SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30131.Seq
         (482 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U43901-1|AAC50652.1|  295|Homo sapiens 37 kD laminin receptor pr...   145   8e-35
S37431-1|AAB22299.1|  295|Homo sapiens 67 kda laminin receptor p...   145   8e-35
J03799-1|AAA36161.1|  295|Homo sapiens protein ( Human colin car...   145   8e-35
BT007219-1|AAP35883.1|  295|Homo sapiens laminin receptor 1 (rib...   145   8e-35
BC107567-1|AAI07568.1|  295|Homo sapiens ribosomal protein SA pr...   145   8e-35
BC073863-1|AAH73863.1|  295|Homo sapiens ribosomal protein SA pr...   145   8e-35
BC071970-1|AAH71970.1|  295|Homo sapiens ribosomal protein SA pr...   145   8e-35
BC071969-1|AAH71969.1|  295|Homo sapiens ribosomal protein SA pr...   145   8e-35
BC071968-1|AAH71968.1|  295|Homo sapiens ribosomal protein SA pr...   145   8e-35
BC071693-1|AAH71693.1|  295|Homo sapiens ribosomal protein SA pr...   145   8e-35
BC068062-1|AAH68062.1|  295|Homo sapiens ribosomal protein SA pr...   145   8e-35
BC066941-1|AAH66941.1|  295|Homo sapiens ribosomal protein SA pr...   145   8e-35
BC062714-1|AAH62714.1|  295|Homo sapiens ribosomal protein SA pr...   145   8e-35
BC053370-1|AAH53370.1|  295|Homo sapiens ribosomal protein SA pr...   145   8e-35
BC034537-1|AAH34537.1|  295|Homo sapiens ribosomal protein SA pr...   145   8e-35
BC013827-1|AAH13827.1|  295|Homo sapiens ribosomal protein SA pr...   145   8e-35
BC010418-1|AAH10418.1|  295|Homo sapiens ribosomal protein SA pr...   145   8e-35
BC008867-1|AAH08867.1|  295|Homo sapiens ribosomal protein SA pr...   145   8e-35
BC005391-1|AAH05391.1|  295|Homo sapiens ribosomal protein SA pr...   145   8e-35
AF503367-1|AAM33304.1|  295|Homo sapiens multidrug resistance-as...   145   8e-35
X61156-1|CAA43469.1|  285|Homo sapiens laminin-binding protein p...   144   2e-34
BC070263-1|AAH70263.1|  295|Homo sapiens ribosomal protein SA pr...   143   3e-34
BC050688-1|AAH50688.1|  295|Homo sapiens ribosomal protein SA pr...   143   3e-34
AF284768-1|AAK69721.1|  295|Homo sapiens laminin receptor-like p...   143   3e-34
BC071971-1|AAH71971.1|  295|Homo sapiens ribosomal protein SA ps...   142   8e-34
X15005-1|CAA33112.1|  300|Homo sapiens protein ( Human mRNA for ...   137   2e-32
U36484-1|AAC50313.1|  125|Homo sapiens laminin-binding protein p...   103   4e-22
M14199-1|AAA36165.1|  135|Homo sapiens protein ( Human laminin r...    71   2e-12
BC107865-1|AAI07866.1|  197|Homo sapiens LOC204010 protein protein.    43   7e-04
BC058822-1|AAH58822.1|  197|Homo sapiens LOC204010 protein protein.    43   7e-04
AJ566387-1|CAD97467.1|  251|Homo sapiens keratin associated prot...    31   1.6  
AB076358-1|BAD01545.1|  251|Homo sapiens keratin associated prot...    31   1.6  
BC110619-1|AAI10620.1|  174|Homo sapiens keratin associated prot...    31   2.1  
AJ406946-1|CAC27585.1|  174|Homo sapiens keratin associated prot...    31   2.1  
AK090647-1|BAC03496.1|  353|Homo sapiens   protein.                    31   2.8  
BC103846-1|AAI03847.1|  127|Homo sapiens keratin associated prot...    30   4.9  
BC103845-1|AAI03846.1|  127|Homo sapiens keratin associated prot...    30   4.9  
AJ406942-1|CAC27581.1|  127|Homo sapiens keratin associated prot...    30   4.9  

>U43901-1|AAC50652.1|  295|Homo sapiens 37 kD laminin receptor
           precursor/p40 ribosome associated protein protein.
          Length = 295

 Score =  145 bits (351), Expect = 8e-35
 Identities = 71/84 (84%), Positives = 75/84 (89%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL+LAARA+VAIENPADV VISSR  GQRAVLKFAA TGATPIAGRFTPG FTNQIQAAF
Sbjct: 57  KLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAF 116

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
           REPRLL+V DP   HQP+TEASYV
Sbjct: 117 REPRLLVVTDPRADHQPLTEASYV 140



 Score =  101 bits (243), Expect = 1e-21
 Identities = 42/74 (56%), Positives = 51/74 (68%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           +P IA CNTDSPL +VDIAIPCN K +HS+GLMWW              R+  W+V+ DL
Sbjct: 142 LPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDL 201

Query: 437 FFYRDPEESEKDEQ 478
           +FYRDPEE EK+EQ
Sbjct: 202 YFYRDPEEIEKEEQ 215


>S37431-1|AAB22299.1|  295|Homo sapiens 67 kda laminin receptor
           protein.
          Length = 295

 Score =  145 bits (351), Expect = 8e-35
 Identities = 71/84 (84%), Positives = 75/84 (89%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL+LAARA+VAIENPADV VISSR  GQRAVLKFAA TGATPIAGRFTPG FTNQIQAAF
Sbjct: 57  KLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAF 116

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
           REPRLL+V DP   HQP+TEASYV
Sbjct: 117 REPRLLVVTDPRADHQPLTEASYV 140



 Score = 99.1 bits (236), Expect = 7e-21
 Identities = 41/74 (55%), Positives = 50/74 (67%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           +P IA CNTDSPL +VDIAIPCN K +HS+GLMWW              R+  W+V+ DL
Sbjct: 142 LPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDL 201

Query: 437 FFYRDPEESEKDEQ 478
           +FYRDPEE  K+EQ
Sbjct: 202 YFYRDPEEIGKEEQ 215


>J03799-1|AAA36161.1|  295|Homo sapiens protein ( Human colin
           carcinoma laminin-binding protein mRNA, complete cds. ).
          Length = 295

 Score =  145 bits (351), Expect = 8e-35
 Identities = 71/84 (84%), Positives = 75/84 (89%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL+LAARA+VAIENPADV VISSR  GQRAVLKFAA TGATPIAGRFTPG FTNQIQAAF
Sbjct: 57  KLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAF 116

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
           REPRLL+V DP   HQP+TEASYV
Sbjct: 117 REPRLLVVTDPRADHQPLTEASYV 140



 Score =  101 bits (243), Expect = 1e-21
 Identities = 42/74 (56%), Positives = 51/74 (68%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           +P IA CNTDSPL +VDIAIPCN K +HS+GLMWW              R+  W+V+ DL
Sbjct: 142 LPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDL 201

Query: 437 FFYRDPEESEKDEQ 478
           +FYRDPEE EK+EQ
Sbjct: 202 YFYRDPEEIEKEEQ 215


>BT007219-1|AAP35883.1|  295|Homo sapiens laminin receptor 1
           (ribosomal protein SA, 67kDa) protein.
          Length = 295

 Score =  145 bits (351), Expect = 8e-35
 Identities = 71/84 (84%), Positives = 75/84 (89%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL+LAARA+VAIENPADV VISSR  GQRAVLKFAA TGATPIAGRFTPG FTNQIQAAF
Sbjct: 57  KLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAF 116

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
           REPRLL+V DP   HQP+TEASYV
Sbjct: 117 REPRLLVVTDPRADHQPLTEASYV 140



 Score =  101 bits (243), Expect = 1e-21
 Identities = 42/74 (56%), Positives = 51/74 (68%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           +P IA CNTDSPL +VDIAIPCN K +HS+GLMWW              R+  W+V+ DL
Sbjct: 142 LPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDL 201

Query: 437 FFYRDPEESEKDEQ 478
           +FYRDPEE EK+EQ
Sbjct: 202 YFYRDPEEIEKEEQ 215


>BC107567-1|AAI07568.1|  295|Homo sapiens ribosomal protein SA
           protein.
          Length = 295

 Score =  145 bits (351), Expect = 8e-35
 Identities = 71/84 (84%), Positives = 75/84 (89%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL+LAARA+VAIENPADV VISSR  GQRAVLKFAA TGATPIAGRFTPG FTNQIQAAF
Sbjct: 57  KLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAF 116

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
           REPRLL+V DP   HQP+TEASYV
Sbjct: 117 REPRLLVVTDPRADHQPLTEASYV 140



 Score =  101 bits (243), Expect = 1e-21
 Identities = 42/74 (56%), Positives = 51/74 (68%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           +P IA CNTDSPL +VDIAIPCN K +HS+GLMWW              R+  W+V+ DL
Sbjct: 142 LPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDL 201

Query: 437 FFYRDPEESEKDEQ 478
           +FYRDPEE EK+EQ
Sbjct: 202 YFYRDPEEIEKEEQ 215


>BC073863-1|AAH73863.1|  295|Homo sapiens ribosomal protein SA
           protein.
          Length = 295

 Score =  145 bits (351), Expect = 8e-35
 Identities = 71/84 (84%), Positives = 75/84 (89%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL+LAARA+VAIENPADV VISSR  GQRAVLKFAA TGATPIAGRFTPG FTNQIQAAF
Sbjct: 57  KLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAF 116

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
           REPRLL+V DP   HQP+TEASYV
Sbjct: 117 REPRLLVVTDPRADHQPLTEASYV 140



 Score =  101 bits (243), Expect = 1e-21
 Identities = 42/74 (56%), Positives = 51/74 (68%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           +P IA CNTDSPL +VDIAIPCN K +HS+GLMWW              R+  W+V+ DL
Sbjct: 142 LPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDL 201

Query: 437 FFYRDPEESEKDEQ 478
           +FYRDPEE EK+EQ
Sbjct: 202 YFYRDPEEIEKEEQ 215


>BC071970-1|AAH71970.1|  295|Homo sapiens ribosomal protein SA
           protein.
          Length = 295

 Score =  145 bits (351), Expect = 8e-35
 Identities = 71/84 (84%), Positives = 75/84 (89%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL+LAARA+VAIENPADV VISSR  GQRAVLKFAA TGATPIAGRFTPG FTNQIQAAF
Sbjct: 57  KLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAF 116

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
           REPRLL+V DP   HQP+TEASYV
Sbjct: 117 REPRLLVVTDPRADHQPLTEASYV 140



 Score =  101 bits (243), Expect = 1e-21
 Identities = 42/74 (56%), Positives = 51/74 (68%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           +P IA CNTDSPL +VDIAIPCN K +HS+GLMWW              R+  W+V+ DL
Sbjct: 142 LPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDL 201

Query: 437 FFYRDPEESEKDEQ 478
           +FYRDPEE EK+EQ
Sbjct: 202 YFYRDPEEIEKEEQ 215


>BC071969-1|AAH71969.1|  295|Homo sapiens ribosomal protein SA
           protein.
          Length = 295

 Score =  145 bits (351), Expect = 8e-35
 Identities = 71/84 (84%), Positives = 75/84 (89%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL+LAARA+VAIENPADV VISSR  GQRAVLKFAA TGATPIAGRFTPG FTNQIQAAF
Sbjct: 57  KLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAF 116

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
           REPRLL+V DP   HQP+TEASYV
Sbjct: 117 REPRLLVVTDPRADHQPLTEASYV 140



 Score =  101 bits (243), Expect = 1e-21
 Identities = 42/74 (56%), Positives = 51/74 (68%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           +P IA CNTDSPL +VDIAIPCN K +HS+GLMWW              R+  W+V+ DL
Sbjct: 142 LPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDL 201

Query: 437 FFYRDPEESEKDEQ 478
           +FYRDPEE EK+EQ
Sbjct: 202 YFYRDPEEIEKEEQ 215


>BC071968-1|AAH71968.1|  295|Homo sapiens ribosomal protein SA
           protein.
          Length = 295

 Score =  145 bits (351), Expect = 8e-35
 Identities = 71/84 (84%), Positives = 75/84 (89%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL+LAARA+VAIENPADV VISSR  GQRAVLKFAA TGATPIAGRFTPG FTNQIQAAF
Sbjct: 57  KLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAF 116

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
           REPRLL+V DP   HQP+TEASYV
Sbjct: 117 REPRLLVVTDPRADHQPLTEASYV 140



 Score =  101 bits (243), Expect = 1e-21
 Identities = 42/74 (56%), Positives = 51/74 (68%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           +P IA CNTDSPL +VDIAIPCN K +HS+GLMWW              R+  W+V+ DL
Sbjct: 142 LPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDL 201

Query: 437 FFYRDPEESEKDEQ 478
           +FYRDPEE EK+EQ
Sbjct: 202 YFYRDPEEIEKEEQ 215


>BC071693-1|AAH71693.1|  295|Homo sapiens ribosomal protein SA
           protein.
          Length = 295

 Score =  145 bits (351), Expect = 8e-35
 Identities = 71/84 (84%), Positives = 75/84 (89%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL+LAARA+VAIENPADV VISSR  GQRAVLKFAA TGATPIAGRFTPG FTNQIQAAF
Sbjct: 57  KLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAF 116

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
           REPRLL+V DP   HQP+TEASYV
Sbjct: 117 REPRLLVVTDPRADHQPLTEASYV 140



 Score =  101 bits (243), Expect = 1e-21
 Identities = 42/74 (56%), Positives = 51/74 (68%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           +P IA CNTDSPL +VDIAIPCN K +HS+GLMWW              R+  W+V+ DL
Sbjct: 142 LPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDL 201

Query: 437 FFYRDPEESEKDEQ 478
           +FYRDPEE EK+EQ
Sbjct: 202 YFYRDPEEIEKEEQ 215


>BC068062-1|AAH68062.1|  295|Homo sapiens ribosomal protein SA
           protein.
          Length = 295

 Score =  145 bits (351), Expect = 8e-35
 Identities = 71/84 (84%), Positives = 75/84 (89%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL+LAARA+VAIENPADV VISSR  GQRAVLKFAA TGATPIAGRFTPG FTNQIQAAF
Sbjct: 57  KLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAF 116

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
           REPRLL+V DP   HQP+TEASYV
Sbjct: 117 REPRLLVVTDPRADHQPLTEASYV 140



 Score =  101 bits (243), Expect = 1e-21
 Identities = 42/74 (56%), Positives = 51/74 (68%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           +P IA CNTDSPL +VDIAIPCN K +HS+GLMWW              R+  W+V+ DL
Sbjct: 142 LPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDL 201

Query: 437 FFYRDPEESEKDEQ 478
           +FYRDPEE EK+EQ
Sbjct: 202 YFYRDPEEIEKEEQ 215


>BC066941-1|AAH66941.1|  295|Homo sapiens ribosomal protein SA
           protein.
          Length = 295

 Score =  145 bits (351), Expect = 8e-35
 Identities = 71/84 (84%), Positives = 75/84 (89%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL+LAARA+VAIENPADV VISSR  GQRAVLKFAA TGATPIAGRFTPG FTNQIQAAF
Sbjct: 57  KLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAF 116

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
           REPRLL+V DP   HQP+TEASYV
Sbjct: 117 REPRLLVVTDPRADHQPLTEASYV 140



 Score = 99.1 bits (236), Expect = 7e-21
 Identities = 41/74 (55%), Positives = 50/74 (67%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           +P IA CNTDSPL +VDIAIPCN K +HS+GLMWW              R+  W+V+ DL
Sbjct: 142 LPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDL 201

Query: 437 FFYRDPEESEKDEQ 478
           +FYRDPEE EK+ Q
Sbjct: 202 YFYRDPEEIEKEGQ 215


>BC062714-1|AAH62714.1|  295|Homo sapiens ribosomal protein SA
           protein.
          Length = 295

 Score =  145 bits (351), Expect = 8e-35
 Identities = 71/84 (84%), Positives = 75/84 (89%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL+LAARA+VAIENPADV VISSR  GQRAVLKFAA TGATPIAGRFTPG FTNQIQAAF
Sbjct: 57  KLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAF 116

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
           REPRLL+V DP   HQP+TEASYV
Sbjct: 117 REPRLLVVTDPRADHQPLTEASYV 140



 Score =  101 bits (243), Expect = 1e-21
 Identities = 42/74 (56%), Positives = 51/74 (68%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           +P IA CNTDSPL +VDIAIPCN K +HS+GLMWW              R+  W+V+ DL
Sbjct: 142 LPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDL 201

Query: 437 FFYRDPEESEKDEQ 478
           +FYRDPEE EK+EQ
Sbjct: 202 YFYRDPEEIEKEEQ 215


>BC053370-1|AAH53370.1|  295|Homo sapiens ribosomal protein SA
           protein.
          Length = 295

 Score =  145 bits (351), Expect = 8e-35
 Identities = 71/84 (84%), Positives = 75/84 (89%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL+LAARA+VAIENPADV VISSR  GQRAVLKFAA TGATPIAGRFTPG FTNQIQAAF
Sbjct: 57  KLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAF 116

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
           REPRLL+V DP   HQP+TEASYV
Sbjct: 117 REPRLLVVTDPRADHQPLTEASYV 140



 Score =  101 bits (243), Expect = 1e-21
 Identities = 42/74 (56%), Positives = 51/74 (68%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           +P IA CNTDSPL +VDIAIPCN K +HS+GLMWW              R+  W+V+ DL
Sbjct: 142 LPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDL 201

Query: 437 FFYRDPEESEKDEQ 478
           +FYRDPEE EK+EQ
Sbjct: 202 YFYRDPEEIEKEEQ 215


>BC034537-1|AAH34537.1|  295|Homo sapiens ribosomal protein SA
           protein.
          Length = 295

 Score =  145 bits (351), Expect = 8e-35
 Identities = 71/84 (84%), Positives = 75/84 (89%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL+LAARA+VAIENPADV VISSR  GQRAVLKFAA TGATPIAGRFTPG FTNQIQAAF
Sbjct: 57  KLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAF 116

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
           REPRLL+V DP   HQP+TEASYV
Sbjct: 117 REPRLLVVTDPRADHQPLTEASYV 140



 Score =  101 bits (243), Expect = 1e-21
 Identities = 42/74 (56%), Positives = 51/74 (68%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           +P IA CNTDSPL +VDIAIPCN K +HS+GLMWW              R+  W+V+ DL
Sbjct: 142 LPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDL 201

Query: 437 FFYRDPEESEKDEQ 478
           +FYRDPEE EK+EQ
Sbjct: 202 YFYRDPEEIEKEEQ 215


>BC013827-1|AAH13827.1|  295|Homo sapiens ribosomal protein SA
           protein.
          Length = 295

 Score =  145 bits (351), Expect = 8e-35
 Identities = 71/84 (84%), Positives = 75/84 (89%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL+LAARA+VAIENPADV VISSR  GQRAVLKFAA TGATPIAGRFTPG FTNQIQAAF
Sbjct: 57  KLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAF 116

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
           REPRLL+V DP   HQP+TEASYV
Sbjct: 117 REPRLLVVTDPRADHQPLTEASYV 140



 Score =  101 bits (243), Expect = 1e-21
 Identities = 42/74 (56%), Positives = 51/74 (68%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           +P IA CNTDSPL +VDIAIPCN K +HS+GLMWW              R+  W+V+ DL
Sbjct: 142 LPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDL 201

Query: 437 FFYRDPEESEKDEQ 478
           +FYRDPEE EK+EQ
Sbjct: 202 YFYRDPEEIEKEEQ 215


>BC010418-1|AAH10418.1|  295|Homo sapiens ribosomal protein SA
           protein.
          Length = 295

 Score =  145 bits (351), Expect = 8e-35
 Identities = 71/84 (84%), Positives = 75/84 (89%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL+LAARA+VAIENPADV VISSR  GQRAVLKFAA TGATPIAGRFTPG FTNQIQAAF
Sbjct: 57  KLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAF 116

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
           REPRLL+V DP   HQP+TEASYV
Sbjct: 117 REPRLLVVTDPRADHQPLTEASYV 140



 Score =  101 bits (243), Expect = 1e-21
 Identities = 42/74 (56%), Positives = 51/74 (68%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           +P IA CNTDSPL +VDIAIPCN K +HS+GLMWW              R+  W+V+ DL
Sbjct: 142 LPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDL 201

Query: 437 FFYRDPEESEKDEQ 478
           +FYRDPEE EK+EQ
Sbjct: 202 YFYRDPEEIEKEEQ 215


>BC008867-1|AAH08867.1|  295|Homo sapiens ribosomal protein SA
           protein.
          Length = 295

 Score =  145 bits (351), Expect = 8e-35
 Identities = 71/84 (84%), Positives = 75/84 (89%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL+LAARA+VAIENPADV VISSR  GQRAVLKFAA TGATPIAGRFTPG FTNQIQAAF
Sbjct: 57  KLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAF 116

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
           REPRLL+V DP   HQP+TEASYV
Sbjct: 117 REPRLLVVTDPRADHQPLTEASYV 140



 Score =  101 bits (243), Expect = 1e-21
 Identities = 42/74 (56%), Positives = 51/74 (68%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           +P IA CNTDSPL +VDIAIPCN K +HS+GLMWW              R+  W+V+ DL
Sbjct: 142 LPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDL 201

Query: 437 FFYRDPEESEKDEQ 478
           +FYRDPEE EK+EQ
Sbjct: 202 YFYRDPEEIEKEEQ 215


>BC005391-1|AAH05391.1|  295|Homo sapiens ribosomal protein SA
           protein.
          Length = 295

 Score =  145 bits (351), Expect = 8e-35
 Identities = 71/84 (84%), Positives = 75/84 (89%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL+LAARA+VAIENPADV VISSR  GQRAVLKFAA TGATPIAGRFTPG FTNQIQAAF
Sbjct: 57  KLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAF 116

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
           REPRLL+V DP   HQP+TEASYV
Sbjct: 117 REPRLLVVTDPRADHQPLTEASYV 140



 Score =  101 bits (243), Expect = 1e-21
 Identities = 42/74 (56%), Positives = 51/74 (68%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           +P IA CNTDSPL +VDIAIPCN K +HS+GLMWW              R+  W+V+ DL
Sbjct: 142 LPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDL 201

Query: 437 FFYRDPEESEKDEQ 478
           +FYRDPEE EK+EQ
Sbjct: 202 YFYRDPEEIEKEEQ 215


>AF503367-1|AAM33304.1|  295|Homo sapiens multidrug
           resistance-associated protein MGr1-Ag protein.
          Length = 295

 Score =  145 bits (351), Expect = 8e-35
 Identities = 71/84 (84%), Positives = 75/84 (89%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL+LAARA+VAIENPADV VISSR  GQRAVLKFAA TGATPIAGRFTPG FTNQIQAAF
Sbjct: 57  KLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAF 116

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
           REPRLL+V DP   HQP+TEASYV
Sbjct: 117 REPRLLVVTDPRADHQPLTEASYV 140



 Score =  101 bits (243), Expect = 1e-21
 Identities = 42/74 (56%), Positives = 51/74 (68%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           +P IA CNTDSPL +VDIAIPCN K +HS+GLMWW              R+  W+V+ DL
Sbjct: 142 LPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDL 201

Query: 437 FFYRDPEESEKDEQ 478
           +FYRDPEE EK+EQ
Sbjct: 202 YFYRDPEEIEKEEQ 215


>X61156-1|CAA43469.1|  285|Homo sapiens laminin-binding protein
           protein.
          Length = 285

 Score =  144 bits (348), Expect = 2e-34
 Identities = 70/84 (83%), Positives = 75/84 (89%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL++AARA+VAIENPADV VISSR  GQRAVLKFAA TGATPIAGRFTPG FTNQIQAAF
Sbjct: 47  KLLVAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAF 106

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
           REPRLL+V DP   HQP+TEASYV
Sbjct: 107 REPRLLVVTDPRADHQPLTEASYV 130



 Score =  101 bits (243), Expect = 1e-21
 Identities = 42/74 (56%), Positives = 51/74 (68%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           +P IA CNTDSPL +VDIAIPCN K +HS+GLMWW              R+  W+V+ DL
Sbjct: 132 LPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDL 191

Query: 437 FFYRDPEESEKDEQ 478
           +FYRDPEE EK+EQ
Sbjct: 192 YFYRDPEEIEKEEQ 205


>BC070263-1|AAH70263.1|  295|Homo sapiens ribosomal protein SA
           protein.
          Length = 295

 Score =  143 bits (347), Expect = 3e-34
 Identities = 70/84 (83%), Positives = 75/84 (89%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL+LAARA+VAIENPADV VISSR  GQRAVLKFAA TGATPIAGRFTPG FTNQIQAAF
Sbjct: 57  KLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAF 116

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
           REPRLL+V DP   HQP++EASYV
Sbjct: 117 REPRLLVVTDPRADHQPLSEASYV 140



 Score =  101 bits (243), Expect = 1e-21
 Identities = 42/74 (56%), Positives = 51/74 (68%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           +P IA CNTDSPL +VDIAIPCN K +HS+GLMWW              R+  W+V+ DL
Sbjct: 142 LPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDL 201

Query: 437 FFYRDPEESEKDEQ 478
           +FYRDPEE EK+EQ
Sbjct: 202 YFYRDPEEIEKEEQ 215


>BC050688-1|AAH50688.1|  295|Homo sapiens ribosomal protein SA
           protein.
          Length = 295

 Score =  143 bits (347), Expect = 3e-34
 Identities = 70/84 (83%), Positives = 74/84 (88%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL+LAARA+VAIENPADV VISSR  GQRAVLKFAA TGATPIAGRFTPG FTNQIQA F
Sbjct: 57  KLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQATF 116

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
           REPRLL+V DP   HQP+TEASYV
Sbjct: 117 REPRLLVVTDPRADHQPLTEASYV 140



 Score =  101 bits (243), Expect = 1e-21
 Identities = 42/74 (56%), Positives = 51/74 (68%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           +P IA CNTDSPL +VDIAIPCN K +HS+GLMWW              R+  W+V+ DL
Sbjct: 142 LPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDL 201

Query: 437 FFYRDPEESEKDEQ 478
           +FYRDPEE EK+EQ
Sbjct: 202 YFYRDPEEIEKEEQ 215


>AF284768-1|AAK69721.1|  295|Homo sapiens laminin receptor-like
           protein LAMRL5 protein.
          Length = 295

 Score =  143 bits (346), Expect = 3e-34
 Identities = 70/84 (83%), Positives = 74/84 (88%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL+L ARA+VAIENPADV VISSR  GQRAVLKFAA TGATPIAGRFTPG FTNQIQAAF
Sbjct: 57  KLLLTARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAF 116

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
           REPRLL+V DP   HQP+TEASYV
Sbjct: 117 REPRLLVVSDPRADHQPLTEASYV 140



 Score =  101 bits (243), Expect = 1e-21
 Identities = 42/74 (56%), Positives = 51/74 (68%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           +P IA CNTDSPL +VDIAIPCN K +HS+GLMWW              R+  W+V+ DL
Sbjct: 142 LPTIALCNTDSPLHYVDIAIPCNNKGTHSVGLMWWMLAREVLRMRGTISREHPWEVMPDL 201

Query: 437 FFYRDPEESEKDEQ 478
           +FYRDPEE EK+EQ
Sbjct: 202 YFYRDPEEIEKEEQ 215


>BC071971-1|AAH71971.1|  295|Homo sapiens ribosomal protein SA
           pseudogene protein.
          Length = 295

 Score =  142 bits (343), Expect = 8e-34
 Identities = 70/84 (83%), Positives = 74/84 (88%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL+LAARA+VAIENPADV VISSR  GQRAVLKFAA TGATPIAGRFTPG FTNQIQAAF
Sbjct: 57  KLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAF 116

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
            EPRLL+V DP   HQP+TEASYV
Sbjct: 117 WEPRLLVVTDPRADHQPLTEASYV 140



 Score =  101 bits (243), Expect = 1e-21
 Identities = 42/74 (56%), Positives = 51/74 (68%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           +P IA CNTDSPL +VDIAIPCN K +HS+GLMWW              R+  W+V+ DL
Sbjct: 142 LPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDL 201

Query: 437 FFYRDPEESEKDEQ 478
           +FYRDPEE EK+EQ
Sbjct: 202 YFYRDPEEIEKEEQ 215


>X15005-1|CAA33112.1|  300|Homo sapiens protein ( Human mRNA for
           potential laminin-binding protein (nem/1cHD4). ).
          Length = 300

 Score =  137 bits (332), Expect = 2e-32
 Identities = 71/89 (79%), Positives = 75/89 (84%), Gaps = 5/89 (5%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQ-----RAVLKFAAHTGATPIAGRFTPGAFTNQ 167
           KL+LAARA+VAIENPADV VISSR  GQ     RAVLKFAA TGATPIAGRFTPG FTNQ
Sbjct: 57  KLLLAARAIVAIENPADVSVISSRNTGQVCGTVRAVLKFAAATGATPIAGRFTPGTFTNQ 116

Query: 168 IQAAFREPRLLIVLDPAQXHQPITEASYV 254
           IQAAFREPRLL+V DP   HQP+TEASYV
Sbjct: 117 IQAAFREPRLLVVTDPRADHQPLTEASYV 145



 Score =  101 bits (243), Expect = 1e-21
 Identities = 42/74 (56%), Positives = 51/74 (68%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           +P IA CNTDSPL +VDIAIPCN K +HS+GLMWW              R+  W+V+ DL
Sbjct: 147 LPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDL 206

Query: 437 FFYRDPEESEKDEQ 478
           +FYRDPEE EK+EQ
Sbjct: 207 YFYRDPEEIEKEEQ 220


>U36484-1|AAC50313.1|  125|Homo sapiens laminin-binding protein
           protein.
          Length = 125

 Score =  103 bits (246), Expect = 4e-22
 Identities = 48/56 (85%), Positives = 50/56 (89%)
 Frame = +3

Query: 87  RAVLKFAAHTGATPIAGRFTPGAFTNQIQAAFREPRLLIVLDPAQXHQPITEASYV 254
           RAVLKFAA TGATPIAGRFTPG FTNQIQAAFREPRLL+V DP   HQP+TEASYV
Sbjct: 1   RAVLKFAAATGATPIAGRFTPGTFTNQIQAAFREPRLLVVTDPRADHQPLTEASYV 56



 Score = 93.9 bits (223), Expect = 3e-19
 Identities = 38/68 (55%), Positives = 46/68 (67%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           +P IA CNTDSPL +VDIAIPCN K +HS+GLMWW              R+  W+V+ DL
Sbjct: 58  LPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDL 117

Query: 437 FFYRDPEE 460
           +FYRDPEE
Sbjct: 118 YFYRDPEE 125


>M14199-1|AAA36165.1|  135|Homo sapiens protein ( Human laminin
           receptor (2H5 epitope) mRNA, 5' end. ).
          Length = 135

 Score = 70.9 bits (166), Expect = 2e-12
 Identities = 28/55 (50%), Positives = 35/55 (63%)
 Frame = +2

Query: 314 IPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDLFFYRDPEESEKDEQ 478
           IPCN K +HS+GLMWW              R+  W+V+ DL+FYRDPEE EK+EQ
Sbjct: 1   IPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEEIEKEEQ 55


>BC107865-1|AAI07866.1|  197|Homo sapiens LOC204010 protein protein.
          Length = 197

 Score = 42.7 bits (96), Expect = 7e-04
 Identities = 27/64 (42%), Positives = 31/64 (48%)
 Frame = +3

Query: 93  VLKFAAHTGATPIAGRFTPGAFTNQIQAAFREPRLLIVLDPAQXHQPITEASYVXFL*LL 272
           +LKFAA TGATPIAG FTPG F  + +        L  L P            +  L LL
Sbjct: 1   MLKFAAATGATPIAGHFTPGTFLTRSRQPTGSHGFLWFLTPGLTTSLSQRHLVLTHLPLL 60

Query: 273 XATQ 284
            ATQ
Sbjct: 61  YATQ 64



 Score = 39.5 bits (88), Expect = 0.006
 Identities = 14/21 (66%), Positives = 20/21 (95%)
 Frame = +2

Query: 416 WDVVVDLFFYRDPEESEKDEQ 478
           W+V+ +L+FYRDPEE+EK+EQ
Sbjct: 108 WEVMSNLYFYRDPEETEKEEQ 128


>BC058822-1|AAH58822.1|  197|Homo sapiens LOC204010 protein protein.
          Length = 197

 Score = 42.7 bits (96), Expect = 7e-04
 Identities = 27/64 (42%), Positives = 31/64 (48%)
 Frame = +3

Query: 93  VLKFAAHTGATPIAGRFTPGAFTNQIQAAFREPRLLIVLDPAQXHQPITEASYVXFL*LL 272
           +LKFAA TGATPIAG FTPG F  + +        L  L P            +  L LL
Sbjct: 1   MLKFAAATGATPIAGHFTPGTFLTRSRQPTGSHGFLWFLTPGLTTSLSQRHLVLTHLPLL 60

Query: 273 XATQ 284
            ATQ
Sbjct: 61  YATQ 64



 Score = 39.5 bits (88), Expect = 0.006
 Identities = 14/21 (66%), Positives = 20/21 (95%)
 Frame = +2

Query: 416 WDVVVDLFFYRDPEESEKDEQ 478
           W+V+ +L+FYRDPEE+EK+EQ
Sbjct: 108 WEVMSNLYFYRDPEETEKEEQ 128


>AJ566387-1|CAD97467.1|  251|Homo sapiens keratin associated protein
           KAP10.10 protein.
          Length = 251

 Score = 31.5 bits (68), Expect = 1.6
 Identities = 25/79 (31%), Positives = 31/79 (39%), Gaps = 4/79 (5%)
 Frame = +2

Query: 5   TCSGCS--CCR-SHREPR*CVRHLITXLRSACCTEVCRXHRCYA-YCGTFHTRCFY*PDP 172
           TCS  S  CC+ S  +P  C     +  + ACC  VC    CY   C    T C      
Sbjct: 118 TCSESSPSCCQQSSCQPTCCTS---SPCQQACCVPVCSKSVCYVPVCSGASTSCC--QQS 172

Query: 173 SCIP*TSSLDCIGPCTXPS 229
           SC P   +  C  P +  S
Sbjct: 173 SCQPACCTASCCRPSSSVS 191


>AB076358-1|BAD01545.1|  251|Homo sapiens keratin associated protein
           protein.
          Length = 251

 Score = 31.5 bits (68), Expect = 1.6
 Identities = 25/79 (31%), Positives = 31/79 (39%), Gaps = 4/79 (5%)
 Frame = +2

Query: 5   TCSGCS--CCR-SHREPR*CVRHLITXLRSACCTEVCRXHRCYA-YCGTFHTRCFY*PDP 172
           TCS  S  CC+ S  +P  C     +  + ACC  VC    CY   C    T C      
Sbjct: 118 TCSESSPSCCQQSSCQPTCCTS---SPCQQACCVPVCSKSVCYVPVCSGASTSCC--QQS 172

Query: 173 SCIP*TSSLDCIGPCTXPS 229
           SC P   +  C  P +  S
Sbjct: 173 SCQPACCTASCCRPSSSVS 191


>BC110619-1|AAI10620.1|  174|Homo sapiens keratin associated protein
           9-2 protein.
          Length = 174

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 24/76 (31%), Positives = 29/76 (38%), Gaps = 1/76 (1%)
 Frame = +2

Query: 5   TCSGCSCCRSHREPR*CVRHLITXLRSACCTEVCRXHRCYAYCGTFHTRCFY*PDPSCIP 184
           TCS  SCC    +P  CV        S+CC   CR   C   C    T C     P+C+ 
Sbjct: 31  TCSSTSCC----QPACCV--------SSCCQPCCRPTSCQNTC--CRTTCC---QPTCVT 73

Query: 185 *TSSLDCIG-PCTXPS 229
                 C   PC  P+
Sbjct: 74  SCCQPSCCSTPCCQPT 89


>AJ406946-1|CAC27585.1|  174|Homo sapiens keratin associated protein
           9.2 protein.
          Length = 174

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 24/76 (31%), Positives = 29/76 (38%), Gaps = 1/76 (1%)
 Frame = +2

Query: 5   TCSGCSCCRSHREPR*CVRHLITXLRSACCTEVCRXHRCYAYCGTFHTRCFY*PDPSCIP 184
           TCS  SCC    +P  CV        S+CC   CR   C   C    T C     P+C+ 
Sbjct: 31  TCSSTSCC----QPACCV--------SSCCQPCCRPTSCQNTC--CRTTCC---QPTCVT 73

Query: 185 *TSSLDCIG-PCTXPS 229
                 C   PC  P+
Sbjct: 74  SCCQPSCCSTPCCQPT 89


>AK090647-1|BAC03496.1|  353|Homo sapiens   protein.
          Length = 353

 Score = 30.7 bits (66), Expect = 2.8
 Identities = 27/93 (29%), Positives = 35/93 (37%), Gaps = 6/93 (6%)
 Frame = +2

Query: 17  CSCCRSHREPR*CVRHLITXLRSACCTEVCRXHRCYAYCGTFHTRC-FY*PDPSC----- 178
           CS C S R    C  H      S CC+  C  H C  +C    + C F    P C     
Sbjct: 102 CSPCCSLRCSPCCSLHC-----SPCCSLQCSLH-CSPHCSLHCSPCCFLHYSPCCSLHFS 155

Query: 179 IP*TSSLDCIGPCTXPSTHY*SFICXIPVIAXC 277
           +  +  + C  PCT P     +  C +P  A C
Sbjct: 156 LCRSPCIPCTVPCTVPHAVPCNAPCTVPRTAPC 188


>BC103846-1|AAI03847.1|  127|Homo sapiens keratin associated protein
           4-10 protein.
          Length = 127

 Score = 29.9 bits (64), Expect = 4.9
 Identities = 15/44 (34%), Positives = 18/44 (40%)
 Frame = +2

Query: 5   TCSGCSCCRSHREPR*CVRHLITXLRSACCTEVCRXHRCYAYCG 136
           +C   SCCR       C +   T  R +CC  VC    C   CG
Sbjct: 38  SCVVSSCCRPSCSQTTCCQ--TTCCRPSCCRPVCCQTTCRPSCG 79


>BC103845-1|AAI03846.1|  127|Homo sapiens keratin associated protein
           4-10 protein.
          Length = 127

 Score = 29.9 bits (64), Expect = 4.9
 Identities = 15/44 (34%), Positives = 18/44 (40%)
 Frame = +2

Query: 5   TCSGCSCCRSHREPR*CVRHLITXLRSACCTEVCRXHRCYAYCG 136
           +C   SCCR       C +   T  R +CC  VC    C   CG
Sbjct: 38  SCVVSSCCRPSCSQTTCCQ--TTCCRPSCCRPVCCQTTCRPSCG 79


>AJ406942-1|CAC27581.1|  127|Homo sapiens keratin associated protein
           4.10 protein.
          Length = 127

 Score = 29.9 bits (64), Expect = 4.9
 Identities = 15/44 (34%), Positives = 18/44 (40%)
 Frame = +2

Query: 5   TCSGCSCCRSHREPR*CVRHLITXLRSACCTEVCRXHRCYAYCG 136
           +C   SCCR       C +   T  R +CC  VC    C   CG
Sbjct: 38  SCVVSSCCRPSCSQTTCCQ--TTCCRPSCCRPVCCQTTCRPSCG 79


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 71,477,078
Number of Sequences: 237096
Number of extensions: 1442186
Number of successful extensions: 2258
Number of sequences better than 10.0: 38
Number of HSP's better than 10.0 without gapping: 2120
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2257
length of database: 76,859,062
effective HSP length: 84
effective length of database: 56,942,998
effective search space used: 4327667848
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -