SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30134.Seq
         (882 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB058761-1|BAB47487.2| 2469|Homo sapiens KIAA1858 protein protein.     33   1.0  
BC053850-1|AAH53850.1|  403|Homo sapiens forkhead box Q1 protein.      33   1.8  
AL499606-1|CAH70503.1|  403|Homo sapiens forkhead box Q1 protein.      33   1.8  
AF225950-1|AAK00639.1|  403|Homo sapiens HNF-3/forkhead-like pro...    33   1.8  
AF153341-1|AAF75586.1|  402|Homo sapiens winged helix/forkhead t...    33   1.8  
AK095564-1|BAC04575.1|  175|Homo sapiens protein ( Homo sapiens ...    32   3.2  
BC108668-1|AAI08669.1|  477|Homo sapiens TSC1 protein protein.         31   4.2  
AL445645-4|CAH72112.1| 1164|Homo sapiens tuberous sclerosis 1 pr...    31   4.2  
AK090435-1|BAC03416.1| 1766|Homo sapiens FLJ00353 protein protein.     31   4.2  
AF013168-1|AAC51674.1| 1164|Homo sapiens hamartin protein.             31   4.2  
AC007956-2|AAF61275.1| 1822|Homo sapiens unknown protein.              31   4.2  
AF361486-1|AAK74120.3| 6995|Homo sapiens mucin 16 protein.             31   5.5  
BC047760-1|AAH47760.1|  364|Homo sapiens Y box binding protein 2...    31   7.3  
BC033800-1|AAH33800.1|  364|Homo sapiens Y box binding protein 2...    31   7.3  
AY358368-1|AAQ88734.1|  839|Homo sapiens MUCDHL protein.               31   7.3  
AK172828-1|BAD18793.1|  447|Homo sapiens protein ( Homo sapiens ...    31   7.3  
AK025498-1|BAB15154.1|  618|Homo sapiens protein ( Homo sapiens ...    31   7.3  
AK025012-1|BAB15052.1|  295|Homo sapiens protein ( Homo sapiens ...    31   7.3  
AF454937-1|AAP97696.1|  440|Homo sapiens DIBD1 B protein.              31   7.3  
AF414442-1|AAL65133.2|22152|Homo sapiens ovarian cancer related ...    31   7.3  
AF395532-1|AAL25798.1|  611|Homo sapiens DIBD1 protein.                31   7.3  
AF258674-2|AAG16731.1|  845|Homo sapiens MUCDHL-FL protein.            31   7.3  
AF096834-1|AAD30662.1|  364|Homo sapiens germ cell specific Y-bo...    31   7.3  
BC111720-1|AAI11721.1| 1522|Homo sapiens brain-specific angiogen...    30   9.7  
BC009255-1|AAH09255.1|  618|Homo sapiens asparagine-linked glyco...    30   9.7  
AL391807-1|CAI21673.1| 1522|Homo sapiens brain-specific angiogen...    30   9.7  
AL359714-1|CAH71522.1| 1522|Homo sapiens brain-specific angiogen...    30   9.7  
AL356117-1|CAH71772.1| 1522|Homo sapiens brain-specific angiogen...    30   9.7  
AL160401-1|CAH73864.1| 1522|Homo sapiens brain-specific angiogen...    30   9.7  
AL158051-1|CAI19625.1| 1522|Homo sapiens brain-specific angiogen...    30   9.7  
AL133378-1|CAC34969.2| 1522|Homo sapiens brain-specific angiogen...    30   9.7  
AF043900-1|AAC39712.1|  475|Homo sapiens amphiphysin IIc2 protein.     30   9.7  
AF043899-1|AAC39711.1|  506|Homo sapiens amphiphysin IIc1 protein.     30   9.7  
AB011122-1|BAA25476.2| 1524|Homo sapiens KIAA0550 protein protein.     30   9.7  
AB005299-1|BAA25363.1| 1522|Homo sapiens BAI 3 protein.                30   9.7  

>AB058761-1|BAB47487.2| 2469|Homo sapiens KIAA1858 protein protein.
          Length = 2469

 Score = 33.5 bits (73), Expect = 1.0
 Identities = 22/65 (33%), Positives = 30/65 (46%), Gaps = 1/65 (1%)
 Frame = -3

Query: 439  PNL*RRNTLLSRHETASSSHRVANVXPVPAASKAH-TGPAGGATHRPAHSGGGTPSRTLA 263
            P+  + + LL + +  SSSH V+   P  A  K   T PAG  +     S   TPS+ L 
Sbjct: 2151 PDHFQEDHLLQKEKEVSSSHMVSQGGPRGAFHKGSATKPAGCQSSSKDRSAASTPSKALK 2210

Query: 262  RTSHP 248
               HP
Sbjct: 2211 FPVHP 2215


>BC053850-1|AAH53850.1|  403|Homo sapiens forkhead box Q1 protein.
          Length = 403

 Score = 32.7 bits (71), Expect = 1.8
 Identities = 17/44 (38%), Positives = 19/44 (43%)
 Frame = -1

Query: 360 PFRLHQRRILVLPAGPRTALHTAAAAPPRGPSLGPVTRGSHIRC 229
           P RL  R   V P  P   L    AA P  P  GP   G+H+ C
Sbjct: 331 PARLGAREAEVPPTAPPLLLAPLPAAAPAKPLRGPAAGGAHLYC 374


>AL499606-1|CAH70503.1|  403|Homo sapiens forkhead box Q1 protein.
          Length = 403

 Score = 32.7 bits (71), Expect = 1.8
 Identities = 17/44 (38%), Positives = 19/44 (43%)
 Frame = -1

Query: 360 PFRLHQRRILVLPAGPRTALHTAAAAPPRGPSLGPVTRGSHIRC 229
           P RL  R   V P  P   L    AA P  P  GP   G+H+ C
Sbjct: 331 PARLGAREAEVPPTAPPLLLAPLPAAAPAKPLRGPAAGGAHLYC 374


>AF225950-1|AAK00639.1|  403|Homo sapiens HNF-3/forkhead-like
           protein 1 protein.
          Length = 403

 Score = 32.7 bits (71), Expect = 1.8
 Identities = 17/44 (38%), Positives = 19/44 (43%)
 Frame = -1

Query: 360 PFRLHQRRILVLPAGPRTALHTAAAAPPRGPSLGPVTRGSHIRC 229
           P RL  R   V P  P   L    AA P  P  GP   G+H+ C
Sbjct: 331 PARLGAREAEVPPTAPPLLLAPLPAAAPAKPLRGPAAGGAHLYC 374


>AF153341-1|AAF75586.1|  402|Homo sapiens winged helix/forkhead
           transcription factor protein.
          Length = 402

 Score = 32.7 bits (71), Expect = 1.8
 Identities = 17/44 (38%), Positives = 19/44 (43%)
 Frame = -1

Query: 360 PFRLHQRRILVLPAGPRTALHTAAAAPPRGPSLGPVTRGSHIRC 229
           P RL  R   V P  P   L    AA P  P  GP   G+H+ C
Sbjct: 330 PARLGAREAEVPPTAPPLLLAPLPAAAPAKPLRGPAAGGAHLYC 373


>AK095564-1|BAC04575.1|  175|Homo sapiens protein ( Homo sapiens
           cDNA FLJ38245 fis, clone FCBBF2007186. ).
          Length = 175

 Score = 31.9 bits (69), Expect = 3.2
 Identities = 12/25 (48%), Positives = 15/25 (60%)
 Frame = -2

Query: 377 SSECPSRSGCIKGAYWSCRRGHAPP 303
           S  CP R+G ++   WS R G APP
Sbjct: 27  SCPCPGRAGSLRTPTWSMRLGQAPP 51


>BC108668-1|AAI08669.1|  477|Homo sapiens TSC1 protein protein.
          Length = 477

 Score = 31.5 bits (68), Expect = 4.2
 Identities = 16/43 (37%), Positives = 23/43 (53%)
 Frame = -2

Query: 323 RRGHAPPCTQRRRHPLADPRSDQSPGALISGALTSLTLPNLVG 195
           R   A PC  R+ H L D  S++ PG+   G++T   LP  +G
Sbjct: 423 RMDSARPCLHRQHHLLNDRGSEEPPGS--KGSVTLSDLPGFLG 463


>AL445645-4|CAH72112.1| 1164|Homo sapiens tuberous sclerosis 1
           protein.
          Length = 1164

 Score = 31.5 bits (68), Expect = 4.2
 Identities = 16/43 (37%), Positives = 23/43 (53%)
 Frame = -2

Query: 323 RRGHAPPCTQRRRHPLADPRSDQSPGALISGALTSLTLPNLVG 195
           R   A PC  R+ H L D  S++ PG+   G++T   LP  +G
Sbjct: 424 RMDSARPCLHRQHHLLNDRGSEEPPGS--KGSVTLSDLPGFLG 464


>AK090435-1|BAC03416.1| 1766|Homo sapiens FLJ00353 protein protein.
          Length = 1766

 Score = 31.5 bits (68), Expect = 4.2
 Identities = 17/41 (41%), Positives = 20/41 (48%)
 Frame = +3

Query: 210 ERQRSQRTGYESPG*LVRARVREGVPPPLCAGRCVAPPAGP 332
           ER   +R G +  G L RA  RE +PP     R   PP GP
Sbjct: 736 ERGPPRRAGSQERGPLRRAGSRERIPPRRAGSRERGPPRGP 776


>AF013168-1|AAC51674.1| 1164|Homo sapiens hamartin protein.
          Length = 1164

 Score = 31.5 bits (68), Expect = 4.2
 Identities = 16/43 (37%), Positives = 23/43 (53%)
 Frame = -2

Query: 323 RRGHAPPCTQRRRHPLADPRSDQSPGALISGALTSLTLPNLVG 195
           R   A PC  R+ H L D  S++ PG+   G++T   LP  +G
Sbjct: 424 RMDSARPCLHRQHHLLNDRGSEEPPGS--KGSVTLSDLPGFLG 464


>AC007956-2|AAF61275.1| 1822|Homo sapiens unknown protein.
          Length = 1822

 Score = 31.5 bits (68), Expect = 4.2
 Identities = 17/41 (41%), Positives = 20/41 (48%)
 Frame = +3

Query: 210  ERQRSQRTGYESPG*LVRARVREGVPPPLCAGRCVAPPAGP 332
            ER   +R G +  G L RA  RE +PP     R   PP GP
Sbjct: 915  ERGPPRRAGSQERGPLRRAGSRERIPPRRAGSRERGPPRGP 955


>AF361486-1|AAK74120.3| 6995|Homo sapiens mucin 16 protein.
          Length = 6995

 Score = 31.1 bits (67), Expect = 5.5
 Identities = 16/38 (42%), Positives = 21/38 (55%)
 Frame = -2

Query: 236  SGALTSLTLPNLVGMNGRLAQSAFIHTVTKTIQAKTFP 123
            SGA TS T+P L    G    +A + T  +T  +KTFP
Sbjct: 3456 SGAATSTTVPTLTHSPGMPETTALLSTHPRTETSKTFP 3493


>BC047760-1|AAH47760.1|  364|Homo sapiens Y box binding protein 2
           protein.
          Length = 364

 Score = 30.7 bits (66), Expect = 7.3
 Identities = 18/46 (39%), Positives = 23/46 (50%)
 Frame = -3

Query: 394 ASSSHRVANVXPVPAASKAHTGPAGGATHRPAHSGGGTPSRTLART 257
           A+++  VA V PVPA      G AGG     +    GTPS   +RT
Sbjct: 20  ATAAGVVAVVVPVPAGEPQKGGGAGGGGGAASGPAAGTPSAPGSRT 65


>BC033800-1|AAH33800.1|  364|Homo sapiens Y box binding protein 2
           protein.
          Length = 364

 Score = 30.7 bits (66), Expect = 7.3
 Identities = 18/46 (39%), Positives = 23/46 (50%)
 Frame = -3

Query: 394 ASSSHRVANVXPVPAASKAHTGPAGGATHRPAHSGGGTPSRTLART 257
           A+++  VA V PVPA      G AGG     +    GTPS   +RT
Sbjct: 20  ATAAGVVAVVVPVPAGEPQKGGGAGGGGGAASGPAAGTPSAPGSRT 65


>AY358368-1|AAQ88734.1|  839|Homo sapiens MUCDHL protein.
          Length = 839

 Score = 30.7 bits (66), Expect = 7.3
 Identities = 20/53 (37%), Positives = 25/53 (47%), Gaps = 1/53 (1%)
 Frame = -3

Query: 403 HETASSSHRVANVXPVPAASKAHTGPAGGAT-HRPAHSGGGTPSRTLARTSHP 248
           H+ A+ S   A   P P  S+      G +T H+PA  GGGT     A TS P
Sbjct: 555 HQPATPSGGTAQT-PEPGTSQPMPPSMGTSTSHQPATPGGGTAQTPEAGTSQP 606


>AK172828-1|BAD18793.1|  447|Homo sapiens protein ( Homo sapiens
           cDNA FLJ23989 fis, clone HRC04156. ).
          Length = 447

 Score = 30.7 bits (66), Expect = 7.3
 Identities = 15/44 (34%), Positives = 24/44 (54%)
 Frame = +2

Query: 491 HFYGTYFVSPSNITIDHLH*LIGNVLNGKNLFVFYVILGINNFN 622
           ++YG   ++P NI + ++    G  L G   + FY+I G  NFN
Sbjct: 101 YYYGKLVIAPLNIVLYNIFTPHGPDLYGTEPWYFYLINGFLNFN 144


>AK025498-1|BAB15154.1|  618|Homo sapiens protein ( Homo sapiens
           cDNA: FLJ21845 fis, clone HEP01884. ).
          Length = 618

 Score = 30.7 bits (66), Expect = 7.3
 Identities = 15/44 (34%), Positives = 24/44 (54%)
 Frame = +2

Query: 491 HFYGTYFVSPSNITIDHLH*LIGNVLNGKNLFVFYVILGINNFN 622
           ++YG   ++P NI + ++    G  L G   + FY+I G  NFN
Sbjct: 272 YYYGKLVIAPLNIVLYNIFTPHGPDLYGTEPWYFYLINGFLNFN 315


>AK025012-1|BAB15052.1|  295|Homo sapiens protein ( Homo sapiens
           cDNA: FLJ21359 fis, clone COL02848. ).
          Length = 295

 Score = 30.7 bits (66), Expect = 7.3
 Identities = 20/53 (37%), Positives = 25/53 (47%), Gaps = 1/53 (1%)
 Frame = -3

Query: 403 HETASSSHRVANVXPVPAASKAHTGPAGGAT-HRPAHSGGGTPSRTLARTSHP 248
           H+ A+ S   A   P P  S+      G +T H+PA  GGGT     A TS P
Sbjct: 11  HQPATPSGGTAQT-PEPGTSQPMPPSMGTSTSHQPATPGGGTAQTPEAGTSQP 62


>AF454937-1|AAP97696.1|  440|Homo sapiens DIBD1 B protein.
          Length = 440

 Score = 30.7 bits (66), Expect = 7.3
 Identities = 15/44 (34%), Positives = 24/44 (54%)
 Frame = +2

Query: 491 HFYGTYFVSPSNITIDHLH*LIGNVLNGKNLFVFYVILGINNFN 622
           ++YG   ++P NI + ++    G  L G   + FY+I G  NFN
Sbjct: 101 YYYGKLVIAPLNIVLYNVFTPHGPDLYGTEPWYFYLIKGFLNFN 144


>AF414442-1|AAL65133.2|22152|Homo sapiens ovarian cancer related tumor
             marker CA125 protein.
          Length = 22152

 Score = 30.7 bits (66), Expect = 7.3
 Identities = 16/38 (42%), Positives = 21/38 (55%)
 Frame = -2

Query: 236   SGALTSLTLPNLVGMNGRLAQSAFIHTVTKTIQAKTFP 123
             SGA TS T+P L    G    +A + T  +T  +KTFP
Sbjct: 11752 SGAATSTTVPTLTHSPGMPETTALLSTHPRTGTSKTFP 11789


>AF395532-1|AAL25798.1|  611|Homo sapiens DIBD1 protein.
          Length = 611

 Score = 30.7 bits (66), Expect = 7.3
 Identities = 15/44 (34%), Positives = 24/44 (54%)
 Frame = +2

Query: 491 HFYGTYFVSPSNITIDHLH*LIGNVLNGKNLFVFYVILGINNFN 622
           ++YG   ++P NI + ++    G  L G   + FY+I G  NFN
Sbjct: 272 YYYGKLVIAPLNIVLYNVFTPHGPDLYGTEPWYFYLIKGFLNFN 315


>AF258674-2|AAG16731.1|  845|Homo sapiens MUCDHL-FL protein.
          Length = 845

 Score = 30.7 bits (66), Expect = 7.3
 Identities = 20/53 (37%), Positives = 25/53 (47%), Gaps = 1/53 (1%)
 Frame = -3

Query: 403 HETASSSHRVANVXPVPAASKAHTGPAGGAT-HRPAHSGGGTPSRTLARTSHP 248
           H+ A+ S   A   P P  S+      G +T H+PA  GGGT     A TS P
Sbjct: 561 HQPATPSGGTAQT-PEPGTSQPMPPSMGTSTSHQPATPGGGTAQTPEAGTSQP 612


>AF096834-1|AAD30662.1|  364|Homo sapiens germ cell specific Y-box
           binding protein protein.
          Length = 364

 Score = 30.7 bits (66), Expect = 7.3
 Identities = 18/46 (39%), Positives = 23/46 (50%)
 Frame = -3

Query: 394 ASSSHRVANVXPVPAASKAHTGPAGGATHRPAHSGGGTPSRTLART 257
           A+++  VA V PVPA      G AGG     +    GTPS   +RT
Sbjct: 20  ATAAGVVAVVVPVPAGEPQKGGGAGGGGGAASGPAAGTPSAPGSRT 65


>BC111720-1|AAI11721.1| 1522|Homo sapiens brain-specific
           angiogenesis inhibitor 3 protein.
          Length = 1522

 Score = 30.3 bits (65), Expect = 9.7
 Identities = 13/36 (36%), Positives = 18/36 (50%)
 Frame = +1

Query: 217 KEVSAPDMRAPGDWSERGSARGCRRRCVQGGAWPRR 324
           +E   P+  A G W++ G   GC + C   G W RR
Sbjct: 445 RECYNPECTANGQWNQWGHWSGCSKSC--DGGWERR 478


>BC009255-1|AAH09255.1|  618|Homo sapiens asparagine-linked
           glycosylation 9 homolog (S. cerevisiae, alpha-
           1,2-mannosyltr protein.
          Length = 618

 Score = 30.3 bits (65), Expect = 9.7
 Identities = 15/44 (34%), Positives = 24/44 (54%)
 Frame = +2

Query: 491 HFYGTYFVSPSNITIDHLH*LIGNVLNGKNLFVFYVILGINNFN 622
           ++YG   ++P NI + ++    G  L G   + FY+I G  NFN
Sbjct: 272 YYYGKLVIAPLNIVLYNVFTPHGPDLYGTEPWYFYLINGFLNFN 315


>AL391807-1|CAI21673.1| 1522|Homo sapiens brain-specific
           angiogenesis inhibitor 3 protein.
          Length = 1522

 Score = 30.3 bits (65), Expect = 9.7
 Identities = 13/36 (36%), Positives = 18/36 (50%)
 Frame = +1

Query: 217 KEVSAPDMRAPGDWSERGSARGCRRRCVQGGAWPRR 324
           +E   P+  A G W++ G   GC + C   G W RR
Sbjct: 445 RECYNPECTANGQWNQWGHWSGCSKSC--DGGWERR 478


>AL359714-1|CAH71522.1| 1522|Homo sapiens brain-specific
           angiogenesis inhibitor 3 protein.
          Length = 1522

 Score = 30.3 bits (65), Expect = 9.7
 Identities = 13/36 (36%), Positives = 18/36 (50%)
 Frame = +1

Query: 217 KEVSAPDMRAPGDWSERGSARGCRRRCVQGGAWPRR 324
           +E   P+  A G W++ G   GC + C   G W RR
Sbjct: 445 RECYNPECTANGQWNQWGHWSGCSKSC--DGGWERR 478


>AL356117-1|CAH71772.1| 1522|Homo sapiens brain-specific
           angiogenesis inhibitor 3 protein.
          Length = 1522

 Score = 30.3 bits (65), Expect = 9.7
 Identities = 13/36 (36%), Positives = 18/36 (50%)
 Frame = +1

Query: 217 KEVSAPDMRAPGDWSERGSARGCRRRCVQGGAWPRR 324
           +E   P+  A G W++ G   GC + C   G W RR
Sbjct: 445 RECYNPECTANGQWNQWGHWSGCSKSC--DGGWERR 478


>AL160401-1|CAH73864.1| 1522|Homo sapiens brain-specific
           angiogenesis inhibitor 3 protein.
          Length = 1522

 Score = 30.3 bits (65), Expect = 9.7
 Identities = 13/36 (36%), Positives = 18/36 (50%)
 Frame = +1

Query: 217 KEVSAPDMRAPGDWSERGSARGCRRRCVQGGAWPRR 324
           +E   P+  A G W++ G   GC + C   G W RR
Sbjct: 445 RECYNPECTANGQWNQWGHWSGCSKSC--DGGWERR 478


>AL158051-1|CAI19625.1| 1522|Homo sapiens brain-specific
           angiogenesis inhibitor 3 protein.
          Length = 1522

 Score = 30.3 bits (65), Expect = 9.7
 Identities = 13/36 (36%), Positives = 18/36 (50%)
 Frame = +1

Query: 217 KEVSAPDMRAPGDWSERGSARGCRRRCVQGGAWPRR 324
           +E   P+  A G W++ G   GC + C   G W RR
Sbjct: 445 RECYNPECTANGQWNQWGHWSGCSKSC--DGGWERR 478


>AL133378-1|CAC34969.2| 1522|Homo sapiens brain-specific
           angiogenesis inhibitor 3 protein.
          Length = 1522

 Score = 30.3 bits (65), Expect = 9.7
 Identities = 13/36 (36%), Positives = 18/36 (50%)
 Frame = +1

Query: 217 KEVSAPDMRAPGDWSERGSARGCRRRCVQGGAWPRR 324
           +E   P+  A G W++ G   GC + C   G W RR
Sbjct: 445 RECYNPECTANGQWNQWGHWSGCSKSC--DGGWERR 478


>AF043900-1|AAC39712.1|  475|Homo sapiens amphiphysin IIc2 protein.
          Length = 475

 Score = 30.3 bits (65), Expect = 9.7
 Identities = 22/86 (25%), Positives = 32/86 (37%), Gaps = 2/86 (2%)
 Frame = -3

Query: 421 NTLLSRHETASSSHRVANVXPVPAASKAHTGPAGGATHRPAHSGGGTPSRTLARTSHPGL 242
           NT   + + + ++    N  P P        P     H P  +GG TP  TL ++     
Sbjct: 246 NTFTVKAQPSDNAPAKGNKSPSPPDGSPAATPEIRVNHEPEPAGGATPGATLPKSPSQPT 305

Query: 241 SYPVR*LL*RSPISLE*T--VDWRSR 170
             P   L    P + E T  V W S+
Sbjct: 306 ESPAGSLPSGEPSAAEGTFAVSWPSQ 331


>AF043899-1|AAC39711.1|  506|Homo sapiens amphiphysin IIc1 protein.
          Length = 506

 Score = 30.3 bits (65), Expect = 9.7
 Identities = 22/86 (25%), Positives = 32/86 (37%), Gaps = 2/86 (2%)
 Frame = -3

Query: 421 NTLLSRHETASSSHRVANVXPVPAASKAHTGPAGGATHRPAHSGGGTPSRTLARTSHPGL 242
           NT   + + + ++    N  P P        P     H P  +GG TP  TL ++     
Sbjct: 277 NTFTVKAQPSDNAPAKGNKSPSPPDGSPAATPEIRVNHEPEPAGGATPGATLPKSPSQPT 336

Query: 241 SYPVR*LL*RSPISLE*T--VDWRSR 170
             P   L    P + E T  V W S+
Sbjct: 337 ESPAGSLPSGEPSAAEGTFAVSWPSQ 362


>AB011122-1|BAA25476.2| 1524|Homo sapiens KIAA0550 protein protein.
          Length = 1524

 Score = 30.3 bits (65), Expect = 9.7
 Identities = 13/36 (36%), Positives = 18/36 (50%)
 Frame = +1

Query: 217 KEVSAPDMRAPGDWSERGSARGCRRRCVQGGAWPRR 324
           +E   P+  A G W++ G   GC + C   G W RR
Sbjct: 447 RECYNPECTANGQWNQWGHWSGCSKSC--DGGWERR 480


>AB005299-1|BAA25363.1| 1522|Homo sapiens BAI 3 protein.
          Length = 1522

 Score = 30.3 bits (65), Expect = 9.7
 Identities = 13/36 (36%), Positives = 18/36 (50%)
 Frame = +1

Query: 217 KEVSAPDMRAPGDWSERGSARGCRRRCVQGGAWPRR 324
           +E   P+  A G W++ G   GC + C   G W RR
Sbjct: 445 RECYNPECTANGQWNQWGHWSGCSKSC--DGGWERR 478


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 130,753,063
Number of Sequences: 237096
Number of extensions: 2934791
Number of successful extensions: 8467
Number of sequences better than 10.0: 35
Number of HSP's better than 10.0 without gapping: 7589
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8433
length of database: 76,859,062
effective HSP length: 90
effective length of database: 55,520,422
effective search space used: 11270645666
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -