SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30132.Seq
         (689 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CR456437-1|CAG30323.1|  863|Homo sapiens dJ1014D13.2 protein.          40   0.006
AL022311-1|CAI18864.1|  863|Homo sapiens protein ( Human DNA seq...    40   0.006
AJ496196-1|CAD42713.1|  863|Homo sapiens molecule interacting wi...    40   0.006
AB051455-1|BAB33338.1|  791|Homo sapiens KIAA1668 protein protein.     40   0.006
BC051812-1|AAH51812.1|  127|Homo sapiens LIMD2 protein protein.        34   0.55 
BC004400-1|AAH04400.1|  127|Homo sapiens LIM domain containing 2...    34   0.55 
AK092301-1|BAC03855.1|  127|Homo sapiens protein ( Homo sapiens ...    34   0.55 
U24576-1|AAB51073.1|  165|Homo sapiens breast tumor autoantigen ...    33   0.96 
BC065818-1|AAH65818.1|  165|Homo sapiens LMO4 protein protein.         33   0.96 
BC017673-1|AAH17673.1|  165|Homo sapiens LIM domain only 4 protein.    33   0.96 
BC003600-1|AAH03600.1|  165|Homo sapiens LIM domain only 4 protein.    33   0.96 
AL138781-3|CAI16879.1|  397|Homo sapiens LIM homeobox 3 protein.       31   2.9  
AK097519-1|BAC05086.1|  519|Homo sapiens protein ( Homo sapiens ...    31   2.9  
AF367089-1|AAL26314.1|  397|Homo sapiens LIM homeobox protein 3 ...    31   2.9  
AF156888-1|AAF36808.1|  397|Homo sapiens LIM homeobox protein 3 ...    31   2.9  
BT020048-1|AAV38851.1|  270|Homo sapiens Ras association (RalGDS...    31   5.1  
BT020047-1|AAV38850.1|  270|Homo sapiens Ras association (RalGDS...    31   5.1  
BC117153-1|AAI17154.1|  340|Homo sapiens Ras association (RalGDS...    31   5.1  
BC110412-1|AAI10413.1|  189|Homo sapiens Ras association (RalGDS...    31   5.1  
AF132677-1|AAD44176.1|  189|Homo sapiens Ras association (RalGDS...    31   5.1  
AF132676-1|AAD44175.1|  270|Homo sapiens Ras association (RalGDS...    31   5.1  
AF132675-1|AAD44174.1|  340|Homo sapiens Ras association (RalGDS...    31   5.1  
AF102772-1|AAF35129.2|  344|Homo sapiens pancreas-specific ras a...    31   5.1  
AF102771-1|AAF35128.2|  344|Homo sapiens cardiac-specific ras as...    31   5.1  
AF102770-1|AAF35127.2|  340|Homo sapiens ras association (RalGDS...    31   5.1  
AF061836-1|AAC16001.1|  270|Homo sapiens putative tumor suppress...    31   5.1  
AF040703-1|AAC70910.2|  270|Homo sapiens ras association (RalGDS...    31   5.1  
AC002481-5|AAB67312.1|  184|Homo sapiens WUGSC:H_LUCA12.5 protein.     31   5.1  
BC110815-1|AAI10816.1|  759|Homo sapiens LIM domain and actin bi...    30   6.8  
AY555744-1|AAS66890.1|  166|Homo sapiens LIM-only isoform D prot...    30   6.8  
AY555743-1|AAS66889.1|  217|Homo sapiens LIM-only isoform C prot...    30   6.8  
AY555742-1|AAS66888.1|  205|Homo sapiens LIM-only isoform B prot...    30   6.8  
AY555741-1|AAS66887.1|  204|Homo sapiens LIM-only isoform A prot...    30   6.8  
AL583834-11|CAM20552.1|  217|Homo sapiens protein ( amily 22 (or...    30   6.8  
AL583834-10|CAI14469.1|  204|Homo sapiens protein ( amily 22 (or...    30   6.8  
AK222971-1|BAD96691.1|  759|Homo sapiens epithelial protein lost...    30   6.8  
AK023649-1|BAB14625.1|  457|Homo sapiens protein ( Homo sapiens ...    30   6.8  
AK000372-1|BAA91120.1|  704|Homo sapiens protein ( Homo sapiens ...    30   6.8  
AK000335-1|BAA91092.1|  599|Homo sapiens protein ( Homo sapiens ...    30   6.8  
AF198455-1|AAF23756.1|  600|Homo sapiens epithelial protein lost...    30   6.8  
AF198454-1|AAF23755.1|  759|Homo sapiens epithelial protein lost...    30   6.8  
AF157325-1|AAF67491.1|  457|Homo sapiens sterol regulatory eleme...    30   6.8  
AB209512-1|BAD92749.1|  769|Homo sapiens epithelial protein lost...    30   6.8  
BC001247-1|AAH01247.2|  660|Homo sapiens LIMA1 protein protein.        30   8.9  
AK000057-1|BAA90914.1|  456|Homo sapiens protein ( Homo sapiens ...    30   8.9  

>CR456437-1|CAG30323.1|  863|Homo sapiens dJ1014D13.2 protein.
          Length = 863

 Score = 40.3 bits (90), Expect = 0.006
 Identities = 17/59 (28%), Positives = 28/59 (47%)
 Frame = +1

Query: 343 EGDNPGASSKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHTVHRP 519
           +G+   + S SE   G T  S C+ C Q ++   +   D + +H HC +C  C +   P
Sbjct: 142 QGEELSSGSLSEQGTGQTPSSTCAACQQHVHLVQRYLADGRLYHRHCFRCRRCSSTLLP 200


>AL022311-1|CAI18864.1|  863|Homo sapiens protein ( Human DNA
           sequence from clone RP5-1014D13 on chromosome
           22q13.1-13.2.  ).
          Length = 863

 Score = 40.3 bits (90), Expect = 0.006
 Identities = 17/59 (28%), Positives = 28/59 (47%)
 Frame = +1

Query: 343 EGDNPGASSKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHTVHRP 519
           +G+   + S SE   G T  S C+ C Q ++   +   D + +H HC +C  C +   P
Sbjct: 142 QGEELSSGSLSEQGTGQTPSSTCAACQQHVHLVQRYLADGRLYHRHCFRCRRCSSTLLP 200


>AJ496196-1|CAD42713.1|  863|Homo sapiens molecule interacting with
           Rab13 protein.
          Length = 863

 Score = 40.3 bits (90), Expect = 0.006
 Identities = 17/59 (28%), Positives = 28/59 (47%)
 Frame = +1

Query: 343 EGDNPGASSKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHTVHRP 519
           +G+   + S SE   G T  S C+ C Q ++   +   D + +H HC +C  C +   P
Sbjct: 142 QGEELSSGSLSEQGTGQTPSSTCAACQQHVHLVQRYLADGRLYHRHCFRCRRCSSTLLP 200


>AB051455-1|BAB33338.1|  791|Homo sapiens KIAA1668 protein protein.
          Length = 791

 Score = 40.3 bits (90), Expect = 0.006
 Identities = 17/59 (28%), Positives = 28/59 (47%)
 Frame = +1

Query: 343 EGDNPGASSKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHTVHRP 519
           +G+   + S SE   G T  S C+ C Q ++   +   D + +H HC +C  C +   P
Sbjct: 70  QGEELSSGSLSEQGTGQTPSSTCAACQQHVHLVQRYLADGRLYHRHCFRCRRCSSTLLP 128


>BC051812-1|AAH51812.1|  127|Homo sapiens LIMD2 protein protein.
          Length = 127

 Score = 33.9 bits (74), Expect = 0.55
 Identities = 16/54 (29%), Positives = 25/54 (46%)
 Frame = +1

Query: 346 GDNPGASSKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHT 507
           G +    SKS +     K + C+ C + +    ++  DK  FH+ C  C  CHT
Sbjct: 20  GSSTVQRSKSFSLRAQVKET-CAACQKTVYPMERLVADKLIFHNSCFCCKHCHT 72


>BC004400-1|AAH04400.1|  127|Homo sapiens LIM domain containing 2
           protein.
          Length = 127

 Score = 33.9 bits (74), Expect = 0.55
 Identities = 16/54 (29%), Positives = 25/54 (46%)
 Frame = +1

Query: 346 GDNPGASSKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHT 507
           G +    SKS +     K + C+ C + +    ++  DK  FH+ C  C  CHT
Sbjct: 20  GSSTVQRSKSFSLRAQVKET-CAACQKTVYPMERLVADKLIFHNSCFCCKHCHT 72


>AK092301-1|BAC03855.1|  127|Homo sapiens protein ( Homo sapiens
           cDNA FLJ34982 fis, clone OCBBF2001186, moderately
           similar to Mus musculus epithelial protein lost in
           neoplasm-a (Eplin) mRNA. ).
          Length = 127

 Score = 33.9 bits (74), Expect = 0.55
 Identities = 16/54 (29%), Positives = 25/54 (46%)
 Frame = +1

Query: 346 GDNPGASSKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHT 507
           G +    SKS +     K + C+ C + +    ++  DK  FH+ C  C  CHT
Sbjct: 20  GSSTVQRSKSFSLRAQVKET-CAACQKTVYPMERLVADKLIFHNSCFCCKHCHT 72


>U24576-1|AAB51073.1|  165|Homo sapiens breast tumor autoantigen
           protein.
          Length = 165

 Score = 33.1 bits (72), Expect = 0.96
 Identities = 21/73 (28%), Positives = 29/73 (39%), Gaps = 1/73 (1%)
 Frame = +1

Query: 352 NPGASSKSE-ASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHTVHRPTST 528
           NPG+SS+    + G+     C+ C   I +   +      +HS C KC  C        T
Sbjct: 3   NPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGT 62

Query: 529 SAMVKSSASLASN 567
           S   KS   L  N
Sbjct: 63  SCYTKSGMILCRN 75


>BC065818-1|AAH65818.1|  165|Homo sapiens LMO4 protein protein.
          Length = 165

 Score = 33.1 bits (72), Expect = 0.96
 Identities = 21/73 (28%), Positives = 29/73 (39%), Gaps = 1/73 (1%)
 Frame = +1

Query: 352 NPGASSKSE-ASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHTVHRPTST 528
           NPG+SS+    + G+     C+ C   I +   +      +HS C KC  C        T
Sbjct: 3   NPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGT 62

Query: 529 SAMVKSSASLASN 567
           S   KS   L  N
Sbjct: 63  SCYTKSGMILCRN 75


>BC017673-1|AAH17673.1|  165|Homo sapiens LIM domain only 4 protein.
          Length = 165

 Score = 33.1 bits (72), Expect = 0.96
 Identities = 21/73 (28%), Positives = 29/73 (39%), Gaps = 1/73 (1%)
 Frame = +1

Query: 352 NPGASSKSE-ASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHTVHRPTST 528
           NPG+SS+    + G+     C+ C   I +   +      +HS C KC  C        T
Sbjct: 3   NPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGT 62

Query: 529 SAMVKSSASLASN 567
           S   KS   L  N
Sbjct: 63  SCYTKSGMILCRN 75


>BC003600-1|AAH03600.1|  165|Homo sapiens LIM domain only 4 protein.
          Length = 165

 Score = 33.1 bits (72), Expect = 0.96
 Identities = 21/73 (28%), Positives = 29/73 (39%), Gaps = 1/73 (1%)
 Frame = +1

Query: 352 NPGASSKSE-ASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHTVHRPTST 528
           NPG+SS+    + G+     C+ C   I +   +      +HS C KC  C        T
Sbjct: 3   NPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGT 62

Query: 529 SAMVKSSASLASN 567
           S   KS   L  N
Sbjct: 63  SCYTKSGMILCRN 75


>AL138781-3|CAI16879.1|  397|Homo sapiens LIM homeobox 3 protein.
          Length = 397

 Score = 31.5 bits (68), Expect = 2.9
 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 1/58 (1%)
 Frame = +1

Query: 337 GQEGDNPGASSKSEASEGNTKR-SVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHT 507
           G E D     + +  + G T+   +C+ C Q I +   ++   + +HS C KC  CHT
Sbjct: 6   GLERDRARPGAAAVCTLGGTREIPLCAGCDQHILDRFILKALDRHWHSKCLKCSDCHT 63


>AK097519-1|BAC05086.1|  519|Homo sapiens protein ( Homo sapiens
           cDNA FLJ40200 fis, clone TESTI2020071, weakly similar to
           Mus musculus epithelial protein lost in neoplasm-a
           (Eplin) mRNA. ).
          Length = 519

 Score = 31.5 bits (68), Expect = 2.9
 Identities = 10/36 (27%), Positives = 19/36 (52%)
 Frame = +1

Query: 400 RSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHT 507
           + +C  C + +     +  DKQ FH  C +C+ C++
Sbjct: 399 KEICILCQKTVYPMECLVADKQNFHKSCFRCHHCNS 434


>AF367089-1|AAL26314.1|  397|Homo sapiens LIM homeobox protein 3
           protein.
          Length = 397

 Score = 31.5 bits (68), Expect = 2.9
 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 1/58 (1%)
 Frame = +1

Query: 337 GQEGDNPGASSKSEASEGNTKR-SVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHT 507
           G E D     + +  + G T+   +C+ C Q I +   ++   + +HS C KC  CHT
Sbjct: 6   GLERDRARPGAAAVCTLGGTREIPLCAGCDQHILDRFILKALDRHWHSKCLKCSDCHT 63


>AF156888-1|AAF36808.1|  397|Homo sapiens LIM homeobox protein 3
           isoform a protein.
          Length = 397

 Score = 31.5 bits (68), Expect = 2.9
 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 1/58 (1%)
 Frame = +1

Query: 337 GQEGDNPGASSKSEASEGNTKR-SVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHT 507
           G E D     + +  + G T+   +C+ C Q I +   ++   + +HS C KC  CHT
Sbjct: 6   GLERDRARPGAAAVCTLGGTREIPLCAGCDQHILDRFILKALDRHWHSKCLKCSDCHT 63


>BT020048-1|AAV38851.1|  270|Homo sapiens Ras association
           (RalGDS/AF-6) domain family 1 protein.
          Length = 270

 Score = 30.7 bits (66), Expect = 5.1
 Identities = 14/30 (46%), Positives = 21/30 (70%)
 Frame = -1

Query: 683 PCPAHKLLHILGKSGVRELLEALLEEFIGV 594
           P  A K LH+L ++  RE++EALL +F+ V
Sbjct: 137 PKDAVKHLHVLSRTRAREVIEALLRKFLVV 166


>BT020047-1|AAV38850.1|  270|Homo sapiens Ras association
           (RalGDS/AF-6) domain family 1 protein.
          Length = 270

 Score = 30.7 bits (66), Expect = 5.1
 Identities = 14/30 (46%), Positives = 21/30 (70%)
 Frame = -1

Query: 683 PCPAHKLLHILGKSGVRELLEALLEEFIGV 594
           P  A K LH+L ++  RE++EALL +F+ V
Sbjct: 137 PKDAVKHLHVLSRTRAREVIEALLRKFLVV 166


>BC117153-1|AAI17154.1|  340|Homo sapiens Ras association
           (RalGDS/AF-6) domain family 1 protein.
          Length = 340

 Score = 30.7 bits (66), Expect = 5.1
 Identities = 14/30 (46%), Positives = 21/30 (70%)
 Frame = -1

Query: 683 PCPAHKLLHILGKSGVRELLEALLEEFIGV 594
           P  A K LH+L ++  RE++EALL +F+ V
Sbjct: 207 PKDAVKHLHVLSRTRAREVIEALLRKFLVV 236


>BC110412-1|AAI10413.1|  189|Homo sapiens Ras association
           (RalGDS/AF-6) domain family 1 protein.
          Length = 189

 Score = 30.7 bits (66), Expect = 5.1
 Identities = 14/30 (46%), Positives = 21/30 (70%)
 Frame = -1

Query: 683 PCPAHKLLHILGKSGVRELLEALLEEFIGV 594
           P  A K LH+L ++  RE++EALL +F+ V
Sbjct: 56  PKDAVKHLHVLSRTRAREVIEALLRKFLVV 85


>AF132677-1|AAD44176.1|  189|Homo sapiens Ras association
           (RalGDS/AF-6) domain family protein 1B protein.
          Length = 189

 Score = 30.7 bits (66), Expect = 5.1
 Identities = 14/30 (46%), Positives = 21/30 (70%)
 Frame = -1

Query: 683 PCPAHKLLHILGKSGVRELLEALLEEFIGV 594
           P  A K LH+L ++  RE++EALL +F+ V
Sbjct: 56  PKDAVKHLHVLSRTRAREVIEALLRKFLVV 85


>AF132676-1|AAD44175.1|  270|Homo sapiens Ras association
           (RalGDS/AF-6) domain family protein 1C protein.
          Length = 270

 Score = 30.7 bits (66), Expect = 5.1
 Identities = 14/30 (46%), Positives = 21/30 (70%)
 Frame = -1

Query: 683 PCPAHKLLHILGKSGVRELLEALLEEFIGV 594
           P  A K LH+L ++  RE++EALL +F+ V
Sbjct: 137 PKDAVKHLHVLSRTRAREVIEALLRKFLVV 166


>AF132675-1|AAD44174.1|  340|Homo sapiens Ras association
           (RalGDS/AF-6) domain family protein 1A protein.
          Length = 340

 Score = 30.7 bits (66), Expect = 5.1
 Identities = 14/30 (46%), Positives = 21/30 (70%)
 Frame = -1

Query: 683 PCPAHKLLHILGKSGVRELLEALLEEFIGV 594
           P  A K LH+L ++  RE++EALL +F+ V
Sbjct: 207 PKDAVKHLHVLSRTRAREVIEALLRKFLVV 236


>AF102772-1|AAF35129.2|  344|Homo sapiens pancreas-specific ras
           association (RalGDS/AF-6) domain family 1 protein
           isoform protein.
          Length = 344

 Score = 30.7 bits (66), Expect = 5.1
 Identities = 14/30 (46%), Positives = 21/30 (70%)
 Frame = -1

Query: 683 PCPAHKLLHILGKSGVRELLEALLEEFIGV 594
           P  A K LH+L ++  RE++EALL +F+ V
Sbjct: 211 PKDAVKHLHVLSRTRAREVIEALLRKFLVV 240


>AF102771-1|AAF35128.2|  344|Homo sapiens cardiac-specific ras
           association (RalGDS/AF-6) domain family 1 protein
           isoform  protein.
          Length = 344

 Score = 30.7 bits (66), Expect = 5.1
 Identities = 14/30 (46%), Positives = 21/30 (70%)
 Frame = -1

Query: 683 PCPAHKLLHILGKSGVRELLEALLEEFIGV 594
           P  A K LH+L ++  RE++EALL +F+ V
Sbjct: 211 PKDAVKHLHVLSRTRAREVIEALLRKFLVV 240


>AF102770-1|AAF35127.2|  340|Homo sapiens ras association
           (RalGDS/AF-6) domain family 1 protein isoform 1A
           protein.
          Length = 340

 Score = 30.7 bits (66), Expect = 5.1
 Identities = 14/30 (46%), Positives = 21/30 (70%)
 Frame = -1

Query: 683 PCPAHKLLHILGKSGVRELLEALLEEFIGV 594
           P  A K LH+L ++  RE++EALL +F+ V
Sbjct: 207 PKDAVKHLHVLSRTRAREVIEALLRKFLVV 236


>AF061836-1|AAC16001.1|  270|Homo sapiens putative tumor suppressor
           protein protein.
          Length = 270

 Score = 30.7 bits (66), Expect = 5.1
 Identities = 14/30 (46%), Positives = 21/30 (70%)
 Frame = -1

Query: 683 PCPAHKLLHILGKSGVRELLEALLEEFIGV 594
           P  A K LH+L ++  RE++EALL +F+ V
Sbjct: 137 PKDAVKHLHVLSRTRAREVIEALLRKFLVV 166


>AF040703-1|AAC70910.2|  270|Homo sapiens ras association
           (RalGDS/AF-6) domain family 1 protein isoform 1C
           protein.
          Length = 270

 Score = 30.7 bits (66), Expect = 5.1
 Identities = 14/30 (46%), Positives = 21/30 (70%)
 Frame = -1

Query: 683 PCPAHKLLHILGKSGVRELLEALLEEFIGV 594
           P  A K LH+L ++  RE++EALL +F+ V
Sbjct: 137 PKDAVKHLHVLSRTRAREVIEALLRKFLVV 166


>AC002481-5|AAB67312.1|  184|Homo sapiens WUGSC:H_LUCA12.5 protein.
          Length = 184

 Score = 30.7 bits (66), Expect = 5.1
 Identities = 14/30 (46%), Positives = 21/30 (70%)
 Frame = -1

Query: 683 PCPAHKLLHILGKSGVRELLEALLEEFIGV 594
           P  A K LH+L ++  RE++EALL +F+ V
Sbjct: 88  PKDAVKHLHVLSRTRAREVIEALLRKFLVV 117


>BC110815-1|AAI10816.1|  759|Homo sapiens LIM domain and actin
           binding 1 protein.
          Length = 759

 Score = 30.3 bits (65), Expect = 6.8
 Identities = 14/54 (25%), Positives = 24/54 (44%)
 Frame = +1

Query: 343 EGDNPGASSKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCH 504
           E   P A  K +A      R  C  C + +    ++  ++Q FH  C +C +C+
Sbjct: 372 ESSPPKAMKKFQAPA----RETCVECQKTVYPMERLLANQQVFHISCFRCSYCN 421


>AY555744-1|AAS66890.1|  166|Homo sapiens LIM-only isoform D
           protein.
          Length = 166

 Score = 30.3 bits (65), Expect = 6.8
 Identities = 12/37 (32%), Positives = 18/37 (48%)
 Frame = +1

Query: 409 CSRCLQMINENNKIEIDKQAFHSHCAKCYFCHTVHRP 519
           C RC Q +    K+    + +H  C KC  CH++  P
Sbjct: 5   CPRCQQPVFFAEKVSSLGKNWHRFCLKCERCHSILSP 41


>AY555743-1|AAS66889.1|  217|Homo sapiens LIM-only isoform C
           protein.
          Length = 217

 Score = 30.3 bits (65), Expect = 6.8
 Identities = 12/37 (32%), Positives = 18/37 (48%)
 Frame = +1

Query: 409 CSRCLQMINENNKIEIDKQAFHSHCAKCYFCHTVHRP 519
           C RC Q +    K+    + +H  C KC  CH++  P
Sbjct: 5   CPRCQQPVFFAEKVSSLGKNWHRFCLKCERCHSILSP 41


>AY555742-1|AAS66888.1|  205|Homo sapiens LIM-only isoform B
           protein.
          Length = 205

 Score = 30.3 bits (65), Expect = 6.8
 Identities = 12/37 (32%), Positives = 18/37 (48%)
 Frame = +1

Query: 409 CSRCLQMINENNKIEIDKQAFHSHCAKCYFCHTVHRP 519
           C RC Q +    K+    + +H  C KC  CH++  P
Sbjct: 5   CPRCQQPVFFAEKVSSLGKNWHRFCLKCERCHSILSP 41


>AY555741-1|AAS66887.1|  204|Homo sapiens LIM-only isoform A
           protein.
          Length = 204

 Score = 30.3 bits (65), Expect = 6.8
 Identities = 12/37 (32%), Positives = 18/37 (48%)
 Frame = +1

Query: 409 CSRCLQMINENNKIEIDKQAFHSHCAKCYFCHTVHRP 519
           C RC Q +    K+    + +H  C KC  CH++  P
Sbjct: 5   CPRCQQPVFFAEKVSSLGKNWHRFCLKCERCHSILSP 41


>AL583834-11|CAM20552.1|  217|Homo sapiens protein ( amily 22
           (organic anion  ).).
          Length = 217

 Score = 30.3 bits (65), Expect = 6.8
 Identities = 12/37 (32%), Positives = 18/37 (48%)
 Frame = +1

Query: 409 CSRCLQMINENNKIEIDKQAFHSHCAKCYFCHTVHRP 519
           C RC Q +    K+    + +H  C KC  CH++  P
Sbjct: 5   CPRCQQPVFFAEKVSSLGKNWHRFCLKCERCHSILSP 41


>AL583834-10|CAI14469.1|  204|Homo sapiens protein ( amily 22
           (organic anion  ).).
          Length = 204

 Score = 30.3 bits (65), Expect = 6.8
 Identities = 12/37 (32%), Positives = 18/37 (48%)
 Frame = +1

Query: 409 CSRCLQMINENNKIEIDKQAFHSHCAKCYFCHTVHRP 519
           C RC Q +    K+    + +H  C KC  CH++  P
Sbjct: 5   CPRCQQPVFFAEKVSSLGKNWHRFCLKCERCHSILSP 41


>AK222971-1|BAD96691.1|  759|Homo sapiens epithelial protein lost in
           neoplasm beta variant protein.
          Length = 759

 Score = 30.3 bits (65), Expect = 6.8
 Identities = 14/54 (25%), Positives = 24/54 (44%)
 Frame = +1

Query: 343 EGDNPGASSKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCH 504
           E   P A  K +A      R  C  C + +    ++  ++Q FH  C +C +C+
Sbjct: 372 ESSPPKAMKKFQAPA----RETCVECQKTVYPMERLLANQQVFHISCFRCSYCN 421


>AK023649-1|BAB14625.1|  457|Homo sapiens protein ( Homo sapiens
           cDNA FLJ13587 fis, clone PLACE1009246, weakly similar to
           POLLEN SPECIFIC PROTEIN SF3. ).
          Length = 457

 Score = 30.3 bits (65), Expect = 6.8
 Identities = 14/54 (25%), Positives = 24/54 (44%)
 Frame = +1

Query: 343 EGDNPGASSKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCH 504
           E   P A  K +A      R  C  C + +    ++  ++Q FH  C +C +C+
Sbjct: 70  ESSPPKAMKKFQAPA----RETCVECQKTVYPMERLLANQQVFHISCFRCSYCN 119


>AK000372-1|BAA91120.1|  704|Homo sapiens protein ( Homo sapiens
           cDNA FLJ20365 fis, clone HEP17877. ).
          Length = 704

 Score = 30.3 bits (65), Expect = 6.8
 Identities = 14/54 (25%), Positives = 24/54 (44%)
 Frame = +1

Query: 343 EGDNPGASSKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCH 504
           E   P A  K +A      R  C  C + +    ++  ++Q FH  C +C +C+
Sbjct: 372 ESSPPKAMKKFQAPA----RETCVECQKTVYPMERLLANQQVFHISCFRCSYCN 421


>AK000335-1|BAA91092.1|  599|Homo sapiens protein ( Homo sapiens
           cDNA FLJ20328 fis, clone HEP10039. ).
          Length = 599

 Score = 30.3 bits (65), Expect = 6.8
 Identities = 14/54 (25%), Positives = 24/54 (44%)
 Frame = +1

Query: 343 EGDNPGASSKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCH 504
           E   P A  K +A      R  C  C + +    ++  ++Q FH  C +C +C+
Sbjct: 212 ESSPPKAMKKFQAPA----RETCVECQKTVYPMERLLANQQVFHISCFRCSYCN 261


>AF198455-1|AAF23756.1|  600|Homo sapiens epithelial protein lost in
           neoplasm alpha protein.
          Length = 600

 Score = 30.3 bits (65), Expect = 6.8
 Identities = 14/54 (25%), Positives = 24/54 (44%)
 Frame = +1

Query: 343 EGDNPGASSKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCH 504
           E   P A  K +A      R  C  C + +    ++  ++Q FH  C +C +C+
Sbjct: 213 ESSPPKAMKKFQAPA----RETCVECQKTVYPMERLLANQQVFHISCFRCSYCN 262


>AF198454-1|AAF23755.1|  759|Homo sapiens epithelial protein lost in
           neoplasm beta protein.
          Length = 759

 Score = 30.3 bits (65), Expect = 6.8
 Identities = 14/54 (25%), Positives = 24/54 (44%)
 Frame = +1

Query: 343 EGDNPGASSKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCH 504
           E   P A  K +A      R  C  C + +    ++  ++Q FH  C +C +C+
Sbjct: 372 ESSPPKAMKKFQAPA----RETCVECQKTVYPMERLLANQQVFHISCFRCSYCN 421


>AF157325-1|AAF67491.1|  457|Homo sapiens sterol regulatory element
           binding protein 3 protein.
          Length = 457

 Score = 30.3 bits (65), Expect = 6.8
 Identities = 14/54 (25%), Positives = 24/54 (44%)
 Frame = +1

Query: 343 EGDNPGASSKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCH 504
           E   P A  K +A      R  C  C + +    ++  ++Q FH  C +C +C+
Sbjct: 70  ESSPPKAMKKFQAPA----RETCVECQKTVYPMERLLANQQVFHISCFRCSYCN 119


>AB209512-1|BAD92749.1|  769|Homo sapiens epithelial protein lost in
           neoplasm beta variant protein.
          Length = 769

 Score = 30.3 bits (65), Expect = 6.8
 Identities = 14/54 (25%), Positives = 24/54 (44%)
 Frame = +1

Query: 343 EGDNPGASSKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCH 504
           E   P A  K +A      R  C  C + +    ++  ++Q FH  C +C +C+
Sbjct: 382 ESSPPKAMKKFQAPA----RETCVECQKTVYPMERLLANQQVFHISCFRCSYCN 431


>BC001247-1|AAH01247.2|  660|Homo sapiens LIMA1 protein protein.
          Length = 660

 Score = 29.9 bits (64), Expect = 8.9
 Identities = 9/35 (25%), Positives = 18/35 (51%)
 Frame = +1

Query: 400 RSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCH 504
           R  C  C + +    ++  ++Q FH  C +C +C+
Sbjct: 288 RETCVECQKTVYPMERLLANQQVFHISCFRCSYCN 322


>AK000057-1|BAA90914.1|  456|Homo sapiens protein ( Homo sapiens
           cDNA FLJ20050 fis, clone COL00688. ).
          Length = 456

 Score = 29.9 bits (64), Expect = 8.9
 Identities = 9/35 (25%), Positives = 18/35 (51%)
 Frame = +1

Query: 400 RSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCH 504
           R  C  C + +    ++  ++Q FH  C +C +C+
Sbjct: 84  RETCVECQKTVYPMERLLANQQVFHISCFRCSYCN 118


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 105,628,238
Number of Sequences: 237096
Number of extensions: 2256372
Number of successful extensions: 6049
Number of sequences better than 10.0: 45
Number of HSP's better than 10.0 without gapping: 5659
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6043
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 7895240574
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -