expect = 2e-29
 Identities = 58/59 (98%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 75.4 bits (177), Expect = 3e-13
 Identities = 34/44 (77%), Positives = 37/44 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           Y SGRTTGIV+DSGDGV+HTVPIYEG ALPHA LRLD +   LT
Sbjct: 60  YTSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELT 103


>AY970421-1|AAX82230.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  128 bits (310), Expect = 2e-29
 Identities = 58/59 (98%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 78.6 bits (185), Expect = 3e-14
 Identities = 36/44 (81%), Positives = 39/44 (88%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAIL LD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILCLDLAGRDLT 103


>AY970390-1|AAX82199.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  128 bits (310), Expect = 2e-29
 Identities = 58/59 (98%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 79.0 bits (186), Expect = 2e-14
 Identities = 35/44 (79%), Positives = 38/44 (86%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           Y SGRTTGIV+DSGDGV+HTVPIYEGYALPHA LRLD +   LT
Sbjct: 60  YTSGRTTGIVMDSGDGVTHTVPIYEGYALPHATLRLDLAGRELT 103


>AY970389-1|AAX82198.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  128 bits (310), Expect = 2e-29
 Identities = 58/59 (98%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 75.4 bits (177), Expect = 3e-13
 Identities = 34/44 (77%), Positives = 37/44 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           Y SGRTTGIV+DSGDGV+HTVPIYEG ALPHA LRLD +   LT
Sbjct: 60  YTSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELT 103


>AY970386-1|AAX82195.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  128 bits (310), Expect = 2e-29
 Identities = 58/59 (98%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 72.5 bits (170), Expect = 2e-12
 Identities = 33/44 (75%), Positives = 37/44 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           Y SGRTTGIV+DSGDGV+HTVPIYEG ALPHA LRL+ +   LT
Sbjct: 60  YTSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLRLNLAGRDLT 103


>AY970378-1|AAX82187.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  128 bits (310), Expect = 2e-29
 Identities = 58/59 (98%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 74.5 bits (175), Expect = 4e-13
 Identities = 34/44 (77%), Positives = 36/44 (81%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           Y SGRTTGIV+DSGDGV+HTVPIYEG ALPHA LRLD     LT
Sbjct: 60  YTSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLRLDLPGRELT 103


>AL160004-5|CAI19052.1|  342|Homo sapiens actin, alpha 1, skeletal
           muscle protein.
          Length = 342

 Score =  128 bits (309), Expect = 3e-29
 Identities = 62/78 (79%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RLD +   LTDYLMKILTERGYSF+T
Sbjct: 110 YASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVT 169

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 170 TAEREIVR-DIKEKLCYV 186



 Score =  115 bits (276), Expect = 3e-25
 Identities = 54/63 (85%), Positives = 57/63 (90%), Gaps = 1/63 (1%)
 Frame = +1

Query: 82  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEH 258
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 259 RAK 267
           ++K
Sbjct: 61  QSK 63



 Score = 61.3 bits (142), Expect = 4e-09
 Identities = 29/30 (96%), Positives = 29/30 (96%)
 Frame = +3

Query: 420 KANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KANREKMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 80  KANREKMTQIMFETFNVPAMYVAIQAVLSL 109



 Score = 48.0 bits (109), Expect = 4e-05
 Identities = 24/35 (68%), Positives = 27/35 (77%), Gaps = 2/35 (5%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVT--NWDDMEKIWHHTF 353
           AQSKRGILTLKYPIEHGI+T  N + M +I   TF
Sbjct: 60  AQSKRGILTLKYPIEHGIITKANREKMTQIMFETF 94


>AY970492-1|AAX82298.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  128 bits (308), Expect = 3e-29
 Identities = 58/59 (98%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLT+APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTQAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970490-1|AAX82296.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  127 bits (307), Expect = 4e-29
 Identities = 58/59 (98%), Positives = 58/59 (98%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRV PEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVTPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970444-1|AAX82253.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  127 bits (307), Expect = 4e-29
 Identities = 58/59 (98%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYN+LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNKLRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970500-1|AAX82306.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  127 bits (306), Expect = 6e-29
 Identities = 58/59 (98%), Positives = 58/59 (98%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ MFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQTMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970456-1|AAX82263.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  127 bits (306), Expect = 6e-29
 Identities = 57/59 (96%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPA+YVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAIYVAIQAVLSL 59



 Score = 75.4 bits (177), Expect = 3e-13
 Identities = 34/44 (77%), Positives = 37/44 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           Y SGRTTGIV+DSGDGV+HTVPIYEG ALPHA LRLD +   LT
Sbjct: 60  YTSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELT 103


>AY970442-1|AAX82251.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  127 bits (306), Expect = 6e-29
 Identities = 58/59 (98%), Positives = 58/59 (98%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKAN EKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANHEKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970429-1|AAX82238.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  127 bits (306), Expect = 6e-29
 Identities = 57/59 (96%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMT+IMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTRIMFETFNTPAMYVAIQAVLSL 59



 Score = 75.4 bits (177), Expect = 3e-13
 Identities = 34/44 (77%), Positives = 37/44 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           Y SGRTTGIV+DSGDGV+HTVPIYEG ALPHA LRLD +   LT
Sbjct: 60  YTSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELT 103


>AY970388-1|AAX82197.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  127 bits (306), Expect = 6e-29
 Identities = 57/59 (96%), Positives = 58/59 (98%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYV IQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVTIQAVLSL 59



 Score = 75.4 bits (177), Expect = 3e-13
 Identities = 34/44 (77%), Positives = 37/44 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           Y SGRTTGIV+DSGDGV+HTVPIYEG ALPHA LRLD +   LT
Sbjct: 60  YTSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELT 103


>AY970387-1|AAX82196.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  127 bits (306), Expect = 6e-29
 Identities = 57/59 (96%), Positives = 58/59 (98%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYV IQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVTIQAVLSL 59



 Score = 75.4 bits (177), Expect = 3e-13
 Identities = 34/44 (77%), Positives = 37/44 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           Y SGRTTGIV+DSGDGV+HTVPIYEG ALPHA LRLD +   LT
Sbjct: 60  YTSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELT 103


>AY970463-1|AAX82270.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  126 bits (305), Expect = 8e-29
 Identities = 57/59 (96%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFY+ELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYSELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 73.3 bits (172), Expect = 1e-12
 Identities = 33/44 (75%), Positives = 36/44 (81%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           Y SGRTTGIV+DSGDG +HTVPIYEG ALPHA LRLD +   LT
Sbjct: 60  YTSGRTTGIVMDSGDGFTHTVPIYEGNALPHATLRLDLAGRELT 103


>AY970458-1|AAX82265.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  126 bits (305), Expect = 8e-29
 Identities = 57/59 (96%), Positives = 59/59 (100%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHP+LLTEAPL+PKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLSPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 68.1 bits (159), Expect = 4e-11
 Identities = 32/44 (72%), Positives = 35/44 (79%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           Y SGRTTGIV+DSGD V+ TVPIYEG ALPHA LRLD +   LT
Sbjct: 60  YTSGRTTGIVMDSGDRVTPTVPIYEGNALPHATLRLDLAGRELT 103


>AY970432-1|AAX82241.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  126 bits (305), Expect = 8e-29
 Identities = 57/59 (96%), Positives = 58/59 (98%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKAN EKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANHEKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 71.7 bits (168), Expect = 3e-12
 Identities = 32/44 (72%), Positives = 36/44 (81%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           Y SG TTGIV+DSGDGV+HTVPIYEG ALPHA LRLD +   +T
Sbjct: 60  YTSGHTTGIVMDSGDGVTHTVPIYEGNALPHATLRLDLAGRDMT 103


>AY970392-1|AAX82201.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  126 bits (305), Expect = 8e-29
 Identities = 57/59 (96%), Positives = 58/59 (98%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKAN EKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANHEKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 73.3 bits (172), Expect = 1e-12
 Identities = 33/44 (75%), Positives = 37/44 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           Y SGRTTGIV+DSGDGV+HTVPIYEG ALPHA LRL+ +   LT
Sbjct: 60  YTSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLRLNLAGRELT 103


>AY970385-1|AAX82194.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  126 bits (305), Expect = 8e-29
 Identities = 57/59 (96%), Positives = 58/59 (98%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKAN EKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANHEKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 77.4 bits (182), Expect = 6e-14
 Identities = 34/44 (77%), Positives = 38/44 (86%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           Y SGRTTGIV+DSGDGV+H VPIYEGYALPHAI+RLD +   LT
Sbjct: 60  YTSGRTTGIVMDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLT 103


>AY970374-1|AAX82183.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  126 bits (305), Expect = 8e-29
 Identities = 58/59 (98%), Positives = 58/59 (98%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPL PKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLTPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970485-1|AAX82291.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  126 bits (304), Expect = 1e-28
 Identities = 58/59 (98%), Positives = 58/59 (98%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF TFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFGTFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970391-1|AAX82200.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  126 bits (304), Expect = 1e-28
 Identities = 57/59 (96%), Positives = 58/59 (98%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHP+LLTEAPLNP ANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPMANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 70.9 bits (166), Expect = 5e-12
 Identities = 32/44 (72%), Positives = 35/44 (79%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           Y SGRTTGI +DSGDGV+HT PIYEG ALPHA LRLD +   LT
Sbjct: 60  YTSGRTTGIFMDSGDGVTHTAPIYEGNALPHAPLRLDLAGRELT 103


>AY970365-1|AAX82175.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  126 bits (304), Expect = 1e-28
 Identities = 58/59 (98%), Positives = 58/59 (98%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNEL VAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELGVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>M16247-1|AAA51580.1|  232|Homo sapiens ACTG1 protein.
          Length = 232

 Score =  126 bits (303), Expect = 1e-28
 Identities = 62/77 (80%), Positives = 65/77 (84%)
 Frame = +2

Query: 512 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFITN 691
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T 
Sbjct: 1   ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTT 60

Query: 692 AXREIRS*TFKEKLCYV 742
           A REI     KEKLCYV
Sbjct: 61  AEREIVR-DIKEKLCYV 76


>AY970496-1|AAX82302.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  126 bits (303), Expect = 1e-28
 Identities = 58/59 (98%), Positives = 58/59 (98%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWH TFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHRTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970462-1|AAX82269.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  126 bits (303), Expect = 1e-28
 Identities = 57/59 (96%), Positives = 58/59 (98%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAV SL
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVPSL 59



 Score = 71.3 bits (167), Expect = 4e-12
 Identities = 32/43 (74%), Positives = 36/43 (83%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRL 637
           Y SGRTTGIV+DSGDGV+HTVPIYEG ALPHA LRL+ +   L
Sbjct: 60  YTSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLRLNLAGREL 102


>AY970426-1|AAX82235.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  126 bits (303), Expect = 1e-28
 Identities = 57/59 (96%), Positives = 58/59 (98%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAV SL
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVPSL 59



 Score = 74.1 bits (174), Expect = 6e-13
 Identities = 33/44 (75%), Positives = 37/44 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           Y SGRTTGIV+DSGDGV+HTVPIY+G ALPHA LRLD +   LT
Sbjct: 60  YTSGRTTGIVMDSGDGVTHTVPIYDGNALPHATLRLDLAGRELT 103


>AY970367-1|AAX82177.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  126 bits (303), Expect = 1e-28
 Identities = 58/59 (98%), Positives = 58/59 (98%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIW HTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWRHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 80.2 bits (189), Expect = 9e-15
 Identities = 36/44 (81%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIY+GYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYKGYALPHAILRLDLAGRDLT 103


>AY970454-1|AAX82261.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  125 bits (302), Expect = 2e-28
 Identities = 57/59 (96%), Positives = 58/59 (98%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEH +LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHSILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 75.4 bits (177), Expect = 3e-13
 Identities = 34/44 (77%), Positives = 37/44 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           Y SGRTTGIV+DSGDGV+HTVPIYEG ALPHA LRLD +   LT
Sbjct: 60  YTSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELT 103


>AY970455-1|AAX82262.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  125 bits (301), Expect = 2e-28
 Identities = 57/59 (96%), Positives = 58/59 (98%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAM VAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMCVAIQAVLSL 59



 Score = 75.4 bits (177), Expect = 3e-13
 Identities = 34/44 (77%), Positives = 37/44 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           Y SGRTTGIV+DSGDGV+HTVPIYEG ALPHA LRLD +   LT
Sbjct: 60  YTSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELT 103


>AY970483-1|AAX82289.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (300), Expect = 3e-28
 Identities = 57/59 (96%), Positives = 58/59 (98%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           +IWHHTFYNELRVAPEEHPVLLTEA LNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   RIWHHTFYNELRVAPEEHPVLLTEATLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 80.2 bits (189), Expect = 9e-15
 Identities = 36/44 (81%), Positives = 39/44 (88%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           Y SGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YTSGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970440-1|AAX82249.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 5e-28
 Identities = 56/59 (94%), Positives = 57/59 (96%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 1   KIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSL 59



 Score = 79.8 bits (188), Expect = 1e-14
 Identities = 36/44 (81%), Positives = 39/44 (88%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RLD +   LT
Sbjct: 60  YASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLT 103


>AY970439-1|AAX82248.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 5e-28
 Identities = 56/59 (94%), Positives = 57/59 (96%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 1   KIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSL 59



 Score = 79.8 bits (188), Expect = 1e-14
 Identities = 36/44 (81%), Positives = 39/44 (88%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RLD +   LT
Sbjct: 60  YASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLT 103


>AY970475-1|AAX82281.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  123 bits (297), Expect = 7e-28
 Identities = 56/59 (94%), Positives = 58/59 (98%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHT YNELRVAPEEHPVLLTEAPLNPKANRE++TQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTLYNELRVAPEEHPVLLTEAPLNPKANREEITQIMFETFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970461-1|AAX82268.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  123 bits (297), Expect = 7e-28
 Identities = 57/59 (96%), Positives = 57/59 (96%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHT YNELRVAPEEHPVLLTEA LNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTLYNELRVAPEEHPVLLTEATLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 72.1 bits (169), Expect = 2e-12
 Identities = 32/43 (74%), Positives = 36/43 (83%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRL 637
           Y SGRTTGIV+DSGDGV+HTVPIY+G ALPHA LRLD +   L
Sbjct: 60  YTSGRTTGIVMDSGDGVTHTVPIYDGNALPHATLRLDLAGREL 102


>AY970407-1|AAX82216.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  122 bits (294), Expect = 2e-27
 Identities = 57/59 (96%), Positives = 57/59 (96%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHT YNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAM VAIQAVLSL
Sbjct: 1   KIWHHTSYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMCVAIQAVLSL 59



 Score = 80.6 bits (190), Expect = 7e-15
 Identities = 36/44 (81%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGI++DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGILMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970427-1|AAX82236.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  121 bits (292), Expect = 3e-27
 Identities = 55/59 (93%), Positives = 57/59 (96%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIM ETFNTPAMYVA QA+LSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMSETFNTPAMYVANQAMLSL 59



 Score = 72.1 bits (169), Expect = 2e-12
 Identities = 32/43 (74%), Positives = 36/43 (83%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRL 637
           Y SGRTTGIV+DSGDGV+HTVPIY+G ALPHA LRLD +   L
Sbjct: 60  YTSGRTTGIVMDSGDGVTHTVPIYDGNALPHATLRLDLAGREL 102


>AY970451-1|AAX82259.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  121 bits (291), Expect = 4e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIW+HTFYNELRVAP+EHP+LLTEAPLNPK NREKMTQIMFE FNTPAMYVAIQAVLSL
Sbjct: 1   KIWYHTFYNELRVAPDEHPILLTEAPLNPKINREKMTQIMFEAFNTPAMYVAIQAVLSL 59



 Score = 74.9 bits (176), Expect = 3e-13
 Identities = 35/44 (79%), Positives = 38/44 (86%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+  VPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTLIVPIYEGYALPHAILRLDLAGRDLT 103


>AY970384-1|AAX82193.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  121 bits (291), Expect = 4e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIW+HTFYNELRVAP+EHP+LLTEAPLNPK NREKMTQIMFE FNTPAMYVAIQAVLSL
Sbjct: 1   KIWYHTFYNELRVAPDEHPILLTEAPLNPKINREKMTQIMFEAFNTPAMYVAIQAVLSL 59



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 37/44 (84%), Positives = 40/44 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970424-1|AAX82233.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  120 bits (289), Expect = 7e-27
 Identities = 54/59 (91%), Positives = 58/59 (98%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAP++HPVLLT+APLNPKANREKMTQIMFETFNT AMYVAIQA+LSL
Sbjct: 1   KIWHHTFYNELRVAPKQHPVLLTKAPLNPKANREKMTQIMFETFNTAAMYVAIQALLSL 59



 Score = 68.5 bits (160), Expect = 3e-11
 Identities = 31/44 (70%), Positives = 36/44 (81%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGI++DSGD V+HTVP Y GYALPH+IL LD +   LT
Sbjct: 60  YASGRTTGIMMDSGDEVTHTVPFYGGYALPHSILCLDLAGRDLT 103


>AY970481-1|AAX82287.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  120 bits (288), Expect = 9e-27
 Identities = 55/59 (93%), Positives = 56/59 (94%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIM E F+ PAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMLEIFDRPAMYVAIQAVLSL 59



 Score = 64.5 bits (150), Expect = 5e-10
 Identities = 30/44 (68%), Positives = 34/44 (77%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           Y SGRTT IV+D  DGV+HTVPIYE YALPHAILR+  +   LT
Sbjct: 60  YTSGRTTDIVMDYDDGVTHTVPIYEEYALPHAILRVCLAGQDLT 103


>X82208-1|CAA57692.1|  329|Homo sapiens beta-centractin protein.
          Length = 329

 Score =  119 bits (287), Expect = 1e-26
 Identities = 49/86 (56%), Positives = 70/86 (81%), Gaps = 1/86 (1%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANR 431
           A+  RG+LT++YP+EHG+V +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP  NR
Sbjct: 32  AEEHRGLLTIRYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKNR 91

Query: 432 EKMTQIMFETFNTPAMYVAIQAVLSL 509
           EK  ++ FETFN PA+++++QAVLSL
Sbjct: 92  EKAAEVFFETFNVPALFISMQAVLSL 117



 Score = 91.5 bits (217), Expect = 4e-18
 Identities = 41/78 (52%), Positives = 58/78 (74%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YA+GRTTG+VLDSGDGV+H VPIYEG+A+PH+I+R+D +   ++ YL  +L + G  F T
Sbjct: 118 YATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVSRYLRLLLRKEGVDFHT 177

Query: 689 NAXREIRS*TFKEKLCYV 742
           +A  E+   T KE+ CY+
Sbjct: 178 SAEFEVVR-TIKERACYL 194



 Score = 36.3 bits (80), Expect = 0.14
 Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 3/36 (8%)
 Frame = +1

Query: 163 PRAVFPSIVGRPRHQGVMVGMGQKDSYVG---DEHR 261
           P+  FP+ VGRP+H  VM G  + D ++G   +EHR
Sbjct: 1   PKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHR 36


>X82207-1|CAA57691.1|  376|Homo sapiens beta-centracetin protein.
          Length = 376

 Score =  119 bits (287), Expect = 1e-26
 Identities = 49/86 (56%), Positives = 70/86 (81%), Gaps = 1/86 (1%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANR 431
           A+  RG+LT++YP+EHG+V +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP  NR
Sbjct: 62  AEEHRGLLTIRYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKNR 121

Query: 432 EKMTQIMFETFNTPAMYVAIQAVLSL 509
           EK  ++ FETFN PA+++++QAVLSL
Sbjct: 122 EKAAEVFFETFNVPALFISMQAVLSL 147



 Score = 91.5 bits (217), Expect = 4e-18
 Identities = 41/78 (52%), Positives = 58/78 (74%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YA+GRTTG+VLDSGDGV+H VPIYEG+A+PH+I+R+D +   ++ YL  +L + G  F T
Sbjct: 148 YATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVSRYLRLLLRKEGVDFHT 207

Query: 689 NAXREIRS*TFKEKLCYV 742
           +A  E+   T KE+ CY+
Sbjct: 208 SAEFEVVR-TIKERACYL 224



 Score = 65.3 bits (152), Expect = 3e-10
 Identities = 29/55 (52%), Positives = 39/55 (70%), Gaps = 3/55 (5%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG---DEHR 261
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G   +EHR
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHR 66


>BC010090-1|AAH10090.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog B, centractin beta (yeast) protein.
          Length = 376

 Score =  119 bits (287), Expect = 1e-26
 Identities = 49/86 (56%), Positives = 70/86 (81%), Gaps = 1/86 (1%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANR 431
           A+  RG+LT++YP+EHG+V +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP  NR
Sbjct: 62  AEEHRGLLTIRYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKNR 121

Query: 432 EKMTQIMFETFNTPAMYVAIQAVLSL 509
           EK  ++ FETFN PA+++++QAVLSL
Sbjct: 122 EKAAEVFFETFNVPALFISMQAVLSL 147



 Score = 91.5 bits (217), Expect = 4e-18
 Identities = 41/78 (52%), Positives = 58/78 (74%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YA+GRTTG+VLDSGDGV+H VPIYEG+A+PH+I+R+D +   ++ YL  +L + G  F T
Sbjct: 148 YATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVSRYLRLLLRKEGVDFHT 207

Query: 689 NAXREIRS*TFKEKLCYV 742
           +A  E+   T KE+ CY+
Sbjct: 208 SAEFEVVR-TIKERACYL 224



 Score = 65.3 bits (152), Expect = 3e-10
 Identities = 29/55 (52%), Positives = 39/55 (70%), Gaps = 3/55 (5%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG---DEHR 261
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G   +EHR
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHR 66


>BC006372-1|AAH06372.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog B, centractin beta (yeast) protein.
          Length = 376

 Score =  119 bits (287), Expect = 1e-26
 Identities = 49/86 (56%), Positives = 70/86 (81%), Gaps = 1/86 (1%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANR 431
           A+  RG+LT++YP+EHG+V +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP  NR
Sbjct: 62  AEEHRGLLTIRYPMEHGVVRDWNDMERIWQYAYSKDQLQTFSEEHPVLLTEAPLNPSKNR 121

Query: 432 EKMTQIMFETFNTPAMYVAIQAVLSL 509
           EK  ++ FETFN PA+++++QAVLSL
Sbjct: 122 EKAAEVFFETFNVPALFISMQAVLSL 147



 Score = 91.5 bits (217), Expect = 4e-18
 Identities = 41/78 (52%), Positives = 58/78 (74%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YA+GRTTG+VLDSGDGV+H VPIYEG+A+PH+I+R+D +   ++ YL  +L + G  F T
Sbjct: 148 YATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVSRYLRLLLRKEGVDFHT 207

Query: 689 NAXREIRS*TFKEKLCYV 742
           +A  E+   T KE+ CY+
Sbjct: 208 SAEFEVVR-TIKERACYL 224



 Score = 65.3 bits (152), Expect = 3e-10
 Identities = 29/55 (52%), Positives = 39/55 (70%), Gaps = 3/55 (5%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG---DEHR 261
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G   +EHR
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHR 66


>BC004374-1|AAH04374.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog B, centractin beta (yeast) protein.
          Length = 376

 Score =  119 bits (287), Expect = 1e-26
 Identities = 49/86 (56%), Positives = 70/86 (81%), Gaps = 1/86 (1%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANR 431
           A+  RG+LT++YP+EHG+V +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP  NR
Sbjct: 62  AEEHRGLLTIRYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKNR 121

Query: 432 EKMTQIMFETFNTPAMYVAIQAVLSL 509
           EK  ++ FETFN PA+++++QAVLSL
Sbjct: 122 EKAAEVFFETFNVPALFISMQAVLSL 147



 Score = 91.5 bits (217), Expect = 4e-18
 Identities = 41/78 (52%), Positives = 58/78 (74%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YA+GRTTG+VLDSGDGV+H VPIYEG+A+PH+I+R+D +   ++ YL  +L + G  F T
Sbjct: 148 YATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVSRYLRLLLRKEGVDFHT 207

Query: 689 NAXREIRS*TFKEKLCYV 742
           +A  E+   T KE+ CY+
Sbjct: 208 SAEFEVVR-TIKERACYL 224



 Score = 65.3 bits (152), Expect = 3e-10
 Identities = 29/55 (52%), Positives = 39/55 (70%), Gaps = 3/55 (5%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG---DEHR 261
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G   +EHR
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHR 66


>AY970452-1|AAX82260.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  119 bits (287), Expect = 1e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIW+HTFYNELRVAP+EHP+LLTEAPLNPK NREKMTQIMFE FNTPAMY AIQAVLSL
Sbjct: 1   KIWYHTFYNELRVAPDEHPILLTEAPLNPKINREKMTQIMFEAFNTPAMYAAIQAVLSL 59



 Score = 79.4 bits (187), Expect = 2e-14
 Identities = 36/44 (81%), Positives = 39/44 (88%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+H VPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHIVPIYEGYALPHAILRLDLAGRDLT 103


>AY970448-1|AAX82257.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  119 bits (287), Expect = 1e-26
 Identities = 54/59 (91%), Positives = 56/59 (94%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFY E+RV PEEHPVL+TEA LNPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYKEVRVVPEEHPVLVTEATLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 67.7 bits (158), Expect = 5e-11
 Identities = 30/44 (68%), Positives = 34/44 (77%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           Y  GR  GIV+DSGDGV+HTVPIY+G ALPHA LRLD +   LT
Sbjct: 60  YTFGRNNGIVMDSGDGVTHTVPIYDGNALPHATLRLDLAGRELT 103


>AY970447-1|AAX82256.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  119 bits (287), Expect = 1e-26
 Identities = 54/59 (91%), Positives = 56/59 (94%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIM E F+ PAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMLEIFDRPAMYVAIQAVLSL 59



 Score = 74.9 bits (176), Expect = 3e-13
 Identities = 34/44 (77%), Positives = 37/44 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           Y SGRTTGIV+DSGDGV+HTVPIYEG ALPHA LRLD +   LT
Sbjct: 60  YTSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLRLDLAGQDLT 103


>AC017099-2|AAY24280.1|  376|Homo sapiens unknown protein.
          Length = 376

 Score =  119 bits (287), Expect = 1e-26
 Identities = 49/86 (56%), Positives = 70/86 (81%), Gaps = 1/86 (1%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANR 431
           A+  RG+LT++YP+EHG+V +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP  NR
Sbjct: 62  AEEHRGLLTIRYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKNR 121

Query: 432 EKMTQIMFETFNTPAMYVAIQAVLSL 509
           EK  ++ FETFN PA+++++QAVLSL
Sbjct: 122 EKAAEVFFETFNVPALFISMQAVLSL 147



 Score = 91.5 bits (217), Expect = 4e-18
 Identities = 41/78 (52%), Positives = 58/78 (74%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YA+GRTTG+VLDSGDGV+H VPIYEG+A+PH+I+R+D +   ++ YL  +L + G  F T
Sbjct: 148 YATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVSRYLRLLLRKEGVDFHT 207

Query: 689 NAXREIRS*TFKEKLCYV 742
           +A  E+   T KE+ CY+
Sbjct: 208 SAEFEVVR-TIKERACYL 224



 Score = 65.3 bits (152), Expect = 3e-10
 Identities = 29/55 (52%), Positives = 39/55 (70%), Gaps = 3/55 (5%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG---DEHR 261
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G   +EHR
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHR 66


>AY970433-1|AAX82242.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  118 bits (285), Expect = 2e-26
 Identities = 53/59 (89%), Positives = 56/59 (94%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIW+HTFYNELRVAP+EHP+LLTEAPLNPK NREKM QIMFE FNTPAMYVAIQAVLSL
Sbjct: 1   KIWYHTFYNELRVAPDEHPILLTEAPLNPKINREKMIQIMFEAFNTPAMYVAIQAVLSL 59



 Score = 79.4 bits (187), Expect = 2e-14
 Identities = 36/44 (81%), Positives = 39/44 (88%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV+DSGDGV+H VPIYEGYALPHAILRLD +   LT
Sbjct: 60  YASGRTTGIVMDSGDGVTHIVPIYEGYALPHAILRLDLAGRDLT 103


>AY970425-1|AAX82234.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  118 bits (285), Expect = 2e-26
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNEL VA +EHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA+LSL
Sbjct: 1   KIWHHTFYNELCVAAKEHPMLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAMLSL 59



 Score = 70.9 bits (166), Expect = 5e-12
 Identities = 32/44 (72%), Positives = 37/44 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           Y SGRTTGIV+DSGDGV+HTVPIY+G ALPHAILR+  +   LT
Sbjct: 60  YTSGRTTGIVMDSGDGVTHTVPIYDGNALPHAILRVCLAGQDLT 103


>Z14978-1|CAA78701.1|  376|Homo sapiens actin-related protein
           protein.
          Length = 376

 Score =  118 bits (283), Expect = 4e-26
 Identities = 48/86 (55%), Positives = 71/86 (82%), Gaps = 1/86 (1%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANR 431
           A+  RG+L+++YP+EHGIV +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP+ NR
Sbjct: 62  AEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNR 121

Query: 432 EKMTQIMFETFNTPAMYVAIQAVLSL 509
           E+  ++ FETFN PA+++++QAVLSL
Sbjct: 122 ERAAEVFFETFNVPALFISMQAVLSL 147



 Score = 88.2 bits (209), Expect = 3e-17
 Identities = 39/78 (50%), Positives = 57/78 (73%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YA+GRTTG+VLDSGDGV+H VPIYEG+A+PH+I+R+D +   ++ +L   L + GY F +
Sbjct: 148 YATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKEGYDFHS 207

Query: 689 NAXREIRS*TFKEKLCYV 742
           ++  EI     KE+ CY+
Sbjct: 208 SSEFEIVK-AIKERACYL 224



 Score = 64.5 bits (150), Expect = 5e-10
 Identities = 29/55 (52%), Positives = 39/55 (70%), Gaps = 3/55 (5%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG---DEHR 261
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G   +EHR
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHR 66


>X82206-1|CAA57690.1|  376|Homo sapiens alpha-centractin protein.
          Length = 376

 Score =  118 bits (283), Expect = 4e-26
 Identities = 48/86 (55%), Positives = 71/86 (82%), Gaps = 1/86 (1%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANR 431
           A+  RG+L+++YP+EHGIV +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP+ NR
Sbjct: 62  AEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNR 121

Query: 432 EKMTQIMFETFNTPAMYVAIQAVLSL 509
           E+  ++ FETFN PA+++++QAVLSL
Sbjct: 122 ERAAEVFFETFNVPALFISMQAVLSL 147



 Score = 88.2 bits (209), Expect = 3e-17
 Identities = 39/78 (50%), Positives = 57/78 (73%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YA+GRTTG+VLDSGDGV+H VPIYEG+A+PH+I+R+D +   ++ +L   L + GY F +
Sbjct: 148 YATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKEGYDFHS 207

Query: 689 NAXREIRS*TFKEKLCYV 742
           ++  EI     KE+ CY+
Sbjct: 208 SSEFEIVK-AIKERACYL 224



 Score = 64.5 bits (150), Expect = 5e-10
 Identities = 29/55 (52%), Positives = 39/55 (70%), Gaps = 3/55 (5%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG---DEHR 261
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G   +EHR
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHR 66


>BC026016-1|AAH26016.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog A, centractin alpha (yeast) protein.
          Length = 376

 Score =  118 bits (283), Expect = 4e-26
 Identities = 48/86 (55%), Positives = 71/86 (82%), Gaps = 1/86 (1%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANR 431
           A+  RG+L+++YP+EHGIV +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP+ NR
Sbjct: 62  AEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNR 121

Query: 432 EKMTQIMFETFNTPAMYVAIQAVLSL 509
           E+  ++ FETFN PA+++++QAVLSL
Sbjct: 122 ERAAEVFFETFNVPALFISMQAVLSL 147



 Score = 88.2 bits (209), Expect = 3e-17
 Identities = 39/78 (50%), Positives = 57/78 (73%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YA+GRTTG+VLDSGDGV+H VPIYEG+A+PH+I+R+D +   ++ +L   L + GY F +
Sbjct: 148 YATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKEGYDFHS 207

Query: 689 NAXREIRS*TFKEKLCYV 742
           ++  EI     KE+ CY+
Sbjct: 208 SSEFEIVK-AIKERACYL 224



 Score = 64.5 bits (150), Expect = 5e-10
 Identities = 29/55 (52%), Positives = 39/55 (70%), Gaps = 3/55 (5%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG---DEHR 261
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G   +EHR
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHR 66


>BC000693-1|AAH00693.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog A, centractin alpha (yeast) protein.
          Length = 376

 Score =  118 bits (283), Expect = 4e-26
 Identities = 48/86 (55%), Positives = 71/86 (82%), Gaps = 1/86 (1%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANR 431
           A+  RG+L+++YP+EHGIV +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP+ NR
Sbjct: 62  AEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNR 121

Query: 432 EKMTQIMFETFNTPAMYVAIQAVLSL 509
           E+  ++ FETFN PA+++++QAVLSL
Sbjct: 122 ERAAEVFFETFNVPALFISMQAVLSL 147



 Score = 88.2 bits (209), Expect = 3e-17
 Identities = 39/78 (50%), Positives = 57/78 (73%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YA+GRTTG+VLDSGDGV+H VPIYEG+A+PH+I+R+D +   ++ +L   L + GY F +
Sbjct: 148 YATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKEGYDFHS 207

Query: 689 NAXREIRS*TFKEKLCYV 742
           ++  EI     KE+ CY+
Sbjct: 208 SSEFEIVK-AIKERACYL 224



 Score = 64.5 bits (150), Expect = 5e-10
 Identities = 29/55 (52%), Positives = 39/55 (70%), Gaps = 3/55 (5%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG---DEHR 261
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G   +EHR
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHR 66


>AL121928-12|CAC08404.1|  376|Homo sapiens ARP1 actin-related
           protein 1 homolog A, centractin alpha (yeast) protein.
          Length = 376

 Score =  118 bits (283), Expect = 4e-26
 Identities = 48/86 (55%), Positives = 71/86 (82%), Gaps = 1/86 (1%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANR 431
           A+  RG+L+++YP+EHGIV +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP+ NR
Sbjct: 62  AEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNR 121

Query: 432 EKMTQIMFETFNTPAMYVAIQAVLSL 509
           E+  ++ FETFN PA+++++QAVLSL
Sbjct: 122 ERAAEVFFETFNVPALFISMQAVLSL 147



 Score = 88.2 bits (209), Expect = 3e-17
 Identities = 39/78 (50%), Positives = 57/78 (73%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YA+GRTTG+VLDSGDGV+H VPIYEG+A+PH+I+R+D +   ++ +L   L + GY F +
Sbjct: 148 YATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKEGYDFHS 207

Query: 689 NAXREIRS*TFKEKLCYV 742
           ++  EI     KE+ CY+
Sbjct: 208 SSEFEIVK-AIKERACYL 224



 Score = 64.5 bits (150), Expect = 5e-10
 Identities = 29/55 (52%), Positives = 39/55 (70%), Gaps = 3/55 (5%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG---DEHR 261
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G   +EHR
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHR 66


>AY970459-1|AAX82266.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  117 bits (281), Expect = 6e-26
 Identities = 52/59 (88%), Positives = 58/59 (98%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHH F+NELRVAP++HP+LLT+APL+PKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 1   KIWHHIFHNELRVAPKQHPMLLTKAPLDPKANREKMTQIMFETFNTPAMYVAIQAVLSL 59



 Score = 75.4 bits (177), Expect = 3e-13
 Identities = 34/44 (77%), Positives = 37/44 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           Y SGRTTGIV+DSGDGV+HTVPIYEG ALPHA LRLD +   LT
Sbjct: 60  YTSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELT 103


>BC113036-1|AAI13037.1|  103|Homo sapiens ACTB protein protein.
          Length = 103

 Score =  114 bits (274), Expect = 4e-25
 Identities = 53/62 (85%), Positives = 56/62 (90%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 36  YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 95

Query: 689 NA 694
            A
Sbjct: 96  TA 97



 Score = 68.5 bits (160), Expect = 3e-11
 Identities = 32/32 (100%), Positives = 32/32 (100%)
 Frame = +3

Query: 414 NPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           NPKANREKMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 4   NPKANREKMTQIMFETFNTPAMYVAIQAVLSL 35


>AY970398-1|AAX82207.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  113 bits (273), Expect = 6e-25
 Identities = 51/59 (86%), Positives = 56/59 (94%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHH F+NELRVAP++HPVLLT+APLNPKANREKMT IMFETFNT AMYVAIQA+LSL
Sbjct: 1   KIWHHIFHNELRVAPKQHPVLLTKAPLNPKANREKMTHIMFETFNTAAMYVAIQALLSL 59



 Score = 69.7 bits (163), Expect = 1e-11
 Identities = 32/44 (72%), Positives = 36/44 (81%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGI++DSGD V+HTVP Y GYALPHAIL LD +   LT
Sbjct: 60  YASGRTTGIMMDSGDEVTHTVPFYGGYALPHAILCLDLAGRDLT 103


>AY970396-1|AAX82205.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  113 bits (272), Expect = 8e-25
 Identities = 51/59 (86%), Positives = 56/59 (94%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYN+L VAPEE+ VL+T+APLNPKANREKMTQIMFE FNTPAMY+AIQAVLSL
Sbjct: 1   KIWHHTFYNKLHVAPEEYLVLMTKAPLNPKANREKMTQIMFEVFNTPAMYMAIQAVLSL 59



 Score = 72.9 bits (171), Expect = 1e-12
 Identities = 33/44 (75%), Positives = 36/44 (81%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           Y SGRTTGIV+D GDGV+HTVPIYEGY LPHAIL LD +   LT
Sbjct: 60  YTSGRTTGIVMDFGDGVAHTVPIYEGYPLPHAILHLDLAGWDLT 103


>AY970395-1|AAX82204.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  113 bits (272), Expect = 8e-25
 Identities = 52/59 (88%), Positives = 55/59 (93%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHH FYN LRVAPEE  VLLTEAPLNP+ANREKMTQIMF+TFNTPAMYVAIQAVL+L
Sbjct: 1   KIWHHVFYNVLRVAPEEQVVLLTEAPLNPRANREKMTQIMFKTFNTPAMYVAIQAVLTL 59



 Score = 64.5 bits (150), Expect = 5e-10
 Identities = 29/44 (65%), Positives = 35/44 (79%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           ++SG TTGIV+DSGDGV+HTVPIYE + LPH IL LD +   LT
Sbjct: 60  HSSGCTTGIVMDSGDGVTHTVPIYERHHLPHTILHLDLAGQDLT 103


>AY970400-1|AAX82209.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  111 bits (268), Expect = 2e-24
 Identities = 50/59 (84%), Positives = 55/59 (93%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEE P+LL EAPLNPKAN +KMTQI+FETFNTPAMY+AIQ +LSL
Sbjct: 1   KIWHHTFYNELRVAPEEQPMLLIEAPLNPKANCKKMTQIIFETFNTPAMYLAIQTMLSL 59



 Score = 73.3 bits (172), Expect = 1e-12
 Identities = 33/39 (84%), Positives = 35/39 (89%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFS 625
           YASGRTTGIVLDS DGV+HTVPIYEGYALP AIL LD +
Sbjct: 60  YASGRTTGIVLDSSDGVTHTVPIYEGYALPQAILHLDLA 98


>AY970379-1|AAX82188.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  111 bits (267), Expect = 3e-24
 Identities = 49/59 (83%), Positives = 55/59 (93%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNEL VAP+EH +LLTE PLNPKAN +KMTQIMFETFNTPA+Y+AIQA+LSL
Sbjct: 1   KIWHHTFYNELHVAPKEHRMLLTEVPLNPKANHKKMTQIMFETFNTPAVYMAIQAMLSL 59



 Score = 65.3 bits (152), Expect = 3e-10
 Identities = 31/44 (70%), Positives = 34/44 (77%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           Y  G TTGIV+DS DGV+HTVPIYEGYALP AIL LD +   LT
Sbjct: 60  YTYGCTTGIVMDSSDGVTHTVPIYEGYALPRAILCLDVAGRDLT 103


>AY970438-1|AAX82247.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  110 bits (265), Expect = 5e-24
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIW H FYNEL VAPEE  VLLTEAPLNP+ANREKMTQIMF+TFNTPAMYVAIQAVLSL
Sbjct: 1   KIWDHVFYNELWVAPEEQVVLLTEAPLNPRANREKMTQIMFKTFNTPAMYVAIQAVLSL 59



 Score = 65.3 bits (152), Expect = 3e-10
 Identities = 29/44 (65%), Positives = 35/44 (79%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           ++SG TTGIV+DSGDGV+HTVPIYE + LPH IL LD +   LT
Sbjct: 60  HSSGCTTGIVMDSGDGVTHTVPIYERHTLPHTILHLDLAGQDLT 103


>AY970467-1|AAX82273.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  110 bits (264), Expect = 7e-24
 Identities = 49/59 (83%), Positives = 55/59 (93%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEE P+LL EAPLNP+AN +KMTQI+FETFNTPAMY+AIQ +LSL
Sbjct: 1   KIWHHTFYNELRVAPEEQPMLLFEAPLNPRANCKKMTQIIFETFNTPAMYLAIQTMLSL 59



 Score = 74.5 bits (175), Expect = 4e-13
 Identities = 35/44 (79%), Positives = 38/44 (86%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIVLDS DGV+HTVPIYEGYALP+AIL LD +   LT
Sbjct: 60  YASGRTTGIVLDSSDGVTHTVPIYEGYALPNAILLLDLAGRDLT 103


>AY970422-1|AAX82231.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  110 bits (264), Expect = 7e-24
 Identities = 49/59 (83%), Positives = 55/59 (93%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEE P+LL EAPLNP+AN +KMTQI+FETFNTPAMY+AIQ +LSL
Sbjct: 1   KIWHHTFYNELRVAPEEQPMLLFEAPLNPRANCKKMTQIIFETFNTPAMYLAIQTMLSL 59



 Score = 74.9 bits (176), Expect = 3e-13
 Identities = 35/44 (79%), Positives = 37/44 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIV DS DGV+HTVPIYEGYALPHAIL LD +   LT
Sbjct: 60  YASGRTTGIVSDSSDGVTHTVPIYEGYALPHAILLLDLAGRDLT 103


>AY970401-1|AAX82210.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  110 bits (264), Expect = 7e-24
 Identities = 49/59 (83%), Positives = 55/59 (93%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNELRVAPEE P+LL EAPLNP+AN +KMTQI+FETFNTPAMY+AIQ +LSL
Sbjct: 1   KIWHHTFYNELRVAPEEQPMLLFEAPLNPRANCKKMTQIIFETFNTPAMYLAIQTMLSL 59



 Score = 74.5 bits (175), Expect = 4e-13
 Identities = 35/44 (79%), Positives = 38/44 (86%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIVLDS DGV+HTVPIYEGYALP+AIL LD +   LT
Sbjct: 60  YASGRTTGIVLDSSDGVTHTVPIYEGYALPNAILLLDLAGRDLT 103


>AY970445-1|AAX82254.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  109 bits (262), Expect = 1e-23
 Identities = 49/59 (83%), Positives = 55/59 (93%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHH F+NELRVAP++HPVLLT+APLNP+ANREKMT IMFETF T AMYVAIQA+LSL
Sbjct: 1   KIWHHIFHNELRVAPKQHPVLLTKAPLNPRANREKMTHIMFETFYTAAMYVAIQALLSL 59



 Score = 66.5 bits (155), Expect = 1e-10
 Identities = 31/44 (70%), Positives = 35/44 (79%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGI++DSGD V+HTV  Y GYALPHAIL LD +   LT
Sbjct: 60  YASGRTTGIMMDSGDEVTHTVAFYGGYALPHAILCLDLAGRDLT 103


>AY970423-1|AAX82232.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  108 bits (260), Expect = 2e-23
 Identities = 48/59 (81%), Positives = 55/59 (93%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           +IWHHTFYNELRVAPEE P+LL EAPLNP+AN +KMTQI+FETFNTPAMY+AIQ +LSL
Sbjct: 1   EIWHHTFYNELRVAPEEQPMLLFEAPLNPRANCKKMTQIIFETFNTPAMYLAIQTMLSL 59



 Score = 74.5 bits (175), Expect = 4e-13
 Identities = 35/44 (79%), Positives = 38/44 (86%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTTGIVLDS DGV+HTVPIYEGYALP+AIL LD +   LT
Sbjct: 60  YASGRTTGIVLDSSDGVTHTVPIYEGYALPNAILLLDLAGRDLT 103


>AY970484-1|AAX82290.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  108 bits (259), Expect = 3e-23
 Identities = 48/59 (81%), Positives = 54/59 (91%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNEL VAP+EH +LLTE PLN KAN +KMTQIMFETFNTPA+Y+AIQA+LSL
Sbjct: 1   KIWHHTFYNELHVAPKEHRMLLTEVPLNSKANHKKMTQIMFETFNTPAVYMAIQAMLSL 59



 Score = 65.3 bits (152), Expect = 3e-10
 Identities = 31/44 (70%), Positives = 34/44 (77%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           Y  G TTGIV+DS DGV+HTVPIYEGYALP AIL LD +   LT
Sbjct: 60  YTYGCTTGIVMDSSDGVTHTVPIYEGYALPRAILCLDVAGRDLT 103


>AY970465-1|AAX82272.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  106 bits (255), Expect = 9e-23
 Identities = 51/58 (87%), Positives = 54/58 (93%), Gaps = 1/58 (1%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF-NTPAMYVAIQAVL 503
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKAN  KMTQI FETF NTPA+Y+AIQAV+
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKAN-HKMTQITFETFSNTPAIYMAIQAVV 57



 Score = 64.5 bits (150), Expect = 5e-10
 Identities = 32/44 (72%), Positives = 36/44 (81%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASG TTGIV+DSG+GV+HT  IYE YALPHAILRLD +   LT
Sbjct: 61  YASGLTTGIVMDSGNGVTHTA-IYEWYALPHAILRLDLAGLDLT 103


>AY970436-1|AAX82245.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  105 bits (253), Expect = 2e-22
 Identities = 50/59 (84%), Positives = 53/59 (89%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHH FYNEL VA EE  VLLTEAPLNP+ANREKMTQIMF+TFNT AMYVAIQAVL+L
Sbjct: 1   KIWHHVFYNELCVALEEQVVLLTEAPLNPRANREKMTQIMFKTFNTQAMYVAIQAVLTL 59



 Score = 65.3 bits (152), Expect = 3e-10
 Identities = 29/44 (65%), Positives = 35/44 (79%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           ++SG TTGIV+DSGDGV+HTVPIYE + LPH IL LD +   LT
Sbjct: 60  HSSGCTTGIVMDSGDGVTHTVPIYERHTLPHTILHLDLAGQDLT 103


>AY970503-1|AAX82309.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  105 bits (252), Expect = 2e-22
 Identities = 48/59 (81%), Positives = 53/59 (89%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNEL VA +EHP+LLT+ PL+PKANREKMTQIM E F+ PAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELCVAAKEHPMLLTKVPLSPKANREKMTQIMLEIFDRPAMYVAIQAVLSL 59



 Score = 67.3 bits (157), Expect = 7e-11
 Identities = 31/44 (70%), Positives = 35/44 (79%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           Y SGRTTGIV+D  DGV+HTVPIYE YALPHAILR+  +   LT
Sbjct: 60  YTSGRTTGIVMDYDDGVTHTVPIYEEYALPHAILRVCLAGQDLT 103


>AY970437-1|AAX82246.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  105 bits (252), Expect = 2e-22
 Identities = 51/59 (86%), Positives = 52/59 (88%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIW HTFYNEL VA EEHPVLL EA  NPKANREKMTQIMFETFN+PAMYVAIQ VLSL
Sbjct: 1   KIWDHTFYNELCVALEEHPVLLIEACPNPKANREKMTQIMFETFNSPAMYVAIQPVLSL 59



 Score = 67.3 bits (157), Expect = 7e-11
 Identities = 35/54 (64%), Positives = 41/54 (75%), Gaps = 2/54 (3%)
 Frame = +2

Query: 470 ARHVRRHPSRALAYASGRTTGIVLDSGDGV--SHTVPIYEGYALPHAILRLDFS 625
           A +V   P  +L YASGRT+GIV DSGDGV  +HTVPIY GYALPHA+L LD +
Sbjct: 48  AMYVAIQPVLSL-YASGRTSGIVRDSGDGVRVTHTVPIYVGYALPHAVLHLDLA 100


>AY970394-1|AAX82203.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  105 bits (251), Expect = 3e-22
 Identities = 48/59 (81%), Positives = 53/59 (89%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNEL VA +EHP+LLT+APL+PKAN EKMTQIM E F+ PAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELCVAAKEHPMLLTKAPLSPKANHEKMTQIMLEIFSRPAMYVAIQAVLSL 59



 Score = 65.7 bits (153), Expect = 2e-10
 Identities = 30/44 (68%), Positives = 33/44 (75%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           Y SGRTT IV+D  DGV+HTVPIY+G ALPHA LRLD     LT
Sbjct: 60  YTSGRTTDIVMDYDDGVTHTVPIYDGNALPHATLRLDLGGRELT 103


>AY970434-1|AAX82243.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  103 bits (247), Expect = 8e-22
 Identities = 49/59 (83%), Positives = 52/59 (88%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHH FYNEL VA EE  VLLTEAPL P+ANREKMTQIMF+TFNT AMYVAIQAVL+L
Sbjct: 1   KIWHHVFYNELCVALEEQVVLLTEAPLKPRANREKMTQIMFKTFNTQAMYVAIQAVLTL 59



 Score = 65.3 bits (152), Expect = 3e-10
 Identities = 29/44 (65%), Positives = 35/44 (79%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           ++SG TTGIV+DSGDGV+HTVPIYE + LPH IL LD +   LT
Sbjct: 60  HSSGWTTGIVMDSGDGVTHTVPIYERHTLPHTILHLDLAGQDLT 103


>AY970435-1|AAX82244.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  102 bits (244), Expect = 2e-21
 Identities = 48/59 (81%), Positives = 52/59 (88%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHH FYNEL VA EE  VLLTE PLNP+ANREKMTQIMF+TFNT AMYVAI+AVL+L
Sbjct: 1   KIWHHVFYNELCVALEEQVVLLTEPPLNPRANREKMTQIMFKTFNTQAMYVAIRAVLTL 59



 Score = 65.3 bits (152), Expect = 3e-10
 Identities = 29/44 (65%), Positives = 35/44 (79%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           ++SG TTGIV+DSGDGV+HTVPIYE + LPH IL LD +   LT
Sbjct: 60  HSSGCTTGIVMDSGDGVTHTVPIYERHTLPHTILHLDLAGQDLT 103


>AY970482-1|AAX82288.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  101 bits (243), Expect = 3e-21
 Identities = 46/59 (77%), Positives = 52/59 (88%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNEL VA +EHP+LLT+ PL+PKAN +KMTQIM E F+ PAMYVAIQAVLSL
Sbjct: 1   KIWHHTFYNELCVAAKEHPMLLTKVPLSPKANHKKMTQIMLEIFDRPAMYVAIQAVLSL 59



 Score = 64.5 bits (150), Expect = 5e-10
 Identities = 30/44 (68%), Positives = 34/44 (77%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           Y SGRTT IV+D  DGV+HTVPIYE YALPHAILR+  +   LT
Sbjct: 60  YTSGRTTDIVMDYDDGVTHTVPIYEEYALPHAILRVCLAGQDLT 103


>AY970450-1|AAX82258.1|  102|Homo sapiens actin-like protein
           protein.
          Length = 102

 Score =  101 bits (243), Expect = 3e-21
 Identities = 46/59 (77%), Positives = 52/59 (88%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYNEL VAP+EHPVLLT+ PLNPKAN EK+ QIMFETFN PAMY+AI  +LS+
Sbjct: 1   KIWHHTFYNEL-VAPKEHPVLLTKVPLNPKANHEKIAQIMFETFNIPAMYMAIWVMLSV 58



 Score = 43.2 bits (97), Expect = 0.001
 Identities = 23/44 (52%), Positives = 29/44 (65%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASG TTGIV+DS    +++V I E YAL +AIL  D +   LT
Sbjct: 59  YASGHTTGIVMDSSGRFTYSVLISEDYALLYAILHPDLACRDLT 102


>AY970397-1|AAX82206.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  100 bits (240), Expect = 6e-21
 Identities = 47/59 (79%), Positives = 52/59 (88%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           KIWHHTFYN+L VAPEE+ VL+T+APL  KANRE MTQIMFE FNT AMY+AIQAVLSL
Sbjct: 1   KIWHHTFYNKLHVAPEEYLVLMTKAPLMTKANREMMTQIMFEVFNTLAMYMAIQAVLSL 59



 Score = 74.1 bits (174), Expect = 6e-13
 Identities = 33/44 (75%), Positives = 36/44 (81%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           Y SGRTTGI +DSGDGV+HTVPIYEGY LPHAIL LD +   LT
Sbjct: 60  YTSGRTTGIAMDSGDGVAHTVPIYEGYTLPHAILHLDLAGWDLT 103


>Z74696-1|CAI42428.1|  376|Homo sapiens actin-related protein T1
           (ACTRT1) protein.
          Length = 376

 Score =   99 bits (238), Expect = 1e-20
 Identities = 43/78 (55%), Positives = 55/78 (70%)
 Frame = +3

Query: 276 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 455
           L L YPIE G+VT WDDMEK+W H F  EL V P + PVL+TE  LNP+  REK+ ++MF
Sbjct: 68  LHLHYPIERGLVTGWDDMEKLWKHLFERELGVKPSQQPVLMTEPSLNPREIREKLAEMMF 127

Query: 456 ETFNTPAMYVAIQAVLSL 509
           ETF+ P  Y++  AV +L
Sbjct: 128 ETFSVPGFYLSNHAVAAL 145



 Score = 77.8 bits (183), Expect = 5e-14
 Identities = 38/89 (42%), Positives = 59/89 (66%)
 Frame = +2

Query: 476 HVRRHPSRALAYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMK 655
           ++  H   AL YAS   TG+V+DSGDGV+ TVPI+EGY+LPHA+ +L  +   +T++L +
Sbjct: 136 YLSNHAVAAL-YASACVTGLVVDSGDGVTCTVPIFEGYSLPHAVTKLCMAGRDITEHLTR 194

Query: 656 ILTERGYSFITNAXREIRS*TFKEKLCYV 742
           +L   G++F     + + +   KEKLCY+
Sbjct: 195 LLFASGFNFPCILNKAVVN-NIKEKLCYI 222



 Score = 48.0 bits (109), Expect = 4e-05
 Identities = 22/54 (40%), Positives = 34/54 (62%)
 Frame = +1

Query: 94  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 255
           +V A++ DNGSG+CKAG +G+  PR V  S++G  +    +  + QK  +VG E
Sbjct: 8   DVPAVIFDNGSGLCKAGLSGEIGPRHVISSVLGHCKFNVPLARLNQK-YFVGQE 60


>BC014597-1|AAH14597.1|  376|Homo sapiens actin-related protein T1
           protein.
          Length = 376

 Score =   99 bits (238), Expect = 1e-20
 Identities = 43/78 (55%), Positives = 55/78 (70%)
 Frame = +3

Query: 276 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 455
           L L YPIE G+VT WDDMEK+W H F  EL V P + PVL+TE  LNP+  REK+ ++MF
Sbjct: 68  LHLHYPIERGLVTGWDDMEKLWKHLFERELGVKPSQQPVLMTEPSLNPREIREKLAEMMF 127

Query: 456 ETFNTPAMYVAIQAVLSL 509
           ETF+ P  Y++  AV +L
Sbjct: 128 ETFSVPGFYLSNHAVAAL 145



 Score = 77.8 bits (183), Expect = 5e-14
 Identities = 38/89 (42%), Positives = 59/89 (66%)
 Frame = +2

Query: 476 HVRRHPSRALAYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMK 655
           ++  H   AL YAS   TG+V+DSGDGV+ TVPI+EGY+LPHA+ +L  +   +T++L +
Sbjct: 136 YLSNHAVAAL-YASACVTGLVVDSGDGVTCTVPIFEGYSLPHAVTKLCMAGRDITEHLTR 194

Query: 656 ILTERGYSFITNAXREIRS*TFKEKLCYV 742
           +L   G++F     + + +   KEKLCY+
Sbjct: 195 LLFASGFNFPCILNKAVVN-NIKEKLCYI 222



 Score = 48.0 bits (109), Expect = 4e-05
 Identities = 22/54 (40%), Positives = 34/54 (62%)
 Frame = +1

Query: 94  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 255
           +V A++ DNGSG+CKAG +G+  PR V  S++G  +    +  + QK  +VG E
Sbjct: 8   DVPAVIFDNGSGLCKAGLSGEIGPRHVISSVLGHCKFNVPLARLNQK-YFVGQE 60


>AF440739-1|AAM00432.1|  376|Homo sapiens actin-related protein T1
           protein.
          Length = 376

 Score =   99 bits (238), Expect = 1e-20
 Identities = 43/78 (55%), Positives = 55/78 (70%)
 Frame = +3

Query: 276 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 455
           L L YPIE G+VT WDDMEK+W H F  EL V P + PVL+TE  LNP+  REK+ ++MF
Sbjct: 68  LHLHYPIERGLVTGWDDMEKLWKHLFERELGVKPSQQPVLMTEPSLNPREIREKLAEMMF 127

Query: 456 ETFNTPAMYVAIQAVLSL 509
           ETF+ P  Y++  AV +L
Sbjct: 128 ETFSVPGFYLSNHAVAAL 145



 Score = 77.8 bits (183), Expect = 5e-14
 Identities = 38/89 (42%), Positives = 59/89 (66%)
 Frame = +2

Query: 476 HVRRHPSRALAYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMK 655
           ++  H   AL YAS   TG+V+DSGDGV+ TVPI+EGY+LPHA+ +L  +   +T++L +
Sbjct: 136 YLSNHAVAAL-YASACVTGLVVDSGDGVTCTVPIFEGYSLPHAVTKLCMAGRDITEHLTR 194

Query: 656 ILTERGYSFITNAXREIRS*TFKEKLCYV 742
           +L   G++F     + + +   KEKLCY+
Sbjct: 195 LLFASGFNFPCILNKAVVN-NIKEKLCYI 222



 Score = 48.0 bits (109), Expect = 4e-05
 Identities = 22/54 (40%), Positives = 34/54 (62%)
 Frame = +1

Query: 94  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 255
           +V A++ DNGSG+CKAG +G+  PR V  S++G  +    +  + QK  +VG E
Sbjct: 8   DVPAVIFDNGSGLCKAGLSGEIGPRHVISSVLGHCKFNVPLARLNQK-YFVGQE 60


>BC029499-1|AAH29499.1|  376|Homo sapiens actin-related protein T2
           protein.
          Length = 376

 Score = 97.9 bits (233), Expect = 4e-20
 Identities = 42/82 (51%), Positives = 56/82 (68%)
 Frame = +3

Query: 264 KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 443
           K+  L L  P E G++T WDD+E++W H F  EL V P + P+L TE  LNP+ NREKM 
Sbjct: 64  KQEALQLHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENREKMA 123

Query: 444 QIMFETFNTPAMYVAIQAVLSL 509
           ++MFE F  PA Y++ QAVL+L
Sbjct: 124 EVMFENFGVPAFYLSDQAVLAL 145



 Score = 73.7 bits (173), Expect = 8e-13
 Identities = 35/78 (44%), Positives = 52/78 (66%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YAS   TG+V+DSGD V+ TVPI+EGY+LPHA+ +L  +   +T+ LM++L   G++F  
Sbjct: 146 YASACVTGLVVDSGDAVTCTVPIFEGYSLPHAVTKLHVAGRDITELLMQLLLASGHTFPC 205

Query: 689 NAXREIRS*TFKEKLCYV 742
              + +     K+KLCYV
Sbjct: 206 QLDKGLVD-DIKKKLCYV 222



 Score = 46.8 bits (106), Expect = 1e-04
 Identities = 23/51 (45%), Positives = 31/51 (60%)
 Frame = +1

Query: 103 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 255
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK  +VG+E
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQK-YFVGEE 60


>AL356984-1|CAH72587.1|  377|Homo sapiens actin-related protein M2
           (ARPM2) protein.
          Length = 377

 Score = 97.9 bits (233), Expect = 4e-20
 Identities = 42/82 (51%), Positives = 56/82 (68%)
 Frame = +3

Query: 264 KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 443
           K+  L L  P E G++T WDD+E++W H F  EL V P + P+L TE  LNP+ NREKM 
Sbjct: 65  KQEALQLHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENREKMA 124

Query: 444 QIMFETFNTPAMYVAIQAVLSL 509
           ++MFE F  PA Y++ QAVL+L
Sbjct: 125 EVMFENFGVPAFYLSDQAVLAL 146



 Score = 73.7 bits (173), Expect = 8e-13
 Identities = 35/78 (44%), Positives = 52/78 (66%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YAS   TG+V+DSGD V+ TVPI+EGY+LPHA+ +L  +   +T+ LM++L   G++F  
Sbjct: 147 YASACVTGLVVDSGDAVTCTVPIFEGYSLPHAVTKLHVAGRDITELLMQLLLASGHTFPC 206

Query: 689 NAXREIRS*TFKEKLCYV 742
              + +     K+KLCYV
Sbjct: 207 QLDKGLVD-DIKKKLCYV 223



 Score = 50.8 bits (116), Expect = 6e-06
 Identities = 23/51 (45%), Positives = 31/51 (60%)
 Frame = +1

Query: 103 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 255
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK  +VG+E
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQKKYFVGEE 61


>AK058153-1|BAB71690.1|  328|Homo sapiens protein ( Homo sapiens
           cDNA FLJ25424 fis, clone TST04169. ).
          Length = 328

 Score = 97.9 bits (233), Expect = 4e-20
 Identities = 42/82 (51%), Positives = 56/82 (68%)
 Frame = +3

Query: 264 KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 443
           K+  L L  P E G++T WDD+E++W H F  EL V P + P+L TE  LNP+ NREKM 
Sbjct: 65  KQEALQLHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENREKMA 124

Query: 444 QIMFETFNTPAMYVAIQAVLSL 509
           ++MFE F  PA Y++ QAVL+L
Sbjct: 125 EVMFENFGVPAFYLSDQAVLAL 146



 Score = 73.7 bits (173), Expect = 8e-13
 Identities = 35/78 (44%), Positives = 52/78 (66%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YAS   TG+V+DSGD V+ TVPI+EGY+LPHA+ +L  +   +T+ LM++L   G++F  
Sbjct: 147 YASACVTGLVVDSGDAVTCTVPIFEGYSLPHAVTKLHVAGRDITELLMQLLLASGHTFPC 206

Query: 689 NAXREIRS*TFKEKLCYV 742
              + +     K+KLCYV
Sbjct: 207 QLDKGLVD-DIKKKLCYV 223



 Score = 50.8 bits (116), Expect = 6e-06
 Identities = 23/51 (45%), Positives = 31/51 (60%)
 Frame = +1

Query: 103 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 255
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK  +VG+E
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQKKYFVGEE 61


>AF440740-1|AAM00433.1|  377|Homo sapiens actin-related protein T2
           protein.
          Length = 377

 Score = 97.9 bits (233), Expect = 4e-20
 Identities = 42/82 (51%), Positives = 56/82 (68%)
 Frame = +3

Query: 264 KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 443
           K+  L L  P E G++T WDD+E++W H F  EL V P + P+L TE  LNP+ NREKM 
Sbjct: 65  KQEALQLHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENREKMA 124

Query: 444 QIMFETFNTPAMYVAIQAVLSL 509
           ++MFE F  PA Y++ QAVL+L
Sbjct: 125 EVMFENFGVPAFYLSDQAVLAL 146



 Score = 73.7 bits (173), Expect = 8e-13
 Identities = 35/78 (44%), Positives = 52/78 (66%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YAS   TG+V+DSGD V+ TVPI+EGY+LPHA+ +L  +   +T+ LM++L   G++F  
Sbjct: 147 YASACVTGLVVDSGDAVTCTVPIFEGYSLPHAVTKLHVAGRDITELLMQLLLASGHTFPC 206

Query: 689 NAXREIRS*TFKEKLCYV 742
              + +     K+KLCYV
Sbjct: 207 QLDKGLVD-DIKKKLCYV 223



 Score = 50.8 bits (116), Expect = 6e-06
 Identities = 23/51 (45%), Positives = 31/51 (60%)
 Frame = +1

Query: 103 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 255
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK  +VG+E
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQKKYFVGEE 61


>AB057364-1|BAB85862.1|  377|Homo sapiens actin-related protein
           hArpM2 protein.
          Length = 377

 Score = 97.9 bits (233), Expect = 4e-20
 Identities = 42/82 (51%), Positives = 56/82 (68%)
 Frame = +3

Query: 264 KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 443
           K+  L L  P E G++T WDD+E++W H F  EL V P + P+L TE  LNP+ NREKM 
Sbjct: 65  KQEALQLHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENREKMA 124

Query: 444 QIMFETFNTPAMYVAIQAVLSL 509
           ++MFE F  PA Y++ QAVL+L
Sbjct: 125 EVMFENFGVPAFYLSDQAVLAL 146



 Score = 73.7 bits (173), Expect = 8e-13
 Identities = 35/78 (44%), Positives = 52/78 (66%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YAS   TG+V+DSGD V+ TVPI+EGY+LPHA+ +L  +   +T+ LM++L   G++F  
Sbjct: 147 YASACVTGLVVDSGDAVTCTVPIFEGYSLPHAVTKLHVAGRDITELLMQLLLASGHTFPC 206

Query: 689 NAXREIRS*TFKEKLCYV 742
              + +     K+KLCYV
Sbjct: 207 QLDKGLVD-DIKKKLCYV 223



 Score = 50.8 bits (116), Expect = 6e-06
 Identities = 23/51 (45%), Positives = 31/51 (60%)
 Frame = +1

Query: 103 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 255
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK  +VG+E
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQKKYFVGEE 61


>BC014610-1|AAH14610.1|  435|Homo sapiens actin-like 7A protein.
          Length = 435

 Score = 97.1 bits (231), Expect = 7e-20
 Identities = 38/78 (48%), Positives = 58/78 (74%)
 Frame = +3

Query: 276 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 455
           L L  P+ HGI+ +WD ++ IW + F  E+++APEEH VL+++ PL+P  NREK  +++F
Sbjct: 129 LKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYAEMLF 188

Query: 456 ETFNTPAMYVAIQAVLSL 509
           E FNTPAM++A Q+ LS+
Sbjct: 189 EAFNTPAMHIAYQSRLSM 206



 Score = 71.7 bits (168), Expect = 3e-12
 Identities = 38/91 (41%), Positives = 54/91 (59%)
 Frame = +2

Query: 470 ARHVRRHPSRALAYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYL 649
           A H+  + SR   Y+ GRT+G+V++ G GVS+ VPIYEGY LP    RLD++ S LT YL
Sbjct: 195 AMHIA-YQSRLSMYSYGRTSGLVVEVGHGVSYVVPIYEGYPLPSITGRLDYAGSDLTAYL 253

Query: 650 MKILTERGYSFITNAXREIRS*TFKEKLCYV 742
           + +L   G  F  +    +     K+K C+V
Sbjct: 254 LGLLNSAGNEFTQDQMGIVED--IKKKCCFV 282



 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 22/55 (40%), Positives = 31/55 (56%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 255
           E   A+VVD G+G CK GFAG   P     + VG+P  +    G  +K+++VG E
Sbjct: 67  EVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQE 121


>AL359692-4|CAI40571.1|  435|Homo sapiens actin-like 7A protein.
          Length = 435

 Score = 97.1 bits (231), Expect = 7e-20
 Identities = 38/78 (48%), Positives = 58/78 (74%)
 Frame = +3

Query: 276 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 455
           L L  P+ HGI+ +WD ++ IW + F  E+++APEEH VL+++ PL+P  NREK  +++F
Sbjct: 129 LKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYAEMLF 188

Query: 456 ETFNTPAMYVAIQAVLSL 509
           E FNTPAM++A Q+ LS+
Sbjct: 189 EAFNTPAMHIAYQSRLSM 206



 Score = 71.7 bits (168), Expect = 3e-12
 Identities = 38/91 (41%), Positives = 54/91 (59%)
 Frame = +2

Query: 470 ARHVRRHPSRALAYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYL 649
           A H+  + SR   Y+ GRT+G+V++ G GVS+ VPIYEGY LP    RLD++ S LT YL
Sbjct: 195 AMHIA-YQSRLSMYSYGRTSGLVVEVGHGVSYVVPIYEGYPLPSITGRLDYAGSDLTAYL 253

Query: 650 MKILTERGYSFITNAXREIRS*TFKEKLCYV 742
           + +L   G  F  +    +     K+K C+V
Sbjct: 254 LGLLNSAGNEFTQDQMGIVED--IKKKCCFV 282



 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 22/55 (40%), Positives = 31/55 (56%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 255
           E   A+VVD G+G CK GFAG   P     + VG+P  +    G  +K+++VG E
Sbjct: 67  EVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQE 121


>AF113526-1|AAD44109.1|  435|Homo sapiens actin-like-7-alpha
           protein.
          Length = 435

 Score = 97.1 bits (231), Expect = 7e-20
 Identities = 38/78 (48%), Positives = 58/78 (74%)
 Frame = +3

Query: 276 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 455
           L L  P+ HGI+ +WD ++ IW + F  E+++APEEH VL+++ PL+P  NREK  +++F
Sbjct: 129 LKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYAEMLF 188

Query: 456 ETFNTPAMYVAIQAVLSL 509
           E FNTPAM++A Q+ LS+
Sbjct: 189 EAFNTPAMHIAYQSRLSM 206



 Score = 71.7 bits (168), Expect = 3e-12
 Identities = 38/91 (41%), Positives = 54/91 (59%)
 Frame = +2

Query: 470 ARHVRRHPSRALAYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYL 649
           A H+  + SR   Y+ GRT+G+V++ G GVS+ VPIYEGY LP    RLD++ S LT YL
Sbjct: 195 AMHIA-YQSRLSMYSYGRTSGLVVEVGHGVSYVVPIYEGYPLPSITGRLDYAGSDLTAYL 253

Query: 650 MKILTERGYSFITNAXREIRS*TFKEKLCYV 742
           + +L   G  F  +    +     K+K C+V
Sbjct: 254 LGLLNSAGNEFTQDQMGIVED--IKKKCCFV 282



 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 22/55 (40%), Positives = 31/55 (56%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 255
           E   A+VVD G+G CK GFAG   P     + VG+P  +    G  +K+++VG E
Sbjct: 67  EVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQE 121


>AB284520-1|BAF41971.1|  435|Homo sapiens human t-actin 2 protein.
          Length = 435

 Score = 97.1 bits (231), Expect = 7e-20
 Identities = 38/78 (48%), Positives = 58/78 (74%)
 Frame = +3

Query: 276 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 455
           L L  P+ HGI+ +WD ++ IW + F  E+++APEEH VL+++ PL+P  NREK  +++F
Sbjct: 129 LKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYAEMLF 188

Query: 456 ETFNTPAMYVAIQAVLSL 509
           E FNTPAM++A Q+ LS+
Sbjct: 189 EAFNTPAMHIAYQSRLSM 206



 Score = 71.7 bits (168), Expect = 3e-12
 Identities = 38/91 (41%), Positives = 54/91 (59%)
 Frame = +2

Query: 470 ARHVRRHPSRALAYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYL 649
           A H+  + SR   Y+ GRT+G+V++ G GVS+ VPIYEGY LP    RLD++ S LT YL
Sbjct: 195 AMHIA-YQSRLSMYSYGRTSGLVVEVGHGVSYVVPIYEGYPLPSITGRLDYAGSDLTAYL 253

Query: 650 MKILTERGYSFITNAXREIRS*TFKEKLCYV 742
           + +L   G  F  +    +     K+K C+V
Sbjct: 254 LGLLNSAGNEFTQDQMGIVED--IKKKCCFV 282



 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 22/55 (40%), Positives = 31/55 (56%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 255
           E   A+VVD G+G CK GFAG   P     + VG+P  +    G  +K+++VG E
Sbjct: 67  EVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQE 121


>AY970393-1|AAX82202.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 96.7 bits (230), Expect = 9e-20
 Identities = 45/58 (77%), Positives = 52/58 (89%), Gaps = 1/58 (1%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF-NTPAMYVAIQAVL 503
           KIWHHTFYN+L + PEEHP+LLT+APLNPKAN  KMTQI FETF NTPA+Y+AIQAV+
Sbjct: 1   KIWHHTFYNKLCMTPEEHPMLLTQAPLNPKAN-HKMTQITFETFSNTPAIYMAIQAVV 57



 Score = 68.9 bits (161), Expect = 2e-11
 Identities = 31/43 (72%), Positives = 36/43 (83%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRL 637
           YASG TTGIV+DSG+GV+HTVPIY+G ALPHA LRLD +   L
Sbjct: 61  YASGLTTGIVMDSGNGVTHTVPIYDGNALPHATLRLDLAGREL 103


>AK055346-1|BAB70906.1|  372|Homo sapiens protein ( Homo sapiens
           cDNA FLJ30784 fis, clone FEBRA2000881, moderately
           similar to ACTIN 6. ).
          Length = 372

 Score = 95.9 bits (228), Expect = 2e-19
 Identities = 46/107 (42%), Positives = 68/107 (63%)
 Frame = +3

Query: 189 GKAPPSGRDGRYGTEGLLCRR*AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR 368
           G+A    R  + G E L     AQ  R  L + YP+E G++T+W+DME +W H +   L+
Sbjct: 36  GRAKGQSRAAQGGLE-LCVGDQAQDWRSSLFISYPVERGLITSWEDMEIMWKHIYDYNLK 94

Query: 369 VAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           + P + PVL+TE  LNP ANR+++T++ FE    PA Y++IQAVL+L
Sbjct: 95  LKPCDGPVLITEPALNPLANRQQITEMFFEHLGVPAFYMSIQAVLAL 141



 Score = 75.4 bits (177), Expect = 3e-13
 Identities = 35/78 (44%), Positives = 52/78 (66%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           +A+G TTG+VL+SG GV+ +VPI+EGY LPH + +LD +   LT+YLM ++   G   ++
Sbjct: 142 FAAGFTTGLVLNSGAGVTQSVPIFEGYCLPHGVQQLDLAGLDLTNYLMVLMKNHGIMLLS 201

Query: 689 NAXREIRS*TFKEKLCYV 742
            + R+I     KE  CYV
Sbjct: 202 ASDRKIVE-DIKESFCYV 218



 Score = 46.8 bits (106), Expect = 1e-04
 Identities = 22/50 (44%), Positives = 32/50 (64%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 255
           +V+DNGSGM KAG AG   P+ ++P+I+GR + Q      G  +  VGD+
Sbjct: 8   VVIDNGSGMIKAGVAGCREPQFIYPNIIGRAKGQS-RAAQGGLELCVGDQ 56


>AB049117-1|BAB39481.1|  372|Homo sapiens actin related protein
           protein.
          Length = 372

 Score = 95.9 bits (228), Expect = 2e-19
 Identities = 46/107 (42%), Positives = 68/107 (63%)
 Frame = +3

Query: 189 GKAPPSGRDGRYGTEGLLCRR*AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR 368
           G+A    R  + G E L     AQ  R  L + YP+E G++T+W+DME +W H +   L+
Sbjct: 36  GRAKGQSRAAQGGLE-LCVGDQAQDWRSSLFISYPVERGLITSWEDMEIMWKHIYDYNLK 94

Query: 369 VAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           + P + PVL+TE  LNP ANR+++T++ FE    PA Y++IQAVL+L
Sbjct: 95  LKPCDGPVLITEPALNPLANRQQITEMFFEHLGVPAFYMSIQAVLAL 141



 Score = 75.4 bits (177), Expect = 3e-13
 Identities = 35/78 (44%), Positives = 52/78 (66%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           +A+G TTG+VL+SG GV+ +VPI+EGY LPH + +LD +   LT+YLM ++   G   ++
Sbjct: 142 FAAGFTTGLVLNSGAGVTQSVPIFEGYCLPHGVQQLDLAGLDLTNYLMVLMKNHGIMLLS 201

Query: 689 NAXREIRS*TFKEKLCYV 742
            + R+I     KE  CYV
Sbjct: 202 ASDRKIVE-DIKESFCYV 218



 Score = 46.8 bits (106), Expect = 1e-04
 Identities = 22/50 (44%), Positives = 32/50 (64%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 255
           +V+DNGSGM KAG AG   P+ ++P+I+GR + Q      G  +  VGD+
Sbjct: 8   VVIDNGSGMIKAGVAGCREPQFIYPNIIGRAKGQS-RAAQGGLELCVGDQ 56


>BC036253-1|AAH36253.1|  339|Homo sapiens ACTR2 protein protein.
          Length = 339

 Score = 94.3 bits (224), Expect = 5e-19
 Identities = 43/86 (50%), Positives = 59/86 (68%), Gaps = 1/86 (1%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANR 431
           A   R +L + YP+E+GIV NWDDM+ +W +TF  E L +      +LLTE P+NP  NR
Sbjct: 6   ASELRSMLEVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNR 65

Query: 432 EKMTQIMFETFNTPAMYVAIQAVLSL 509
           EK+ ++MFET+    +YVAIQAVL+L
Sbjct: 66  EKIVEVMFETYQFSGVYVAIQAVLTL 91



 Score = 87.8 bits (208), Expect = 4e-17
 Identities = 43/80 (53%), Positives = 56/80 (70%), Gaps = 1/80 (1%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YA G  TG+V+DSGDGV+H  P+YEG++LPH   RLD +   +T YL+K+L  RGY+F  
Sbjct: 92  YAQGLLTGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNH 151

Query: 689 NAXRE-IRS*TFKEKLCYVG 745
           +A  E +R    KEKLCYVG
Sbjct: 152 SADFETVR--MIKEKLCYVG 169


>AF006082-1|AAB64187.1|  394|Homo sapiens Arp2 protein.
          Length = 394

 Score = 94.3 bits (224), Expect = 5e-19
 Identities = 43/86 (50%), Positives = 59/86 (68%), Gaps = 1/86 (1%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANR 431
           A   R +L + YP+E+GIV NWDDM+ +W +TF  E L +      +LLTE P+NP  NR
Sbjct: 61  ASELRSMLEVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNR 120

Query: 432 EKMTQIMFETFNTPAMYVAIQAVLSL 509
           EK+ ++MFET+    +YVAIQAVL+L
Sbjct: 121 EKIVEVMFETYQFSGVYVAIQAVLTL 146



 Score = 87.8 bits (208), Expect = 4e-17
 Identities = 43/80 (53%), Positives = 56/80 (70%), Gaps = 1/80 (1%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YA G  TG+V+DSGDGV+H  P+YEG++LPH   RLD +   +T YL+K+L  RGY+F  
Sbjct: 147 YAQGLLTGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNH 206

Query: 689 NAXRE-IRS*TFKEKLCYVG 745
           +A  E +R    KEKLCYVG
Sbjct: 207 SADFETVR--MIKEKLCYVG 224



 Score = 46.8 bits (106), Expect = 1e-04
 Identities = 23/52 (44%), Positives = 32/52 (61%), Gaps = 2/52 (3%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDE 255
           +V DNG+G  K G+AG + P  +FP++VGRP  R    +  +  KD  VGDE
Sbjct: 9   VVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDE 60


>BC014546-1|AAH14546.1|  394|Homo sapiens ARP2 actin-related protein
           2 homolog (yeast) protein.
          Length = 394

 Score = 93.5 bits (222), Expect = 9e-19
 Identities = 43/86 (50%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANR 431
           A   R  L + YP+E+GIV NWDDM+ +W +TF  E L +      +LLTE P+NP  NR
Sbjct: 61  ASELRSTLEVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNR 120

Query: 432 EKMTQIMFETFNTPAMYVAIQAVLSL 509
           EK+ ++MFET+    +YVAIQAVL+L
Sbjct: 121 EKIVEVMFETYQFSGVYVAIQAVLTL 146



 Score = 85.4 bits (202), Expect = 2e-16
 Identities = 42/80 (52%), Positives = 55/80 (68%), Gaps = 1/80 (1%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YA G  TG+V+DSGDGV+H  P+YE ++LPH   RLD +   +T YL+K+L  RGY+F  
Sbjct: 147 YAQGLLTGVVVDSGDGVTHICPVYESFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNH 206

Query: 689 NAXRE-IRS*TFKEKLCYVG 745
           +A  E +R    KEKLCYVG
Sbjct: 207 SADFETVR--MIKEKLCYVG 224



 Score = 46.8 bits (106), Expect = 1e-04
 Identities = 23/52 (44%), Positives = 32/52 (61%), Gaps = 2/52 (3%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDE 255
           +V DNG+G  K G+AG + P  +FP++VGRP  R    +  +  KD  VGDE
Sbjct: 9   VVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDE 60


>BC033789-1|AAH33789.1|  415|Homo sapiens actin-like 7B protein.
          Length = 415

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 37/78 (47%), Positives = 57/78 (73%)
 Frame = +3

Query: 276 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 455
           L L  P++HGIV +WD ++ IW + F   +++ PEEH VL+++ PL+P +NREK  ++MF
Sbjct: 109 LKLVNPLKHGIVVDWDCVQDIWEYIFRTAMKILPEEHAVLVSDPPLSPSSNREKYAELMF 168

Query: 456 ETFNTPAMYVAIQAVLSL 509
           ETF  PAM+V  Q++LS+
Sbjct: 169 ETFGIPAMHVTSQSLLSI 186



 Score = 69.7 bits (163), Expect = 1e-11
 Identities = 34/77 (44%), Positives = 49/77 (63%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           Y+ G+T+G+V++SG GVSH VPI EG  LP    R D++   LT+YLM++L E G++F  
Sbjct: 187 YSYGKTSGLVVESGHGVSHVVPISEGDVLPGLTSRADYAGGDLTNYLMQLLNEAGHAFTD 246

Query: 689 NAXREIRS*TFKEKLCY 739
           +    I     K+K CY
Sbjct: 247 DHLHIIEH--IKKKCCY 261



 Score = 37.5 bits (83), Expect = 0.061
 Identities = 18/54 (33%), Positives = 29/54 (53%)
 Frame = +1

Query: 94  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 255
           ++ A+++D GS  CK G+AG+  P     S VG+   +    G  +K + VG E
Sbjct: 48  KIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTLVGHE 101


>AL359692-3|CAI40570.1|  415|Homo sapiens actin-like 7B protein.
          Length = 415

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 37/78 (47%), Positives = 57/78 (73%)
 Frame = +3

Query: 276 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 455
           L L  P++HGIV +WD ++ IW + F   +++ PEEH VL+++ PL+P +NREK  ++MF
Sbjct: 109 LKLVNPLKHGIVVDWDCVQDIWEYIFRTAMKILPEEHAVLVSDPPLSPSSNREKYAELMF 168

Query: 456 ETFNTPAMYVAIQAVLSL 509
           ETF  PAM+V  Q++LS+
Sbjct: 169 ETFGIPAMHVTSQSLLSI 186



 Score = 69.7 bits (163), Expect = 1e-11
 Identities = 34/77 (44%), Positives = 49/77 (63%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           Y+ G+T+G+V++SG GVSH VPI EG  LP    R D++   LT+YLM++L E G++F  
Sbjct: 187 YSYGKTSGLVVESGHGVSHVVPISEGDVLPGLTSRADYAGGDLTNYLMQLLNEAGHAFTD 246

Query: 689 NAXREIRS*TFKEKLCY 739
           +    I     K+K CY
Sbjct: 247 DHLHIIEH--IKKKCCY 261



 Score = 37.5 bits (83), Expect = 0.061
 Identities = 18/54 (33%), Positives = 29/54 (53%)
 Frame = +1

Query: 94  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 255
           ++ A+++D GS  CK G+AG+  P     S VG+   +    G  +K + VG E
Sbjct: 48  KIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTLVGHE 101


>AF113527-1|AAD44110.1|  415|Homo sapiens actin-like-7-beta protein.
          Length = 415

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 37/78 (47%), Positives = 57/78 (73%)
 Frame = +3

Query: 276 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 455
           L L  P++HGIV +WD ++ IW + F   +++ PEEH VL+++ PL+P +NREK  ++MF
Sbjct: 109 LKLVNPLKHGIVVDWDCVQDIWEYIFRTAMKILPEEHAVLVSDPPLSPSSNREKYAELMF 168

Query: 456 ETFNTPAMYVAIQAVLSL 509
           ETF  PAM+V  Q++LS+
Sbjct: 169 ETFGIPAMHVTSQSLLSI 186



 Score = 69.7 bits (163), Expect = 1e-11
 Identities = 34/77 (44%), Positives = 49/77 (63%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           Y+ G+T+G+V++SG GVSH VPI EG  LP    R D++   LT+YLM++L E G++F  
Sbjct: 187 YSYGKTSGLVVESGHGVSHVVPISEGDVLPGLTSRADYAGGDLTNYLMQLLNEAGHAFTD 246

Query: 689 NAXREIRS*TFKEKLCY 739
           +    I     K+K CY
Sbjct: 247 DHLHIIEH--IKKKCCY 261



 Score = 37.5 bits (83), Expect = 0.061
 Identities = 18/54 (33%), Positives = 29/54 (53%)
 Frame = +1

Query: 94  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 255
           ++ A+++D GS  CK G+AG+  P     S VG+   +    G  +K + VG E
Sbjct: 48  KIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTLVGHE 101


>AB284521-1|BAF41972.1|  415|Homo sapiens t-actin 1 protein.
          Length = 415

 Score = 92.3 bits (219), Expect = 2e-18
 Identities = 37/78 (47%), Positives = 57/78 (73%)
 Frame = +3

Query: 276 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 455
           L L  P++HGIV +WD ++ IW + F   +++ PEEH VL+++ PL+P +NREK  ++MF
Sbjct: 109 LKLVNPLKHGIVVDWDCVQDIWEYIFRTAMKILPEEHAVLVSDPPLSPSSNREKYAELMF 168

Query: 456 ETFNTPAMYVAIQAVLSL 509
           ETF  PAM+V  Q++LS+
Sbjct: 169 ETFGIPAMHVTSQSLLSI 186



 Score = 69.7 bits (163), Expect = 1e-11
 Identities = 34/77 (44%), Positives = 49/77 (63%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           Y+ G+T+G+V++SG GVSH VPI EG  LP    R D++   LT+YLM++L E G++F  
Sbjct: 187 YSYGKTSGLVVESGHGVSHVVPISEGDVLPGLTSRADYAGGDLTNYLMQLLNEAGHAFTD 246

Query: 689 NAXREIRS*TFKEKLCY 739
           +    I     K+K CY
Sbjct: 247 DHLHIIEH--IKKKCCY 261



 Score = 37.5 bits (83), Expect = 0.061
 Identities = 18/54 (33%), Positives = 29/54 (53%)
 Frame = +1

Query: 94  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 255
           ++ A+++D GS  CK G+AG+  P     S VG+   +    G  +K + VG E
Sbjct: 48  KIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTLVGHE 101


>BC044590-1|AAH44590.1|  418|Homo sapiens ARP3 actin-related protein
           3 homolog (yeast) protein.
          Length = 418

 Score = 91.9 bits (218), Expect = 3e-18
 Identities = 40/75 (53%), Positives = 51/75 (68%)
 Frame = +3

Query: 285 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 464
           K+PI HGIV +WD ME+      +  LR  PE+H  LLTE PLN   NRE   +IMFE+F
Sbjct: 75  KWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESF 134

Query: 465 NTPAMYVAIQAVLSL 509
           N P +Y+A+QAVL+L
Sbjct: 135 NVPGLYIAVQAVLAL 149



 Score = 47.6 bits (108), Expect = 6e-05
 Identities = 25/79 (31%), Positives = 40/79 (50%)
 Frame = +2

Query: 527 TGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFITNAXREI 706
           TG V+DSGDGV+H +P+ EGY +   I  +  +   +T ++ ++L +R          E 
Sbjct: 164 TGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLET 223

Query: 707 RS*TFKEKLCYVGS*LSKQ 763
                KE+  YV   L K+
Sbjct: 224 AK-AVKERYSYVCPDLVKE 241



 Score = 37.9 bits (84), Expect = 0.046
 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 8/59 (13%)
 Frame = +1

Query: 103 ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDE 255
           A VVD G+G  K G+AG+  P+ + PS         VG    + VM G+   D ++GDE
Sbjct: 7   ACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDE 65


>AF127773-1|AAD51904.1|  418|Homo sapiens unknown protein.
          Length = 418

 Score = 91.9 bits (218), Expect = 3e-18
 Identities = 40/75 (53%), Positives = 51/75 (68%)
 Frame = +3

Query: 285 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 464
           K+PI HGIV +WD ME+      +  LR  PE+H  LLTE PLN   NRE   +IMFE+F
Sbjct: 75  KWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESF 134

Query: 465 NTPAMYVAIQAVLSL 509
           N P +Y+A+QAVL+L
Sbjct: 135 NVPGLYIAVQAVLAL 149



 Score = 47.6 bits (108), Expect = 6e-05
 Identities = 25/79 (31%), Positives = 40/79 (50%)
 Frame = +2

Query: 527 TGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFITNAXREI 706
           TG V+DSGDGV+H +P+ EGY +   I  +  +   +T ++ ++L +R          E 
Sbjct: 164 TGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLET 223

Query: 707 RS*TFKEKLCYVGS*LSKQ 763
                KE+  YV   L K+
Sbjct: 224 AK-AVKERYSYVCPDLVKE 241



 Score = 37.9 bits (84), Expect = 0.046
 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 8/59 (13%)
 Frame = +1

Query: 103 ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDE 255
           A VVD G+G  K G+AG+  P+ + PS         VG    + VM G+   D ++GDE
Sbjct: 7   ACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDE 65


>AF006083-1|AAB64188.1|  418|Homo sapiens Arp3 protein.
          Length = 418

 Score = 91.9 bits (218), Expect = 3e-18
 Identities = 40/75 (53%), Positives = 51/75 (68%)
 Frame = +3

Query: 285 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 464
           K+PI HGIV +WD ME+      +  LR  PE+H  LLTE PLN   NRE   +IMFE+F
Sbjct: 75  KWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESF 134

Query: 465 NTPAMYVAIQAVLSL 509
           N P +Y+A+QAVL+L
Sbjct: 135 NVPGLYIAVQAVLAL 149



 Score = 47.6 bits (108), Expect = 6e-05
 Identities = 25/79 (31%), Positives = 40/79 (50%)
 Frame = +2

Query: 527 TGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFITNAXREI 706
           TG V+DSGDGV+H +P+ EGY +   I  +  +   +T ++ ++L +R          E 
Sbjct: 164 TGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLET 223

Query: 707 RS*TFKEKLCYVGS*LSKQ 763
                KE+  YV   L K+
Sbjct: 224 AK-AVKERYSYVCPDLVKE 241



 Score = 37.9 bits (84), Expect = 0.046
 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 8/59 (13%)
 Frame = +1

Query: 103 ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDE 255
           A VVD G+G  K G+AG+  P+ + PS         VG    + VM G+   D ++GDE
Sbjct: 7   ACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDE 65


>AC110769-1|AAX93226.1|  418|Homo sapiens unknown protein.
          Length = 418

 Score = 91.9 bits (218), Expect = 3e-18
 Identities = 40/75 (53%), Positives = 51/75 (68%)
 Frame = +3

Query: 285 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 464
           K+PI HGIV +WD ME+      +  LR  PE+H  LLTE PLN   NRE   +IMFE+F
Sbjct: 75  KWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESF 134

Query: 465 NTPAMYVAIQAVLSL 509
           N P +Y+A+QAVL+L
Sbjct: 135 NVPGLYIAVQAVLAL 149



 Score = 47.6 bits (108), Expect = 6e-05
 Identities = 25/79 (31%), Positives = 40/79 (50%)
 Frame = +2

Query: 527 TGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFITNAXREI 706
           TG V+DSGDGV+H +P+ EGY +   I  +  +   +T ++ ++L +R          E 
Sbjct: 164 TGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLET 223

Query: 707 RS*TFKEKLCYVGS*LSKQ 763
                KE+  YV   L K+
Sbjct: 224 AK-AVKERYSYVCPDLVKE 241



 Score = 37.9 bits (84), Expect = 0.046
 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 8/59 (13%)
 Frame = +1

Query: 103 ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDE 255
           A VVD G+G  K G+AG+  P+ + PS         VG    + VM G+   D ++GDE
Sbjct: 7   ACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDE 65


>AB209353-1|BAD92590.1|  369|Homo sapiens ARP3 actin-related protein
           3 homolog variant protein.
          Length = 369

 Score = 91.9 bits (218), Expect = 3e-18
 Identities = 40/75 (53%), Positives = 51/75 (68%)
 Frame = +3

Query: 285 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 464
           K+PI HGIV +WD ME+      +  LR  PE+H  LLTE PLN   NRE   +IMFE+F
Sbjct: 26  KWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESF 85

Query: 465 NTPAMYVAIQAVLSL 509
           N P +Y+A+QAVL+L
Sbjct: 86  NVPGLYIAVQAVLAL 100



 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 24/79 (30%), Positives = 40/79 (50%)
 Frame = +2

Query: 527 TGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFITNAXREI 706
           TG V++SGDGV+H +P+ EGY +   I  +  +   +T ++ ++L +R          E 
Sbjct: 115 TGTVINSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLET 174

Query: 707 RS*TFKEKLCYVGS*LSKQ 763
                KE+  YV   L K+
Sbjct: 175 AK-AVKERYSYVCPDLVKE 192


>BC015207-1|AAH15207.1|  348|Homo sapiens ARP3 actin-related protein
           3 homolog B (yeast) protein.
          Length = 348

 Score = 91.5 bits (217), Expect = 4e-18
 Identities = 38/75 (50%), Positives = 52/75 (69%)
 Frame = +3

Query: 285 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 464
           K+PI HGI+ +WD ME+      +  LR  PE+H  L+TE PLN   NRE + +IMFE+F
Sbjct: 75  KWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTPENREYLAEIMFESF 134

Query: 465 NTPAMYVAIQAVLSL 509
           N P +Y+A+QAVL+L
Sbjct: 135 NVPGLYIAVQAVLAL 149



 Score = 55.6 bits (128), Expect = 2e-07
 Identities = 26/72 (36%), Positives = 39/72 (54%)
 Frame = +2

Query: 527 TGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFITNAXREI 706
           TGIV+DSGDGV+H +P+ EGY +   I  +  +   +T ++ ++L ER          E 
Sbjct: 164 TGIVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLREREVGIPPEQSLET 223

Query: 707 RS*TFKEKLCYV 742
                KEK CY+
Sbjct: 224 AK-AIKEKYCYI 234



 Score = 32.3 bits (70), Expect = 2.3
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 8/57 (14%)
 Frame = +1

Query: 109 VVDNGSGMCKAGFAGDDAPRAVFPSIVG--------RPRHQGVMVGMGQKDSYVGDE 255
           VVD G+G  K G+AG+  P+ + PS +             + V+ G+   D ++GDE
Sbjct: 9   VVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRRVLRGVDDLDFFIGDE 65


>BC008682-1|AAH08682.1|  418|Homo sapiens ARP3 actin-related protein
           3 homolog B (yeast) protein.
          Length = 418

 Score = 91.5 bits (217), Expect = 4e-18
 Identities = 38/75 (50%), Positives = 52/75 (69%)
 Frame = +3

Query: 285 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 464
           K+PI HGI+ +WD ME+      +  LR  PE+H  L+TE PLN   NRE + +IMFE+F
Sbjct: 75  KWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTPENREYLAEIMFESF 134

Query: 465 NTPAMYVAIQAVLSL 509
           N P +Y+A+QAVL+L
Sbjct: 135 NVPGLYIAVQAVLAL 149



 Score = 55.6 bits (128), Expect = 2e-07
 Identities = 26/72 (36%), Positives = 39/72 (54%)
 Frame = +2

Query: 527 TGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFITNAXREI 706
           TGIV+DSGDGV+H +P+ EGY +   I  +  +   +T ++ ++L ER          E 
Sbjct: 164 TGIVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLREREVGIPPEQSLET 223

Query: 707 RS*TFKEKLCYV 742
                KEK CY+
Sbjct: 224 AK-AIKEKYCYI 234



 Score = 32.3 bits (70), Expect = 2.3
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 8/57 (14%)
 Frame = +1

Query: 109 VVDNGSGMCKAGFAGDDAPRAVFPSIVG--------RPRHQGVMVGMGQKDSYVGDE 255
           VVD G+G  K G+AG+  P+ + PS +             + V+ G+   D ++GDE
Sbjct: 9   VVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRRVLRGVDDLDFFIGDE 65


>AF086920-1|AAP97150.1|  402|Homo sapiens actin related protein ARP4
           protein.
          Length = 402

 Score = 91.5 bits (217), Expect = 4e-18
 Identities = 38/75 (50%), Positives = 52/75 (69%)
 Frame = +3

Query: 285 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 464
           K+PI HGI+ +WD ME+      +  LR  PE+H  L+TE PLN   NRE + +IMFE+F
Sbjct: 56  KWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTPENREYLAEIMFESF 115

Query: 465 NTPAMYVAIQAVLSL 509
           N P +Y+A+QAVL+L
Sbjct: 116 NVPGLYIAVQAVLAL 130



 Score = 51.6 bits (118), Expect = 4e-06
 Identities = 26/73 (35%), Positives = 39/73 (53%), Gaps = 1/73 (1%)
 Frame = +2

Query: 527 TGIVLDSGDGVSHTVPI-YEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFITNAXRE 703
           TGIV+DSGDGV+H +P+  EGY +   I  +  +   +T ++ ++L ER          E
Sbjct: 145 TGIVIDSGDGVTHVIPVGQEGYVIGSCIKHIPIAGRDITYFIQQLLREREVGIPPEQSLE 204

Query: 704 IRS*TFKEKLCYV 742
                 KEK CY+
Sbjct: 205 TAK-AIKEKYCYI 216


>AF023453-1|AAC98904.1|  418|Homo sapiens actin-related protein
           3-beta protein.
          Length = 418

 Score = 91.5 bits (217), Expect = 4e-18
 Identities = 38/75 (50%), Positives = 52/75 (69%)
 Frame = +3

Query: 285 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 464
           K+PI HGI+ +WD ME+      +  LR  PE+H  L+TE PLN   NRE + +IMFE+F
Sbjct: 75  KWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTPENREYLAEIMFESF 134

Query: 465 NTPAMYVAIQAVLSL 509
           N P +Y+A+QAVL+L
Sbjct: 135 NVPGLYIAVQAVLAL 149



 Score = 55.6 bits (128), Expect = 2e-07
 Identities = 26/72 (36%), Positives = 39/72 (54%)
 Frame = +2

Query: 527 TGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFITNAXREI 706
           TGIV+DSGDGV+H +P+ EGY +   I  +  +   +T ++ ++L ER          E 
Sbjct: 164 TGIVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLREREVGIPPEQSLET 223

Query: 707 RS*TFKEKLCYV 742
                KEK CY+
Sbjct: 224 AK-AIKEKYCYI 234



 Score = 32.3 bits (70), Expect = 2.3
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 8/57 (14%)
 Frame = +1

Query: 109 VVDNGSGMCKAGFAGDDAPRAVFPSIVG--------RPRHQGVMVGMGQKDSYVGDE 255
           VVD G+G  K G+AG+  P+ + PS +             + V+ G+   D ++GDE
Sbjct: 9   VVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRRVLRGVDDLDFFIGDE 65


>BC045752-1|AAH45752.1|  416|Homo sapiens hypothetical protein
           MGC33407 protein.
          Length = 416

 Score = 90.6 bits (215), Expect = 6e-18
 Identities = 38/78 (48%), Positives = 54/78 (69%)
 Frame = +3

Query: 276 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 455
           LTL  P+  GIV +WD  E IW H   ++LRVA  +HP+L ++ P +P  NREK+ ++ F
Sbjct: 108 LTLVQPLRSGIVVDWDAAELIWRHLLEHDLRVATHDHPLLFSDPPFSPATNREKLVEVAF 167

Query: 456 ETFNTPAMYVAIQAVLSL 509
           E+  +PAMYVA Q+VLS+
Sbjct: 168 ESLRSPAMYVASQSVLSV 185



 Score = 64.5 bits (150), Expect = 5e-10
 Identities = 32/85 (37%), Positives = 50/85 (58%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YA GR +G+V+D+G GV++TVP+++GY L HA  RLD + + LT +L ++L + G     
Sbjct: 186 YAHGRVSGLVVDTGHGVTYTVPVFQGYNLLHATERLDLAGNNLTAFLAEMLLQAGLPLGQ 245

Query: 689 NAXREIRS*TFKEKLCYVGS*LSKQ 763
                + +   K   CYV S   K+
Sbjct: 246 QDLDLVEN--IKHHYCYVASDFQKE 268



 Score = 38.7 bits (86), Expect = 0.027
 Identities = 17/56 (30%), Positives = 29/56 (51%)
 Frame = +1

Query: 94  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           +  A+V+D G+G CK GFAG  +P     +I+G    +    G     +++G+  R
Sbjct: 48  KTGAVVIDMGTGTCKVGFAGQASPTYTVATILGCQPKKPATSGQSGLQTFIGEAAR 103


>BC024028-1|AAH24028.1|  416|Homo sapiens hypothetical protein
           MGC33407 protein.
          Length = 416

 Score = 90.6 bits (215), Expect = 6e-18
 Identities = 38/78 (48%), Positives = 54/78 (69%)
 Frame = +3

Query: 276 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 455
           LTL  P+  GIV +WD  E IW H   ++LRVA  +HP+L ++ P +P  NREK+ ++ F
Sbjct: 108 LTLVQPLRSGIVVDWDAAELIWRHLLEHDLRVATHDHPLLFSDPPFSPATNREKLVEVAF 167

Query: 456 ETFNTPAMYVAIQAVLSL 509
           E+  +PAMYVA Q+VLS+
Sbjct: 168 ESLRSPAMYVASQSVLSV 185



 Score = 64.5 bits (150), Expect = 5e-10
 Identities = 32/85 (37%), Positives = 50/85 (58%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YA GR +G+V+D+G GV++TVP+++GY L HA  RLD + + LT +L ++L + G     
Sbjct: 186 YAHGRVSGLVVDTGHGVTYTVPVFQGYNLLHATERLDLAGNNLTAFLAEMLLQAGLPLGQ 245

Query: 689 NAXREIRS*TFKEKLCYVGS*LSKQ 763
                + +   K   CYV S   K+
Sbjct: 246 QDLDLVEN--IKHHYCYVASDFQKE 268



 Score = 38.7 bits (86), Expect = 0.027
 Identities = 17/56 (30%), Positives = 29/56 (51%)
 Frame = +1

Query: 94  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           +  A+V+D G+G CK GFAG  +P     +I+G    +    G     +++G+  R
Sbjct: 48  KTGAVVIDMGTGTCKVGFAGQASPTYTVATILGCQPKKPATSGQSGLQTFIGEAAR 103


>BC007289-1|AAH07289.1|  372|Homo sapiens actin related protein M1
           protein.
          Length = 372

 Score = 90.6 bits (215), Expect = 6e-18
 Identities = 45/107 (42%), Positives = 67/107 (62%)
 Frame = +3

Query: 189 GKAPPSGRDGRYGTEGLLCRR*AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR 368
           G+A    R  + G E L     AQ  R  L + YP+E G++T+ +DME +W H +   L+
Sbjct: 36  GRAKGQSRAAQGGLE-LCVGDQAQDWRSSLFISYPVERGLITSCEDMEIMWKHIYDYNLK 94

Query: 369 VAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           + P + PVL+TE  LNP ANR+++T++ FE    PA Y++IQAVL+L
Sbjct: 95  LKPCDGPVLITEPALNPLANRQQITEMFFEHLGVPAFYMSIQAVLAL 141



 Score = 75.4 bits (177), Expect = 3e-13
 Identities = 35/78 (44%), Positives = 52/78 (66%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           +A+G TTG+VL+SG GV+ +VPI+EGY LPH + +LD +   LT+YLM ++   G   ++
Sbjct: 142 FAAGFTTGLVLNSGAGVTQSVPIFEGYCLPHGVQQLDLAGLDLTNYLMVLMKNHGIMLLS 201

Query: 689 NAXREIRS*TFKEKLCYV 742
            + R+I     KE  CYV
Sbjct: 202 ASDRKIVE-DIKESFCYV 218



 Score = 46.8 bits (106), Expect = 1e-04
 Identities = 22/50 (44%), Positives = 32/50 (64%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 255
           +V+DNGSGM KAG AG   P+ ++P+I+GR + Q      G  +  VGD+
Sbjct: 8   VVIDNGSGMIKAGVAGCREPQFIYPNIIGRAKGQS-RAAQGGLELCVGDQ 56


>AY970399-1|AAX82208.1|   97|Homo sapiens actin-like protein
           protein.
          Length = 97

 Score = 85.0 bits (201), Expect = 3e-16
 Identities = 42/61 (68%), Positives = 48/61 (78%)
 Frame = +3

Query: 333 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLT 512
           KIW    YNEL VAPEEHPV LTEAP+N KAN +KMTQIMFETFNTPA+YVA  ++ +  
Sbjct: 1   KIW---LYNELGVAPEEHPVQLTEAPMNHKANCKKMTQIMFETFNTPAIYVAFVSLYASG 57

Query: 513 R 515
           R
Sbjct: 58  R 58



 Score = 69.7 bits (163), Expect = 1e-11
 Identities = 31/44 (70%), Positives = 38/44 (86%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLT 640
           YASGRTT I++DSGDGV+HTVP+Y+G+ALPHAIL LD +   LT
Sbjct: 54  YASGRTTSIMMDSGDGVTHTVPMYKGHALPHAILYLDLAGWDLT 97


>BC020944-1|AAH20944.1|  426|Homo sapiens actin-like 6B protein.
          Length = 426

 Score = 73.7 bits (173), Expect = 8e-13
 Identities = 29/72 (40%), Positives = 49/72 (68%)
 Frame = +3

Query: 291 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 470
           P+++G++ +W+    I  HT+   ++  P  HPVL++EAP N +A REK+T++MFE +N 
Sbjct: 84  PLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTRAKREKLTELMFEQYNI 143

Query: 471 PAMYVAIQAVLS 506
           PA ++   AVL+
Sbjct: 144 PAFFLCKTAVLT 155



 Score = 42.7 bits (96), Expect = 0.002
 Identities = 19/34 (55%), Positives = 25/34 (73%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 192
           +EV ALV D GS   +AG+AG+D P+A FP+ VG
Sbjct: 9   DEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVG 42



 Score = 41.5 bits (93), Expect = 0.004
 Identities = 16/36 (44%), Positives = 27/36 (75%)
 Frame = +2

Query: 506 AYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILR 613
           A+A+GR+TG+VLDSG   +  +P+++GY L   I++
Sbjct: 156 AFANGRSTGLVLDSGATHTTAIPVHDGYVLQQGIVK 191


>AF053356-5|AAC78795.1|  475|Homo sapiens actin like gene protein.
          Length = 475

 Score = 73.7 bits (173), Expect = 8e-13
 Identities = 29/72 (40%), Positives = 49/72 (68%)
 Frame = +3

Query: 291 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 470
           P+++G++ +W+    I  HT+   ++  P  HPVL++EAP N +A REK+T++MFE +N 
Sbjct: 84  PLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTRAKREKLTELMFEQYNI 143

Query: 471 PAMYVAIQAVLS 506
           PA ++   AVL+
Sbjct: 144 PAFFLCKTAVLT 155



 Score = 42.7 bits (96), Expect = 0.002
 Identities = 19/34 (55%), Positives = 25/34 (73%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 192
           +EV ALV D GS   +AG+AG+D P+A FP+ VG
Sbjct: 9   DEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVG 42



 Score = 41.5 bits (93), Expect = 0.004
 Identities = 16/36 (44%), Positives = 27/36 (75%)
 Frame = +2

Query: 506 AYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILR 613
           A+A+GR+TG+VLDSG   +  +P+++GY L   I++
Sbjct: 156 AFANGRSTGLVLDSGATHTTAIPVHDGYVLQQGIVK 191


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 133,734,734
Number of Sequences: 237096
Number of extensions: 3359998
Number of successful extensions: 16523
Number of sequences better than 10.0: 339
Number of HSP's better than 10.0 without gapping: 13810
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 16116
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 10872716010
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -