SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30125.Seq
         (682 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ496105-1|ABF47094.1|  223|Homo sapiens progesterone receptor m...   115   1e-25
BC092478-1|AAH92478.1|  223|Homo sapiens progesterone receptor m...   115   1e-25
BC016692-1|AAH16692.1|  223|Homo sapiens progesterone receptor m...   115   1e-25
AJ002030-1|CAA05152.1|  223|Homo sapiens progresterone binding p...   115   1e-25
Y12711-1|CAA73248.1|  195|Homo sapiens putative progesterone bin...   105   1e-22
DQ496104-1|ABF47093.1|  195|Homo sapiens progesterone receptor m...   105   1e-22
CR456993-1|CAG33274.1|  195|Homo sapiens PGRMC1 protein.              105   1e-22
BC034238-1|AAH34238.1|  195|Homo sapiens progesterone receptor m...   105   1e-22
BC008823-1|AAH08823.1|  172|Homo sapiens neuron derived neurotro...    66   1e-10
AY762102-1|AAX07829.1|  172|Homo sapiens cell growth-inhibiting ...    66   1e-10
AF173937-1|AAD51419.1|  172|Homo sapiens secreted protein of unk...    66   1e-10
AB126219-1|BAD72063.1|  172|Homo sapiens neudesin protein protein.     66   1e-10
AK223135-1|BAD96855.1|  172|Homo sapiens SCIRP10-related protein...    64   3e-10
BC051697-1|AAH51697.1|  264|Homo sapiens cytochrome b5 domain co...    56   1e-07
BC020263-1|AAH20263.1|  264|Homo sapiens cytochrome b5 domain co...    56   1e-07
AK172844-1|BAD18808.1|  264|Homo sapiens protein ( Homo sapiens ...    56   1e-07
AJ249131-1|CAB65109.1|  109|Homo sapiens progesterone membrane b...    53   1e-06
BX640912-1|CAE45953.1|  613|Homo sapiens hypothetical protein pr...    32   2.2  
BC110389-1|AAI10390.1|  607|Homo sapiens HNRPR protein protein.        32   2.2  
BC001449-1|AAH01449.1|  636|Homo sapiens HNRPR protein protein.        32   2.2  
AL109936-4|CAI19027.1|  636|Homo sapiens heterogeneous nuclear r...    32   2.2  
AL109936-3|CAI19026.1|  633|Homo sapiens heterogeneous nuclear r...    32   2.2  
AF000364-1|AAC39540.1|  633|Homo sapiens heterogeneous nuclear r...    32   2.2  
M94131-1|AAA59163.1| 1270|Homo sapiens mucin protein.                  31   3.8  
M74027-1|AAA59875.1|  573|Homo sapiens mucin protein.                  31   3.8  
L21998-1|AAB95295.1| 5179|Homo sapiens mucin protein.                  31   3.8  

>DQ496105-1|ABF47094.1|  223|Homo sapiens progesterone receptor
           membrane component 2 protein.
          Length = 223

 Score =  115 bits (277), Expect = 1e-25
 Identities = 56/103 (54%), Positives = 75/103 (72%), Gaps = 2/103 (1%)
 Frame = +3

Query: 267 ELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSV--TAP 440
           +LRQYDG++   R+L+AVNG +FDVT+G++FYGP GPY +F GRDA+RGLATF +   A 
Sbjct: 107 QLRQYDGSRNP-RILLAVNGKVFDVTKGSKFYGPAGPYGIFAGRDASRGLATFCLDKDAL 165

Query: 441 EKDYDDLSDLNSMEMESVREWEDNLERIMIWSVDF*GLVKNPG 569
             +YDDLSDLN+++MESVREWE   +       D+ G +  PG
Sbjct: 166 RDEYDDLSDLNAVQMESVREWEMQFKE----KYDYVGRLLKPG 204



 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 19/26 (73%), Positives = 22/26 (84%)
 Frame = +2

Query: 509 QFRENYDLVGRLLRPGEEPRNYSDEE 586
           QF+E YD VGRLL+PGEEP  Y+DEE
Sbjct: 189 QFKEKYDYVGRLLKPGEEPSEYTDEE 214


>BC092478-1|AAH92478.1|  223|Homo sapiens progesterone receptor
           membrane component 2 protein.
          Length = 223

 Score =  115 bits (277), Expect = 1e-25
 Identities = 56/103 (54%), Positives = 75/103 (72%), Gaps = 2/103 (1%)
 Frame = +3

Query: 267 ELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSV--TAP 440
           +LRQYDG++   R+L+AVNG +FDVT+G++FYGP GPY +F GRDA+RGLATF +   A 
Sbjct: 107 QLRQYDGSRNP-RILLAVNGKVFDVTKGSKFYGPAGPYGIFAGRDASRGLATFCLDKDAL 165

Query: 441 EKDYDDLSDLNSMEMESVREWEDNLERIMIWSVDF*GLVKNPG 569
             +YDDLSDLN+++MESVREWE   +       D+ G +  PG
Sbjct: 166 RDEYDDLSDLNAVQMESVREWEMQFKE----KYDYVGRLLKPG 204



 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 19/26 (73%), Positives = 22/26 (84%)
 Frame = +2

Query: 509 QFRENYDLVGRLLRPGEEPRNYSDEE 586
           QF+E YD VGRLL+PGEEP  Y+DEE
Sbjct: 189 QFKEKYDYVGRLLKPGEEPSEYTDEE 214


>BC016692-1|AAH16692.1|  223|Homo sapiens progesterone receptor
           membrane component 2 protein.
          Length = 223

 Score =  115 bits (277), Expect = 1e-25
 Identities = 56/103 (54%), Positives = 75/103 (72%), Gaps = 2/103 (1%)
 Frame = +3

Query: 267 ELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSV--TAP 440
           +LRQYDG++   R+L+AVNG +FDVT+G++FYGP GPY +F GRDA+RGLATF +   A 
Sbjct: 107 QLRQYDGSRNP-RILLAVNGKVFDVTKGSKFYGPAGPYGIFAGRDASRGLATFCLDKDAL 165

Query: 441 EKDYDDLSDLNSMEMESVREWEDNLERIMIWSVDF*GLVKNPG 569
             +YDDLSDLN+++MESVREWE   +       D+ G +  PG
Sbjct: 166 RDEYDDLSDLNAVQMESVREWEMQFKE----KYDYVGRLLKPG 204



 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 19/26 (73%), Positives = 22/26 (84%)
 Frame = +2

Query: 509 QFRENYDLVGRLLRPGEEPRNYSDEE 586
           QF+E YD VGRLL+PGEEP  Y+DEE
Sbjct: 189 QFKEKYDYVGRLLKPGEEPSEYTDEE 214


>AJ002030-1|CAA05152.1|  223|Homo sapiens progresterone binding
           protein protein.
          Length = 223

 Score =  115 bits (277), Expect = 1e-25
 Identities = 56/103 (54%), Positives = 75/103 (72%), Gaps = 2/103 (1%)
 Frame = +3

Query: 267 ELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSV--TAP 440
           +LRQYDG++   R+L+AVNG +FDVT+G++FYGP GPY +F GRDA+RGLATF +   A 
Sbjct: 107 QLRQYDGSRNP-RILLAVNGKVFDVTKGSKFYGPAGPYGIFAGRDASRGLATFCLDKDAL 165

Query: 441 EKDYDDLSDLNSMEMESVREWEDNLERIMIWSVDF*GLVKNPG 569
             +YDDLSDLN+++MESVREWE   +       D+ G +  PG
Sbjct: 166 RDEYDDLSDLNAVQMESVREWEMQFKE----KYDYVGRLLKPG 204



 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 19/26 (73%), Positives = 22/26 (84%)
 Frame = +2

Query: 509 QFRENYDLVGRLLRPGEEPRNYSDEE 586
           QF+E YD VGRLL+PGEEP  Y+DEE
Sbjct: 189 QFKEKYDYVGRLLKPGEEPSEYTDEE 214


>Y12711-1|CAA73248.1|  195|Homo sapiens putative progesterone
           binding protein protein.
          Length = 195

 Score =  105 bits (253), Expect = 1e-22
 Identities = 48/85 (56%), Positives = 65/85 (76%), Gaps = 2/85 (2%)
 Frame = +3

Query: 258 TAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSV-- 431
           T  ELR++DG Q+  R+LMA+NG +FDVT+G +FYGP GPY VF GRDA+RGLATF +  
Sbjct: 74  TPAELRRFDGVQDP-RILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDK 132

Query: 432 TAPEKDYDDLSDLNSMEMESVREWE 506
            A + +YDDLSDL + + E++ +WE
Sbjct: 133 EALKDEYDDLSDLTAAQQETLSDWE 157



 Score = 40.7 bits (91), Expect = 0.005
 Identities = 22/38 (57%), Positives = 24/38 (63%)
 Frame = +2

Query: 509 QFRENYDLVGRLLRPGEEPRNYSDEEPEEADTSALPND 622
           QF   Y  VG+LL+ GEEP  YSDEE E  D SA  ND
Sbjct: 159 QFTFKYHHVGKLLKEGEEPTVYSDEE-EPKDESARKND 195


>DQ496104-1|ABF47093.1|  195|Homo sapiens progesterone receptor
           membrane component 1 protein.
          Length = 195

 Score =  105 bits (253), Expect = 1e-22
 Identities = 48/85 (56%), Positives = 65/85 (76%), Gaps = 2/85 (2%)
 Frame = +3

Query: 258 TAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSV-- 431
           T  ELR++DG Q+  R+LMA+NG +FDVT+G +FYGP GPY VF GRDA+RGLATF +  
Sbjct: 74  TPAELRRFDGVQDP-RILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDK 132

Query: 432 TAPEKDYDDLSDLNSMEMESVREWE 506
            A + +YDDLSDL + + E++ +WE
Sbjct: 133 EALKDEYDDLSDLTAAQQETLSDWE 157



 Score = 40.7 bits (91), Expect = 0.005
 Identities = 22/38 (57%), Positives = 24/38 (63%)
 Frame = +2

Query: 509 QFRENYDLVGRLLRPGEEPRNYSDEEPEEADTSALPND 622
           QF   Y  VG+LL+ GEEP  YSDEE E  D SA  ND
Sbjct: 159 QFTFKYHHVGKLLKEGEEPTVYSDEE-EPKDESARKND 195


>CR456993-1|CAG33274.1|  195|Homo sapiens PGRMC1 protein.
          Length = 195

 Score =  105 bits (253), Expect = 1e-22
 Identities = 48/85 (56%), Positives = 65/85 (76%), Gaps = 2/85 (2%)
 Frame = +3

Query: 258 TAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSV-- 431
           T  ELR++DG Q+  R+LMA+NG +FDVT+G +FYGP GPY VF GRDA+RGLATF +  
Sbjct: 74  TPAELRRFDGVQDP-RILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDK 132

Query: 432 TAPEKDYDDLSDLNSMEMESVREWE 506
            A + +YDDLSDL + + E++ +WE
Sbjct: 133 EALKDEYDDLSDLTAAQQETLSDWE 157



 Score = 40.7 bits (91), Expect = 0.005
 Identities = 22/38 (57%), Positives = 24/38 (63%)
 Frame = +2

Query: 509 QFRENYDLVGRLLRPGEEPRNYSDEEPEEADTSALPND 622
           QF   Y  VG+LL+ GEEP  YSDEE E  D SA  ND
Sbjct: 159 QFTFKYHHVGKLLKEGEEPTVYSDEE-EPKDESARKND 195


>BC034238-1|AAH34238.1|  195|Homo sapiens progesterone receptor
           membrane component 1 protein.
          Length = 195

 Score =  105 bits (253), Expect = 1e-22
 Identities = 48/85 (56%), Positives = 65/85 (76%), Gaps = 2/85 (2%)
 Frame = +3

Query: 258 TAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSV-- 431
           T  ELR++DG Q+  R+LMA+NG +FDVT+G +FYGP GPY VF GRDA+RGLATF +  
Sbjct: 74  TPAELRRFDGVQDP-RILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDK 132

Query: 432 TAPEKDYDDLSDLNSMEMESVREWE 506
            A + +YDDLSDL + + E++ +WE
Sbjct: 133 EALKDEYDDLSDLTAAQQETLSDWE 157



 Score = 40.7 bits (91), Expect = 0.005
 Identities = 22/38 (57%), Positives = 24/38 (63%)
 Frame = +2

Query: 509 QFRENYDLVGRLLRPGEEPRNYSDEEPEEADTSALPND 622
           QF   Y  VG+LL+ GEEP  YSDEE E  D SA  ND
Sbjct: 159 QFTFKYHHVGKLLKEGEEPTVYSDEE-EPKDESARKND 195


>BC008823-1|AAH08823.1|  172|Homo sapiens neuron derived
           neurotrophic factor protein.
          Length = 172

 Score = 66.1 bits (154), Expect = 1e-10
 Identities = 32/81 (39%), Positives = 48/81 (59%)
 Frame = +3

Query: 258 TAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVTA 437
           T  EL +Y G +E   + +AV G +FDVT G  FYG G PY    G+D+TRG+A  S+  
Sbjct: 48  TEEELARYGGEEEDQPIYLAVKGVVFDVTSGKEFYGRGAPYNALTGKDSTRGVAKMSLDP 107

Query: 438 PEKDYDDLSDLNSMEMESVRE 500
            +  + D + L + E+E++ E
Sbjct: 108 ADLTH-DTTGLTAKELEALDE 127


>AY762102-1|AAX07829.1|  172|Homo sapiens cell growth-inhibiting
           protein 47 protein.
          Length = 172

 Score = 66.1 bits (154), Expect = 1e-10
 Identities = 32/81 (39%), Positives = 48/81 (59%)
 Frame = +3

Query: 258 TAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVTA 437
           T  EL +Y G +E   + +AV G +FDVT G  FYG G PY    G+D+TRG+A  S+  
Sbjct: 48  TEEELARYGGEEEDQPIYLAVKGVVFDVTSGKEFYGRGAPYNALTGKDSTRGVAKMSLDP 107

Query: 438 PEKDYDDLSDLNSMEMESVRE 500
            +  + D + L + E+E++ E
Sbjct: 108 ADLTH-DTTGLTAKELEALDE 127


>AF173937-1|AAD51419.1|  172|Homo sapiens secreted protein of
           unknown function protein.
          Length = 172

 Score = 66.1 bits (154), Expect = 1e-10
 Identities = 32/81 (39%), Positives = 48/81 (59%)
 Frame = +3

Query: 258 TAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVTA 437
           T  EL +Y G +E   + +AV G +FDVT G  FYG G PY    G+D+TRG+A  S+  
Sbjct: 48  TEEELARYGGEEEDQPIYLAVKGVVFDVTSGKEFYGRGAPYNALTGKDSTRGVAKMSLDP 107

Query: 438 PEKDYDDLSDLNSMEMESVRE 500
            +  + D + L + E+E++ E
Sbjct: 108 ADLTH-DTTGLTAKELEALDE 127


>AB126219-1|BAD72063.1|  172|Homo sapiens neudesin protein protein.
          Length = 172

 Score = 66.1 bits (154), Expect = 1e-10
 Identities = 32/81 (39%), Positives = 48/81 (59%)
 Frame = +3

Query: 258 TAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVTA 437
           T  EL +Y G +E   + +AV G +FDVT G  FYG G PY    G+D+TRG+A  S+  
Sbjct: 48  TEEELARYGGEEEDQPIYLAVKGVVFDVTSGKEFYGRGAPYNALTGKDSTRGVAKMSLDP 107

Query: 438 PEKDYDDLSDLNSMEMESVRE 500
            +  + D + L + E+E++ E
Sbjct: 108 ADLTH-DTTGLTAKELEALDE 127


>AK223135-1|BAD96855.1|  172|Homo sapiens SCIRP10-related protein
           variant protein.
          Length = 172

 Score = 64.5 bits (150), Expect = 3e-10
 Identities = 31/81 (38%), Positives = 48/81 (59%)
 Frame = +3

Query: 258 TAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVTA 437
           T  EL +Y G +E   + +AV G +F+VT G  FYG G PY    G+D+TRG+A  S+  
Sbjct: 48  TEEELARYGGEEEDQPIYLAVKGVVFEVTSGKEFYGRGAPYNALTGKDSTRGVAKMSLDP 107

Query: 438 PEKDYDDLSDLNSMEMESVRE 500
            +  + D + L + E+E++ E
Sbjct: 108 ADLTH-DTTGLTAKELEALDE 127


>BC051697-1|AAH51697.1|  264|Homo sapiens cytochrome b5 domain
           containing 2 protein.
          Length = 264

 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 29/79 (36%), Positives = 44/79 (55%)
 Frame = +3

Query: 267 ELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVTAPEK 446
           EL +Y G      + +A+ G ++DV+ G R Y PG  Y+ F GRDA+R   T   +    
Sbjct: 42  ELSRYRGGPGDPGLYLALLGRVYDVSSGRRHYEPGSHYSGFAGRDASRAFVTGDCSEAGL 101

Query: 447 DYDDLSDLNSMEMESVREW 503
             DD+SDL++ EM ++  W
Sbjct: 102 -VDDVSDLSAAEMLTLHNW 119


>BC020263-1|AAH20263.1|  264|Homo sapiens cytochrome b5 domain
           containing 2 protein.
          Length = 264

 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 29/79 (36%), Positives = 44/79 (55%)
 Frame = +3

Query: 267 ELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVTAPEK 446
           EL +Y G      + +A+ G ++DV+ G R Y PG  Y+ F GRDA+R   T   +    
Sbjct: 42  ELSRYRGGPGDPGLYLALLGRVYDVSSGRRHYEPGSHYSGFAGRDASRAFVTGDCSEAGL 101

Query: 447 DYDDLSDLNSMEMESVREW 503
             DD+SDL++ EM ++  W
Sbjct: 102 -VDDVSDLSAAEMLTLHNW 119


>AK172844-1|BAD18808.1|  264|Homo sapiens protein ( Homo sapiens
           cDNA FLJ24005 fis, clone KAT01883. ).
          Length = 264

 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 29/79 (36%), Positives = 44/79 (55%)
 Frame = +3

Query: 267 ELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVTAPEK 446
           EL +Y G      + +A+ G ++DV+ G R Y PG  Y+ F GRDA+R   T   +    
Sbjct: 42  ELSRYRGGPGDPGLYLALLGRVYDVSSGRRHYEPGSHYSGFAGRDASRAFVTGDCSEAGL 101

Query: 447 DYDDLSDLNSMEMESVREW 503
             DD+SDL++ EM ++  W
Sbjct: 102 -VDDVSDLSAAEMLTLHNW 119


>AJ249131-1|CAB65109.1|  109|Homo sapiens progesterone membrane
           binding protein protein.
          Length = 109

 Score = 52.8 bits (121), Expect = 1e-06
 Identities = 22/37 (59%), Positives = 30/37 (81%)
 Frame = +3

Query: 258 TAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGP 368
           T  ELR++DG Q+  R+LMA+NG +FDVT+G +FYGP
Sbjct: 74  TPAELRRFDGVQDP-RILMAINGKVFDVTKGRKFYGP 109


>BX640912-1|CAE45953.1|  613|Homo sapiens hypothetical protein
           protein.
          Length = 613

 Score = 31.9 bits (69), Expect = 2.2
 Identities = 17/52 (32%), Positives = 23/52 (44%)
 Frame = +3

Query: 303 RVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVTAPEKDYDD 458
           + L+   G+  DVT G R YG   P +V+ G     G   F    P   Y+D
Sbjct: 105 KALLERTGYTLDVTTGQRKYGGPPPDSVYSGVQPGIGTEVFVGKIPRDLYED 156


>BC110389-1|AAI10390.1|  607|Homo sapiens HNRPR protein protein.
          Length = 607

 Score = 31.9 bits (69), Expect = 2.2
 Identities = 17/52 (32%), Positives = 23/52 (44%)
 Frame = +3

Query: 303 RVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVTAPEKDYDD 458
           + L+   G+  DVT G R YG   P +V+ G     G   F    P   Y+D
Sbjct: 102 KALLERTGYTLDVTTGQRKYGGPPPDSVYSGVQPGIGTEVFVGKIPRDLYED 153


>BC001449-1|AAH01449.1|  636|Homo sapiens HNRPR protein protein.
          Length = 636

 Score = 31.9 bits (69), Expect = 2.2
 Identities = 17/52 (32%), Positives = 23/52 (44%)
 Frame = +3

Query: 303 RVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVTAPEKDYDD 458
           + L+   G+  DVT G R YG   P +V+ G     G   F    P   Y+D
Sbjct: 128 KALLERTGYTLDVTTGQRKYGGPPPDSVYSGVQPGIGTEVFVGKIPRDLYED 179


>AL109936-4|CAI19027.1|  636|Homo sapiens heterogeneous nuclear
           ribonucleoprotein R protein.
          Length = 636

 Score = 31.9 bits (69), Expect = 2.2
 Identities = 17/52 (32%), Positives = 23/52 (44%)
 Frame = +3

Query: 303 RVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVTAPEKDYDD 458
           + L+   G+  DVT G R YG   P +V+ G     G   F    P   Y+D
Sbjct: 128 KALLERTGYTLDVTTGQRKYGGPPPDSVYSGVQPGIGTEVFVGKIPRDLYED 179


>AL109936-3|CAI19026.1|  633|Homo sapiens heterogeneous nuclear
           ribonucleoprotein R protein.
          Length = 633

 Score = 31.9 bits (69), Expect = 2.2
 Identities = 17/52 (32%), Positives = 23/52 (44%)
 Frame = +3

Query: 303 RVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVTAPEKDYDD 458
           + L+   G+  DVT G R YG   P +V+ G     G   F    P   Y+D
Sbjct: 128 KALLERTGYTLDVTTGQRKYGGPPPDSVYSGVQPGIGTEVFVGKIPRDLYED 179


>AF000364-1|AAC39540.1|  633|Homo sapiens heterogeneous nuclear
           ribonucleoprotein R protein.
          Length = 633

 Score = 31.9 bits (69), Expect = 2.2
 Identities = 17/52 (32%), Positives = 23/52 (44%)
 Frame = +3

Query: 303 RVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVTAPEKDYDD 458
           + L+   G+  DVT G R YG   P +V+ G     G   F    P   Y+D
Sbjct: 128 KALLERTGYTLDVTTGQRKYGGPPPDSVYSGVQPGIGTEVFVGKIPRDLYED 179


>M94131-1|AAA59163.1| 1270|Homo sapiens mucin protein.
          Length = 1270

 Score = 31.1 bits (67), Expect = 3.8
 Identities = 18/52 (34%), Positives = 22/52 (42%), Gaps = 1/52 (1%)
 Frame = -1

Query: 433  VTENVASPLVASLPPKTAYGPPGP*NR-FPLVTSNIHPFTAINTLPPSCVPS 281
            +T     P     PP T    P P     P  T+ I P T+  TLPP+  PS
Sbjct: 966  ITTTTPPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTTTPS 1017



 Score = 29.9 bits (64), Expect = 8.8
 Identities = 18/52 (34%), Positives = 22/52 (42%)
 Frame = -1

Query: 436  AVTENVASPLVASLPPKTAYGPPGP*NRFPLVTSNIHPFTAINTLPPSCVPS 281
            A T  +      S P  T   PP      P  T+ I P T+  TLPP+  PS
Sbjct: 887  ASTTTLPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTTTPS 938


>M74027-1|AAA59875.1|  573|Homo sapiens mucin protein.
          Length = 573

 Score = 31.1 bits (67), Expect = 3.8
 Identities = 18/52 (34%), Positives = 22/52 (42%), Gaps = 1/52 (1%)
 Frame = -1

Query: 433 VTENVASPLVASLPPKTAYGPPGP*NR-FPLVTSNIHPFTAINTLPPSCVPS 281
           +T     P     PP T    P P     P  T+ I P T+  TLPP+  PS
Sbjct: 249 ITTTTPPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTTTPS 300



 Score = 29.9 bits (64), Expect = 8.8
 Identities = 18/52 (34%), Positives = 22/52 (42%)
 Frame = -1

Query: 436 AVTENVASPLVASLPPKTAYGPPGP*NRFPLVTSNIHPFTAINTLPPSCVPS 281
           A T  +      S P  T   PP      P  T+ I P T+  TLPP+  PS
Sbjct: 170 ASTTTLPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTTTPS 221


>L21998-1|AAB95295.1| 5179|Homo sapiens mucin protein.
          Length = 5179

 Score = 31.1 bits (67), Expect = 3.8
 Identities = 18/52 (34%), Positives = 22/52 (42%), Gaps = 1/52 (1%)
 Frame = -1

Query: 433  VTENVASPLVASLPPKTAYGPPGP*NR-FPLVTSNIHPFTAINTLPPSCVPS 281
            +T     P     PP T    P P     P  T+ I P T+  TLPP+  PS
Sbjct: 1591 ITTTTPPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTTTPS 1642



 Score = 29.9 bits (64), Expect = 8.8
 Identities = 18/52 (34%), Positives = 22/52 (42%)
 Frame = -1

Query: 436  AVTENVASPLVASLPPKTAYGPPGP*NRFPLVTSNIHPFTAINTLPPSCVPS 281
            A T  +      S P  T   PP      P  T+ I P T+  TLPP+  PS
Sbjct: 1512 ASTTTLPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTTTPS 1563


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 103,965,530
Number of Sequences: 237096
Number of extensions: 2332327
Number of successful extensions: 6120
Number of sequences better than 10.0: 26
Number of HSP's better than 10.0 without gapping: 5665
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6094
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 7727256732
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -