SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30123.Seq
         (694 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X02344-1|CAA26203.1|  445|Homo sapiens beta-tubulin protein.          151   3e-36
BX255925-3|CAM24148.1|  445|Homo sapiens tubulin, beta 2C protein.    151   3e-36
BC071889-1|AAH71889.1|  445|Homo sapiens tubulin, beta 2C protein.    151   3e-36
BC039175-1|AAH39175.1|  445|Homo sapiens tubulin, beta 2C protein.    151   3e-36
BC029529-1|AAH29529.1|  445|Homo sapiens tubulin, beta 2C protein.    151   3e-36
BC024038-1|AAH24038.1|  445|Homo sapiens tubulin, beta 2C protein.    151   3e-36
BC019829-1|AAH19829.1|  445|Homo sapiens tubulin, beta 2C protein.    151   3e-36
BC019359-1|AAH19359.1|  445|Homo sapiens tubulin, beta 2C protein.    151   3e-36
BC012835-1|AAH12835.1|  445|Homo sapiens tubulin, beta 2C protein.    151   3e-36
BC007889-1|AAH07889.1|  445|Homo sapiens tubulin, beta 2C protein.    151   3e-36
BC004188-1|AAH04188.1|  445|Homo sapiens tubulin, beta 2C protein.    151   3e-36
BC002885-1|AAH02885.1|  445|Homo sapiens tubulin, beta 2C protein.    151   3e-36
BC002783-1|AAH02783.1|  445|Homo sapiens tubulin, beta 2C protein.    151   3e-36
BC001911-1|AAH01911.1|  445|Homo sapiens tubulin, beta 2C protein.    151   3e-36
AY167990-1|AAN87335.1|  445|Homo sapiens class IVb beta tubulin ...   151   3e-36
BC101271-1|AAI01272.1|  441|Homo sapiens TUBB8 protein protein.       149   7e-36
BC101270-1|AAI01271.1|  441|Homo sapiens TUBB8 protein protein.       149   7e-36
AL713922-4|CAI16221.1|  435|Homo sapiens novel protein similar t...   149   7e-36
AF355127-1|AAL32434.1|  444|Homo sapiens beta-tubulin 4Q protein.     149   7e-36
X00734-1|CAA25318.1|  444|Homo sapiens tubulin 5-beta protein.        148   2e-35
BC013683-1|AAH13683.1|  444|Homo sapiens tubulin, beta 4 protein.     148   2e-35
BC006570-1|AAH06570.1|  444|Homo sapiens TUBB4 protein protein.       148   2e-35
X79535-1|CAA56071.1|  445|Homo sapiens beta tubulin protein.          147   4e-35
V00599-1|CAA23844.1|  437|Homo sapiens protein ( Human mRNA frag...   147   4e-35
J00314-1|AAB59507.1|  444|Homo sapiens protein ( Human beta-tubu...   147   4e-35
CR541958-1|CAG46756.1|  445|Homo sapiens TUBB protein.                147   4e-35
CR456788-1|CAG33069.1|  445|Homo sapiens MGC8685 protein.             147   4e-35
BX248307-7|CAM25934.1|  426|Homo sapiens tubulin beta polypeptid...   147   4e-35
BX248307-6|CAM25933.1|  444|Homo sapiens tubulin beta polypeptid...   147   4e-35
BT019930-1|AAV38733.1|  445|Homo sapiens tubulin, beta polypepti...   147   4e-35
BC141925-1|AAI41926.1|  253|Homo sapiens TUBB2A protein protein.      147   4e-35
BC141924-1|AAI41925.1|  253|Homo sapiens TUBB2A protein protein.      147   4e-35
BC103746-1|AAI03747.1|  444|Homo sapiens tubulin, beta protein.       147   4e-35
BC070326-1|AAH70326.1|  444|Homo sapiens tubulin, beta protein.       147   4e-35
BC063610-1|AAH63610.1|  445|Homo sapiens tubulin, beta 2B protein.    147   4e-35
BC021909-1|AAH21909.1|  444|Homo sapiens tubulin, beta protein.       147   4e-35
BC020946-1|AAH20946.1|  444|Homo sapiens tubulin, beta protein.       147   4e-35
BC019924-1|AAH19924.1|  444|Homo sapiens tubulin, beta protein.       147   4e-35
BC018780-1|AAH18780.1|  445|Homo sapiens tubulin, beta 2A protein.    147   4e-35
BC013374-1|AAH13374.1|  444|Homo sapiens tubulin, beta protein.       147   4e-35
BC007605-1|AAH07605.1|  444|Homo sapiens tubulin, beta protein.       147   4e-35
BC005838-1|AAH05838.1|  444|Homo sapiens tubulin, beta protein.       147   4e-35
BC002347-1|AAH02347.1|  444|Homo sapiens tubulin, beta protein.       147   4e-35
BC001938-1|AAH01938.1|  444|Homo sapiens tubulin, beta protein.       147   4e-35
BC001352-1|AAH01352.1|  445|Homo sapiens tubulin, beta 2B protein.    147   4e-35
BC001194-1|AAH01194.1|  445|Homo sapiens tubulin, beta 2A protein.    147   4e-35
BA000025-69|BAB63321.1|  444|Homo sapiens Beta-tubulin protein.       147   4e-35
AY159127-1|AAN85571.1|  445|Homo sapiens class II beta tubulin i...   147   4e-35
AL845353-24|CAI41893.1|  426|Homo sapiens tubulin, beta polypept...   147   4e-35
AL845353-23|CAI41892.1|  444|Homo sapiens tubulin, beta polypept...   147   4e-35
AL662848-8|CAM24851.1|  426|Homo sapiens tubulin, beta protein.       147   4e-35
AL662848-7|CAI17441.1|  444|Homo sapiens tubulin, beta protein.       147   4e-35
AL662797-12|CAM25516.1|  426|Homo sapiens tubulin, beta protein.      147   4e-35
AL662797-11|CAI18196.1|  444|Homo sapiens tubulin, beta protein.      147   4e-35
AL445309-1|CAI40952.1|  445|Homo sapiens RP11-506K6.1 protein.        147   4e-35
AL031963-6|CAD70628.1|  445|Homo sapiens protein ( Human DNA seq...   147   4e-35
AF141349-1|AAD33873.1|  444|Homo sapiens beta-tubulin protein.        147   4e-35
AF070600-1|AAC28654.1|  444|Homo sapiens beta-tubulin protein.        147   4e-35
AF070593-1|AAC28650.1|  444|Homo sapiens beta-tubulin protein.        147   4e-35
AF070561-1|AAC28642.1|  444|Homo sapiens beta-tubulin protein.        147   4e-35
AB202098-1|BAE78618.1|  444|Homo sapiens beta 5-tubulin protein.      147   4e-35
AB103606-1|BAF31267.1|  444|Homo sapiens beta-tubulin protein pr...   147   4e-35
AB088100-1|BAC54932.1|  444|Homo sapiens tubulin, beta polypepti...   147   4e-35
AB062393-1|BAB93480.1|  444|Homo sapiens beta 5-tubulin protein.      147   4e-35
AK022340-1|BAB14016.1|  446|Homo sapiens protein ( Homo sapiens ...   144   3e-34
BC002654-1|AAH02654.1|  446|Homo sapiens tubulin, beta 6 protein.     143   5e-34
U47634-1|AAC52035.1|  450|Homo sapiens beta-tubulin protein.          142   1e-33
BT006971-1|AAP35617.1|  797|Homo sapiens tubulin, beta, 4 protein.    142   1e-33
BC111374-1|AAI11375.1|  447|Homo sapiens TUBB6 protein protein.       142   1e-33
BC003021-1|AAH03021.2|  450|Homo sapiens tubulin, beta 3 protein.     142   1e-33
BC000748-1|AAH00748.1|  450|Homo sapiens tubulin, beta 3 protein.     142   1e-33
AK223039-1|BAD96759.1|  450|Homo sapiens tubulin, beta, 4 varian...   142   1e-33
AF427491-1|AAL28094.1|  450|Homo sapiens class III beta tubulin ...   142   1e-33
BC001678-1|AAH01678.2|  406|Homo sapiens TUBB3 protein protein.       138   1e-32
U83110-1|AAB41497.1|  434|Homo sapiens beta-tubulin protein.          132   1e-30
U83668-1|AAB48456.1|  433|Homo sapiens beta-tubulin protein.          128   2e-29
BC033679-1|AAH33679.1|  451|Homo sapiens tubulin, beta 1 protein.     125   1e-28
AL109840-7|CAC09371.2|  451|Homo sapiens tubulin, beta 1 protein.     125   1e-28
AJ292757-1|CAC16605.1|  451|Homo sapiens protein ( Homo sapiens ...   125   1e-28
BC047518-1|AAH47518.1|  280|Homo sapiens TUBB3 protein protein.       107   5e-23
BX248307-8|CAM25935.1|  372|Homo sapiens tubulin beta polypeptid...    98   2e-20
AL845353-25|CAI41894.1|  372|Homo sapiens tubulin, beta polypept...    98   2e-20
AL662848-9|CAI17442.1|  372|Homo sapiens tubulin, beta protein.        98   2e-20
AL662797-13|CAI18197.1|  372|Homo sapiens tubulin, beta protein.       98   2e-20
BC127872-1|AAI27873.2|  188|Homo sapiens TUBB2B protein protein.       97   4e-20
AL713922-2|CAI16219.1|  227|Homo sapiens novel protein similar t...    97   5e-20
X01703-1|CAA25855.1|  451|Homo sapiens alpha-tubulin protein.          89   1e-17
K00558-1|AAA91576.1|  451|Homo sapiens protein ( human alpha-tub...    89   1e-17
DQ400107-1|ABD60581.1|  451|Homo sapiens alpha tubulin protein.        89   1e-17
BC071904-1|AAH71904.1|  451|Homo sapiens tubulin, alpha 1b protein.    89   1e-17
BC063036-1|AAH63036.1|  449|Homo sapiens tubulin, alpha 1c protein.    89   1e-17
BC051297-1|AAH51297.1|  449|Homo sapiens tubulin, alpha 1c protein.    89   1e-17
BC050637-1|AAH50637.1|  451|Homo sapiens tubulin, alpha 1a protein.    89   1e-17
BC030820-1|AAH30820.1|  451|Homo sapiens tubulin, alpha 1b protein.    89   1e-17
BC021088-1|AAH21088.1|  449|Homo sapiens tubulin, alpha 1c protein.    89   1e-17
BC019298-1|AAH19298.1|  449|Homo sapiens tubulin, alpha 1c protein.    89   1e-17
BC017004-1|AAH17004.1|  451|Homo sapiens tubulin, alpha 1b protein.    89   1e-17
BC015883-1|AAH15883.1|  451|Homo sapiens tubulin, alpha 1b protein.    89   1e-17
BC011790-1|AAH11790.1|  449|Homo sapiens tubulin, alpha 1c protein.    89   1e-17
BC011572-1|AAH11572.1|  451|Homo sapiens tubulin, alpha 1b protein.    89   1e-17
BC010494-1|AAH10494.1|  451|Homo sapiens tubulin, alpha 1b protein.    89   1e-17
BC009513-1|AAH09513.1|  451|Homo sapiens tubulin, alpha 1b protein.    89   1e-17
BC009512-1|AAH09512.1|  451|Homo sapiens tubulin, alpha 1b protein.    89   1e-17
BC009509-1|AAH09509.1|  451|Homo sapiens tubulin, alpha 1b protein.    89   1e-17
BC009314-1|AAH09314.1|  451|Homo sapiens tubulin, alpha 1b protein.    89   1e-17
BC008659-1|AAH08659.1|  451|Homo sapiens tubulin, alpha 1b protein.    89   1e-17
BC006481-1|AAH06481.1|  451|Homo sapiens tubulin, alpha 1b protein.    89   1e-17
BC006468-1|AAH06468.1|  451|Homo sapiens tubulin, alpha 1a protein.    89   1e-17
BC006379-1|AAH06379.1|  451|Homo sapiens tubulin, alpha 1b protein.    89   1e-17
BC005946-1|AAH05946.1|  449|Homo sapiens tubulin, alpha 1c protein.    89   1e-17
BC004949-1|AAH04949.1|  449|Homo sapiens tubulin, alpha 1c protein.    89   1e-17
BC001128-1|AAH01128.1|  451|Homo sapiens tubulin, alpha 1b protein.    89   1e-17
BC000696-1|AAH00696.1|  451|Homo sapiens tubulin, alpha 1b protein.    89   1e-17
AK223024-1|BAD96744.1|  449|Homo sapiens tubulin alpha 6 variant...    89   1e-17
AF141347-1|AAD33871.1|  451|Homo sapiens alpha-tubulin protein.        89   1e-17
AF081484-1|AAC31959.1|  451|Homo sapiens alpha-tubulin isoform 1...    89   1e-17
DQ422808-1|ABD72607.1|  450|Homo sapiens tubulin, alpha 2 protein.     88   3e-17
BC057810-1|AAH57810.1|  450|Homo sapiens tubulin, alpha 3d protein.    88   3e-17
BC011721-1|AAH11721.1|  418|Homo sapiens tubulin, alpha 3c protein.    88   3e-17
AL139327-3|CAH73534.1|  450|Homo sapiens tubulin, alpha 3c protein.    88   3e-17
AF005392-1|AAC39578.1|  449|Homo sapiens alpha tubulin protein.        88   3e-17
X06956-1|CAA30026.1|  447|Homo sapiens alpha-tubulin protein.          87   6e-17
BT006731-1|AAP35377.1|  448|Homo sapiens tubulin, alpha 1 (testi...    87   6e-17
BC009238-1|AAH09238.1|  448|Homo sapiens tubulin, alpha 4a protein.    87   6e-17
AY895018-1|AAW65371.1|  448|Homo sapiens tubulin, alpha 1 (testi...    87   6e-17
BC057811-1|AAH57811.1|  450|Homo sapiens tubulin, alpha 3e protein.    86   1e-16
BC033064-1|AAH33064.1|  325|Homo sapiens TUBA1C protein protein.       84   4e-16
CR456600-1|CAG30486.1|  449|Homo sapiens TUBA8 protein.                81   5e-15
BX537702-1|CAD97815.1|  479|Homo sapiens hypothetical protein pr...    81   5e-15
BC104845-1|AAI04846.1|  449|Homo sapiens tubulin, alpha 8 protein.     81   5e-15
BC074827-1|AAH74827.1|  449|Homo sapiens tubulin, alpha 8 protein.     81   5e-15
AJ245922-1|CAB88036.1|  449|Homo sapiens alpha-tubulin 8 protein.      81   5e-15
BC021564-1|AAH21564.1|  335|Homo sapiens TUBA1B protein protein.       74   4e-13
BC105634-1|AAI05635.1|  446|Homo sapiens tubulin, alpha-like 3 p...    73   1e-12
BC099716-1|AAH99716.1|  446|Homo sapiens tubulin, alpha-like 3 p...    73   1e-12
BC098247-1|AAH98247.1|  406|Homo sapiens TUBAL3 protein protein.       73   1e-12
AL683826-2|CAI23625.1|  446|Homo sapiens tubulin, alpha-like 3 p...    73   1e-12
AK025318-1|BAB15110.1|  446|Homo sapiens protein ( Homo sapiens ...    73   1e-12
M61764-1|AAA52620.1|  451|Homo sapiens gamma-tubulin protein.          66   8e-11
CR407642-1|CAG28570.1|  451|Homo sapiens TUBG1 protein.                66   8e-11
BT019931-1|AAV38734.1|  451|Homo sapiens tubulin, gamma 1 protein.     66   8e-11
BC108739-1|AAI08740.1|  451|Homo sapiens tubulin, gamma 2 protein.     66   8e-11
BC051890-1|AAH51890.1|  451|Homo sapiens tubulin, gamma 2 protein.     66   8e-11
BC009670-1|AAH09670.1|  451|Homo sapiens tubulin, gamma 2 protein.     66   8e-11
BC000619-1|AAH00619.1|  451|Homo sapiens tubulin, gamma 1 protein.     66   8e-11
AK022324-1|BAB14012.1|  451|Homo sapiens protein ( Homo sapiens ...    66   8e-11
AF225971-1|AAF34188.1|  451|Homo sapiens gamma-tubulin protein.        66   8e-11
AL713922-3|CAI16220.1|  410|Homo sapiens novel protein similar t...    62   2e-09
AY533484-1|AAS86429.1|   98|Homo sapiens tubulin alpha-1 protein.      53   1e-06
BC127874-1|AAI27875.1|  151|Homo sapiens Unknown (protein for IM...    51   3e-06
AL050056-1|CAB43252.1|  325|Homo sapiens hypothetical protein pr...    51   3e-06
AF035316-1|AAB88188.1|  342|Homo sapiens protein ( Homo sapiens ...    51   3e-06
BC001896-1|AAH01896.1|  340|Homo sapiens TUBB protein protein.         50   8e-06
DQ457058-1|ABE96641.1|  208|Homo sapiens XTP3TPA-transactivated ...    46   1e-04
AK024002-1|BAB14767.1|  241|Homo sapiens protein ( Homo sapiens ...    45   2e-04
Z99289-5|CAI42328.1|  163|Homo sapiens tubulin, epsilon 1 protein.     39   0.015
Z99289-4|CAI42327.1|  475|Homo sapiens tubulin, epsilon 1 protein.     39   0.015
Z99289-3|CAI42326.1|  206|Homo sapiens tubulin, epsilon 1 protein.     39   0.015
BC031101-1|AAH31101.1|  475|Homo sapiens tubulin, epsilon 1 prot...    39   0.015
BC025405-1|AAH25405.1|  475|Homo sapiens tubulin, epsilon 1 prot...    39   0.015
AF201334-1|AAF09585.1|  475|Homo sapiens epsilon-tubulin protein.      39   0.015
BC000258-1|AAH00258.1|  398|Homo sapiens TUBD1 protein protein.        38   0.034
AF201333-1|AAF09584.1|  453|Homo sapiens delta-tubulin protein.        38   0.045
AB031045-1|BAD83581.1|  351|Homo sapiens delta-tubulin isoform p...    38   0.045
AB031044-1|BAD83580.1|  398|Homo sapiens delta-tubulin isoform p...    38   0.045
AB030837-1|BAD16590.1|  453|Homo sapiens delta tubulin protein.        38   0.045
AK024391-1|BAB14906.1| 1811|Homo sapiens protein ( Homo sapiens ...    31   3.0  
D87717-1|BAA13442.2| 1086|Homo sapiens KIAA0013 protein.               31   5.2  
BC063444-1|AAH63444.1|  501|Homo sapiens Rho GTPase activating p...    31   5.2  
BC039563-1|AAH39563.1| 1023|Homo sapiens Rho GTPase activating p...    31   5.2  
AK024096-1|BAB14825.1|  199|Homo sapiens protein ( Homo sapiens ...    31   5.2  
Z70200-1|CAA94089.1| 1701|Homo sapiens U5 snRNP-specific 200kD p...    30   9.0  
BC112891-1|AAI12892.1| 1887|Homo sapiens ASCC3L1 protein protein.      30   9.0  
BC065924-1|AAH65924.1| 1821|Homo sapiens ASCC3L1 protein protein.      30   9.0  
BC007577-1|AAH07577.1| 1308|Homo sapiens ASCC3L1 protein protein.      30   9.0  
AY572488-1|AAS78571.1| 2136|Homo sapiens 200 kDa U5 snRNP-specif...    30   9.0  
AY236487-1|AAP74807.1|  766|Homo sapiens proliferation-inducing ...    30   9.0  
AF542172-1|AAQ11383.1|  508|Homo sapiens HLC-6 protein.                30   9.0  
AB018331-1|BAA34508.2| 2026|Homo sapiens KIAA0788 protein protein.     30   9.0  

>X02344-1|CAA26203.1|  445|Homo sapiens beta-tubulin protein.
          Length = 445

 Score =  151 bits (365), Expect = 3e-36
 Identities = 75/145 (51%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEA+ GKYVPR VL+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 85.4 bits (202), Expect = 2e-16
 Identities = 35/42 (83%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI++LQ G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 42



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 177


>BX255925-3|CAM24148.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  151 bits (365), Expect = 3e-36
 Identities = 75/145 (51%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEA+ GKYVPR VL+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 85.4 bits (202), Expect = 2e-16
 Identities = 35/42 (83%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI++LQ G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 42



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 177


>BC071889-1|AAH71889.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  151 bits (365), Expect = 3e-36
 Identities = 75/145 (51%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEA+ GKYVPR VL+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 85.4 bits (202), Expect = 2e-16
 Identities = 35/42 (83%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI++LQ G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 42



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 177


>BC039175-1|AAH39175.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  151 bits (365), Expect = 3e-36
 Identities = 75/145 (51%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEA+ GKYVPR VL+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 85.4 bits (202), Expect = 2e-16
 Identities = 35/42 (83%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI++LQ G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 42



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 177


>BC029529-1|AAH29529.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  151 bits (365), Expect = 3e-36
 Identities = 75/145 (51%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEA+ GKYVPR VL+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 85.4 bits (202), Expect = 2e-16
 Identities = 35/42 (83%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI++LQ G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 42



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 177


>BC024038-1|AAH24038.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  151 bits (365), Expect = 3e-36
 Identities = 75/145 (51%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEA+ GKYVPR VL+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 85.4 bits (202), Expect = 2e-16
 Identities = 35/42 (83%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI++LQ G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 42



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 177


>BC019829-1|AAH19829.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  151 bits (365), Expect = 3e-36
 Identities = 75/145 (51%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEA+ GKYVPR VL+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 85.4 bits (202), Expect = 2e-16
 Identities = 35/42 (83%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI++LQ G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 42



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 177


>BC019359-1|AAH19359.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  151 bits (365), Expect = 3e-36
 Identities = 75/145 (51%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEA+ GKYVPR VL+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 85.4 bits (202), Expect = 2e-16
 Identities = 35/42 (83%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI++LQ G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 42



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 177


>BC012835-1|AAH12835.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  151 bits (365), Expect = 3e-36
 Identities = 75/145 (51%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEA+ GKYVPR VL+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 85.4 bits (202), Expect = 2e-16
 Identities = 35/42 (83%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI++LQ G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 42



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 177


>BC007889-1|AAH07889.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  151 bits (365), Expect = 3e-36
 Identities = 75/145 (51%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEA+ GKYVPR VL+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 85.4 bits (202), Expect = 2e-16
 Identities = 35/42 (83%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI++LQ G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 42



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 177


>BC004188-1|AAH04188.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  151 bits (365), Expect = 3e-36
 Identities = 75/145 (51%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEA+ GKYVPR VL+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 85.4 bits (202), Expect = 2e-16
 Identities = 35/42 (83%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI++LQ G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 42



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 177


>BC002885-1|AAH02885.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  151 bits (365), Expect = 3e-36
 Identities = 75/145 (51%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEA+ GKYVPR VL+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 85.4 bits (202), Expect = 2e-16
 Identities = 35/42 (83%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI++LQ G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 42



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 177


>BC002783-1|AAH02783.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  151 bits (365), Expect = 3e-36
 Identities = 75/145 (51%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEA+ GKYVPR VL+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 85.4 bits (202), Expect = 2e-16
 Identities = 35/42 (83%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI++LQ G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 42



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 177


>BC001911-1|AAH01911.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  151 bits (365), Expect = 3e-36
 Identities = 75/145 (51%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEA+ GKYVPR VL+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 85.4 bits (202), Expect = 2e-16
 Identities = 35/42 (83%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI++LQ G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 42



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 177


>AY167990-1|AAN87335.1|  445|Homo sapiens class IVb beta tubulin
           protein.
          Length = 445

 Score =  151 bits (365), Expect = 3e-36
 Identities = 75/145 (51%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEA+ GKYVPR VL+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 85.4 bits (202), Expect = 2e-16
 Identities = 35/42 (83%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI++LQ G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 42



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 177


>BC101271-1|AAI01272.1|  441|Homo sapiens TUBB8 protein protein.
          Length = 441

 Score =  149 bits (362), Expect = 7e-36
 Identities = 74/145 (51%), Positives = 93/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEAS G+YVPR VL+DL+P TMD+VRSGPFG +FRPDNF++GQ  A NNWA
Sbjct: 40  QLERINVYYNEASGGRYVPRAVLVDLEPGTMDSVRSGPFGQVFRPDNFIFGQCGAGNNWA 99

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E++ES +DV+R+EAE     +   +T +              +   +  P  
Sbjct: 100 KGHYTEGAELMESVMDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLLSKIREEYPDR 159

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 160 IINTFSILPSPKVSDTVVEPYNATL 184



 Score = 68.5 bits (160), Expect = 2e-11
 Identities = 28/39 (71%), Positives = 31/39 (79%)
 Frame = +1

Query: 139 IINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           I+  Q+G CGNQIG KFWEVISDEH ID +G YHGDS L
Sbjct: 1   IVLTQIGQCGNQIGAKFWEVISDEHAIDSAGTYHGDSHL 39



 Score = 50.4 bits (115), Expect = 6e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRII TFS+ PSP+VSD
Sbjct: 125 DCLQGFQLTHSLGGGTGSGMGTLLLSKIREEYPDRIINTFSILPSPKVSD 174


>BC101270-1|AAI01271.1|  441|Homo sapiens TUBB8 protein protein.
          Length = 441

 Score =  149 bits (362), Expect = 7e-36
 Identities = 74/145 (51%), Positives = 93/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEAS G+YVPR VL+DL+P TMD+VRSGPFG +FRPDNF++GQ  A NNWA
Sbjct: 40  QLERINVYYNEASGGRYVPRAVLVDLEPGTMDSVRSGPFGQVFRPDNFIFGQCGAGNNWA 99

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E++ES +DV+R+EAE     +   +T +              +   +  P  
Sbjct: 100 KGHYTEGAELMESVMDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLLSKIREEYPDR 159

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 160 IINTFSILPSPKVSDTVVEPYNATL 184



 Score = 68.5 bits (160), Expect = 2e-11
 Identities = 28/39 (71%), Positives = 31/39 (79%)
 Frame = +1

Query: 139 IINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           I+  Q+G CGNQIG KFWEVISDEH ID +G YHGDS L
Sbjct: 1   IVLTQIGQCGNQIGAKFWEVISDEHAIDSAGTYHGDSHL 39



 Score = 50.4 bits (115), Expect = 6e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRII TFS+ PSP+VSD
Sbjct: 125 DCLQGFQLTHSLGGGTGSGMGTLLLSKIREEYPDRIINTFSILPSPKVSD 174


>AL713922-4|CAI16221.1|  435|Homo sapiens novel protein similar to
           beta-tubulin 4Q (TUBB4Q)kinase) II gamma protein.
          Length = 435

 Score =  149 bits (362), Expect = 7e-36
 Identities = 74/145 (51%), Positives = 93/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEAS G+YVPR VL+DL+P TMD+VRSGPFG +FRPDNF++GQ  A NNWA
Sbjct: 43  QLERINVYYNEASGGRYVPRAVLVDLEPGTMDSVRSGPFGQVFRPDNFIFGQCGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E++ES +DV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELMESVMDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLLSKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IINTFSILPSPKVSDTVVEPYNATL 187



 Score = 74.5 bits (175), Expect = 3e-13
 Identities = 31/42 (73%), Positives = 34/42 (80%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+  Q+G CGNQIG KFWEVISDEH ID +G YHGDS L
Sbjct: 1   MREIVLTQIGQCGNQIGAKFWEVISDEHAIDSAGTYHGDSHL 42



 Score = 50.4 bits (115), Expect = 6e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRII TFS+ PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLLSKIREEYPDRIINTFSILPSPKVSD 177


>AF355127-1|AAL32434.1|  444|Homo sapiens beta-tubulin 4Q protein.
          Length = 444

 Score =  149 bits (362), Expect = 7e-36
 Identities = 74/145 (51%), Positives = 93/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEAS G+YVPR VL+DL+P TMD+VRSGPFG +FRPDNF++GQ  A NNWA
Sbjct: 43  QLERINVYYNEASGGRYVPRAVLVDLEPGTMDSVRSGPFGQVFRPDNFIFGQCGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E++ES +DV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELMESVMDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLLSKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IINTFSILPSPKVSDTVVEPYNATL 187



 Score = 74.5 bits (175), Expect = 3e-13
 Identities = 31/42 (73%), Positives = 34/42 (80%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+  Q+G CGNQIG KFWEVISDEH ID +G YHGDS L
Sbjct: 1   MREIVLTQIGQCGNQIGAKFWEVISDEHAIDSAGTYHGDSHL 42



 Score = 50.4 bits (115), Expect = 6e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRII TFS+ PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLLSKIREEYPDRIINTFSILPSPKVSD 177


>X00734-1|CAA25318.1|  444|Homo sapiens tubulin 5-beta protein.
          Length = 444

 Score =  148 bits (358), Expect = 2e-35
 Identities = 73/145 (50%), Positives = 93/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEA+ G YVPR VL+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E++++ LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDAVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKMREEFPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 85.4 bits (202), Expect = 2e-16
 Identities = 35/42 (83%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI++LQ G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 42



 Score = 47.2 bits (107), Expect = 6e-05
 Identities = 22/50 (44%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 ++++REE+PDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKMREEFPDRIMNTFSVVPSPKVSD 177


>BC013683-1|AAH13683.1|  444|Homo sapiens tubulin, beta 4 protein.
          Length = 444

 Score =  148 bits (358), Expect = 2e-35
 Identities = 73/145 (50%), Positives = 93/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEA+ G YVPR VL+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E++++ LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDAVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 85.4 bits (202), Expect = 2e-16
 Identities = 35/42 (83%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI++LQ G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 42



 Score = 48.4 bits (110), Expect = 2e-05
 Identities = 23/50 (46%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREE+PDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPKVSD 177


>BC006570-1|AAH06570.1|  444|Homo sapiens TUBB4 protein protein.
          Length = 444

 Score =  148 bits (358), Expect = 2e-35
 Identities = 73/145 (50%), Positives = 93/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEA+ G YVPR VL+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E++++ LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDAVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 85.4 bits (202), Expect = 2e-16
 Identities = 35/42 (83%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI++LQ G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 42



 Score = 48.4 bits (110), Expect = 2e-05
 Identities = 23/50 (46%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREE+PDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPKVSD 177


>X79535-1|CAA56071.1|  445|Homo sapiens beta tubulin protein.
          Length = 445

 Score =  147 bits (356), Expect = 4e-35
 Identities = 72/145 (49%), Positives = 93/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEA+  KYVPR +L+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+E+E     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVMPSPKVSDTVVEPYNATL 187



 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDL 42



 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 26/56 (46%), Positives = 32/56 (57%)
 Frame = +2

Query: 491 KGS*GLDCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           K S   DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 122 KESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSD 177


>V00599-1|CAA23844.1|  437|Homo sapiens protein ( Human mRNA
           fragment encoding beta-tubulin. (from clone D-beta-1).
           ).
          Length = 437

 Score =  147 bits (356), Expect = 4e-35
 Identities = 72/145 (49%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QL+RI+VYYNEA+ GKYVPR +L+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 36  QLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 95

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 96  KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 155

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 156 IMNTFSVVPSPKVSDTVVEPYNATL 180



 Score = 74.5 bits (175), Expect = 3e-13
 Identities = 30/35 (85%), Positives = 31/35 (88%)
 Frame = +1

Query: 151 QVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           Q G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   QAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 35



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 121 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 170


>J00314-1|AAB59507.1|  444|Homo sapiens protein ( Human beta-tubulin
           gene, clone m40. ).
          Length = 444

 Score =  147 bits (356), Expect = 4e-35
 Identities = 72/145 (49%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QL+RI+VYYNEA+ GKYVPR +L+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 42



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 177


>CR541958-1|CAG46756.1|  445|Homo sapiens TUBB protein.
          Length = 445

 Score =  147 bits (356), Expect = 4e-35
 Identities = 72/145 (49%), Positives = 93/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEA+  KYVPR +L+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+E+E     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVMPSPKVSDTVVEPYNATL 187



 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDL 42



 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 26/56 (46%), Positives = 32/56 (57%)
 Frame = +2

Query: 491 KGS*GLDCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           K S   DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 122 KESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSD 177


>CR456788-1|CAG33069.1|  445|Homo sapiens MGC8685 protein.
          Length = 445

 Score =  147 bits (356), Expect = 4e-35
 Identities = 72/145 (49%), Positives = 93/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEA+  KYVPR +L+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+E+E     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVMPSPKVSDTVVEPYNATL 187



 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDL 42



 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 26/56 (46%), Positives = 32/56 (57%)
 Frame = +2

Query: 491 KGS*GLDCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           K S   DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 122 KESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSD 177


>BX248307-7|CAM25934.1|  426|Homo sapiens tubulin beta polypeptide
           protein.
          Length = 426

 Score =  147 bits (356), Expect = 4e-35
 Identities = 72/145 (49%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QL+RI+VYYNEA+ GKYVPR +L+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 25  QLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 84

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 85  KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 144

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 145 IMNTFSVVPSPKVSDTVVEPYNATL 169



 Score = 53.6 bits (123), Expect = 6e-07
 Identities = 21/23 (91%), Positives = 22/23 (95%)
 Frame = +1

Query: 187 FWEVISDEHGIDPSGCYHGDSDL 255
           FWEVISDEHGIDP+G YHGDSDL
Sbjct: 2   FWEVISDEHGIDPTGTYHGDSDL 24



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 110 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 159


>BX248307-6|CAM25933.1|  444|Homo sapiens tubulin beta polypeptide
           protein.
          Length = 444

 Score =  147 bits (356), Expect = 4e-35
 Identities = 72/145 (49%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QL+RI+VYYNEA+ GKYVPR +L+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 42



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 177


>BT019930-1|AAV38733.1|  445|Homo sapiens tubulin, beta polypeptide
           paralog protein.
          Length = 445

 Score =  147 bits (356), Expect = 4e-35
 Identities = 72/145 (49%), Positives = 93/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEA+  KYVPR +L+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+E+E     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVMPSPKVSDTVVEPYNATL 187



 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDL 42



 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 26/56 (46%), Positives = 32/56 (57%)
 Frame = +2

Query: 491 KGS*GLDCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           K S   DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 122 KESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSD 177


>BC141925-1|AAI41926.1|  253|Homo sapiens TUBB2A protein protein.
          Length = 253

 Score =  147 bits (356), Expect = 4e-35
 Identities = 72/145 (49%), Positives = 93/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEA+  KYVPR +L+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 36  QLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 95

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+E+E     +   +T +              +   +  P  
Sbjct: 96  KGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 155

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 156 IMNTFSVMPSPKVSDTVVEPYNATL 180



 Score = 54.0 bits (124), Expect = 5e-07
 Identities = 21/24 (87%), Positives = 23/24 (95%)
 Frame = +1

Query: 184 KFWEVISDEHGIDPSGCYHGDSDL 255
           +FWEVISDEHGIDP+G YHGDSDL
Sbjct: 12  QFWEVISDEHGIDPTGSYHGDSDL 35



 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 26/56 (46%), Positives = 32/56 (57%)
 Frame = +2

Query: 491 KGS*GLDCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           K S   DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 115 KESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSD 170


>BC141924-1|AAI41925.1|  253|Homo sapiens TUBB2A protein protein.
          Length = 253

 Score =  147 bits (356), Expect = 4e-35
 Identities = 72/145 (49%), Positives = 93/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEA+  KYVPR +L+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 36  QLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 95

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+E+E     +   +T +              +   +  P  
Sbjct: 96  KGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 155

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 156 IMNTFSVMPSPKVSDTVVEPYNATL 180



 Score = 54.0 bits (124), Expect = 5e-07
 Identities = 21/24 (87%), Positives = 23/24 (95%)
 Frame = +1

Query: 184 KFWEVISDEHGIDPSGCYHGDSDL 255
           +FWEVISDEHGIDP+G YHGDSDL
Sbjct: 12  QFWEVISDEHGIDPTGSYHGDSDL 35



 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 26/56 (46%), Positives = 32/56 (57%)
 Frame = +2

Query: 491 KGS*GLDCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           K S   DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 115 KESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSD 170


>BC103746-1|AAI03747.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  147 bits (356), Expect = 4e-35
 Identities = 72/145 (49%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QL+RI+VYYNEA+ GKYVPR +L+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 42



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 177


>BC070326-1|AAH70326.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  147 bits (356), Expect = 4e-35
 Identities = 72/145 (49%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QL+RI+VYYNEA+ GKYVPR +L+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 42



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 177


>BC063610-1|AAH63610.1|  445|Homo sapiens tubulin, beta 2B protein.
          Length = 445

 Score =  147 bits (356), Expect = 4e-35
 Identities = 72/145 (49%), Positives = 93/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEA+  KYVPR +L+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+E+E     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVMPSPKVSDTVVEPYNATL 187



 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDL 42



 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 26/56 (46%), Positives = 32/56 (57%)
 Frame = +2

Query: 491 KGS*GLDCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           K S   DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 122 KESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSD 177


>BC021909-1|AAH21909.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  147 bits (356), Expect = 4e-35
 Identities = 72/145 (49%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QL+RI+VYYNEA+ GKYVPR +L+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 42



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 177


>BC020946-1|AAH20946.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  147 bits (356), Expect = 4e-35
 Identities = 72/145 (49%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QL+RI+VYYNEA+ GKYVPR +L+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 42



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 177


>BC019924-1|AAH19924.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  147 bits (356), Expect = 4e-35
 Identities = 72/145 (49%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QL+RI+VYYNEA+ GKYVPR +L+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 42



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 177


>BC018780-1|AAH18780.1|  445|Homo sapiens tubulin, beta 2A protein.
          Length = 445

 Score =  147 bits (356), Expect = 4e-35
 Identities = 72/145 (49%), Positives = 93/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEA+  KYVPR +L+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+E+E     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVMPSPKVSDTVVEPYNATL 187



 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDL 42



 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 26/56 (46%), Positives = 32/56 (57%)
 Frame = +2

Query: 491 KGS*GLDCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           K S   DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 122 KESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSD 177


>BC013374-1|AAH13374.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  147 bits (356), Expect = 4e-35
 Identities = 72/145 (49%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QL+RI+VYYNEA+ GKYVPR +L+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 42



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 177


>BC007605-1|AAH07605.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  147 bits (356), Expect = 4e-35
 Identities = 72/145 (49%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QL+RI+VYYNEA+ GKYVPR +L+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 42



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 177


>BC005838-1|AAH05838.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  147 bits (356), Expect = 4e-35
 Identities = 72/145 (49%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QL+RI+VYYNEA+ GKYVPR +L+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 42



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 177


>BC002347-1|AAH02347.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  147 bits (356), Expect = 4e-35
 Identities = 72/145 (49%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QL+RI+VYYNEA+ GKYVPR +L+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 42



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 177


>BC001938-1|AAH01938.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  147 bits (356), Expect = 4e-35
 Identities = 72/145 (49%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QL+RI+VYYNEA+ GKYVPR +L+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 42



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 177


>BC001352-1|AAH01352.1|  445|Homo sapiens tubulin, beta 2B protein.
          Length = 445

 Score =  147 bits (356), Expect = 4e-35
 Identities = 72/145 (49%), Positives = 93/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEA+  KYVPR +L+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+E+E     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVMPSPKVSDTVVEPYNATL 187



 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDL 42



 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 26/56 (46%), Positives = 32/56 (57%)
 Frame = +2

Query: 491 KGS*GLDCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           K S   DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 122 KESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSD 177


>BC001194-1|AAH01194.1|  445|Homo sapiens tubulin, beta 2A protein.
          Length = 445

 Score =  147 bits (356), Expect = 4e-35
 Identities = 72/145 (49%), Positives = 93/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEA+  KYVPR +L+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+E+E     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVMPSPKVSDTVVEPYNATL 187



 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDL 42



 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 26/56 (46%), Positives = 32/56 (57%)
 Frame = +2

Query: 491 KGS*GLDCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           K S   DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 122 KESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSD 177


>BA000025-69|BAB63321.1|  444|Homo sapiens Beta-tubulin protein.
          Length = 444

 Score =  147 bits (356), Expect = 4e-35
 Identities = 72/145 (49%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QL+RI+VYYNEA+ GKYVPR +L+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 42



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 177


>AY159127-1|AAN85571.1|  445|Homo sapiens class II beta tubulin
           isotype protein.
          Length = 445

 Score =  147 bits (356), Expect = 4e-35
 Identities = 72/145 (49%), Positives = 93/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEA+  KYVPR +L+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+E+E     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVMPSPKVSDTVVEPYNATL 187



 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDL 42



 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 26/56 (46%), Positives = 32/56 (57%)
 Frame = +2

Query: 491 KGS*GLDCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           K S   DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 122 KESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSD 177


>AL845353-24|CAI41893.1|  426|Homo sapiens tubulin, beta polypeptide
           protein.
          Length = 426

 Score =  147 bits (356), Expect = 4e-35
 Identities = 72/145 (49%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QL+RI+VYYNEA+ GKYVPR +L+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 25  QLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 84

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 85  KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 144

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 145 IMNTFSVVPSPKVSDTVVEPYNATL 169



 Score = 53.6 bits (123), Expect = 6e-07
 Identities = 21/23 (91%), Positives = 22/23 (95%)
 Frame = +1

Query: 187 FWEVISDEHGIDPSGCYHGDSDL 255
           FWEVISDEHGIDP+G YHGDSDL
Sbjct: 2   FWEVISDEHGIDPTGTYHGDSDL 24



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 110 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 159


>AL845353-23|CAI41892.1|  444|Homo sapiens tubulin, beta polypeptide
           protein.
          Length = 444

 Score =  147 bits (356), Expect = 4e-35
 Identities = 72/145 (49%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QL+RI+VYYNEA+ GKYVPR +L+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 42



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 177


>AL662848-8|CAM24851.1|  426|Homo sapiens tubulin, beta protein.
          Length = 426

 Score =  147 bits (356), Expect = 4e-35
 Identities = 72/145 (49%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QL+RI+VYYNEA+ GKYVPR +L+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 25  QLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 84

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 85  KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 144

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 145 IMNTFSVVPSPKVSDTVVEPYNATL 169



 Score = 53.6 bits (123), Expect = 6e-07
 Identities = 21/23 (91%), Positives = 22/23 (95%)
 Frame = +1

Query: 187 FWEVISDEHGIDPSGCYHGDSDL 255
           FWEVISDEHGIDP+G YHGDSDL
Sbjct: 2   FWEVISDEHGIDPTGTYHGDSDL 24



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 110 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 159


>AL662848-7|CAI17441.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  147 bits (356), Expect = 4e-35
 Identities = 72/145 (49%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QL+RI+VYYNEA+ GKYVPR +L+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 42



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 177


>AL662797-12|CAM25516.1|  426|Homo sapiens tubulin, beta protein.
          Length = 426

 Score =  147 bits (356), Expect = 4e-35
 Identities = 72/145 (49%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QL+RI+VYYNEA+ GKYVPR +L+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 25  QLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 84

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 85  KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 144

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 145 IMNTFSVVPSPKVSDTVVEPYNATL 169



 Score = 53.6 bits (123), Expect = 6e-07
 Identities = 21/23 (91%), Positives = 22/23 (95%)
 Frame = +1

Query: 187 FWEVISDEHGIDPSGCYHGDSDL 255
           FWEVISDEHGIDP+G YHGDSDL
Sbjct: 2   FWEVISDEHGIDPTGTYHGDSDL 24



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 110 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 159


>AL662797-11|CAI18196.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  147 bits (356), Expect = 4e-35
 Identities = 72/145 (49%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QL+RI+VYYNEA+ GKYVPR +L+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 42



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 177


>AL445309-1|CAI40952.1|  445|Homo sapiens RP11-506K6.1 protein.
          Length = 445

 Score =  147 bits (356), Expect = 4e-35
 Identities = 72/145 (49%), Positives = 93/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEA+  KYVPR +L+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+E+E     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVMPSPKVSDTVVEPYNATL 187



 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDL 42



 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 26/56 (46%), Positives = 32/56 (57%)
 Frame = +2

Query: 491 KGS*GLDCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           K S   DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 122 KESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSD 177


>AL031963-6|CAD70628.1|  445|Homo sapiens protein ( Human DNA
           sequence from clone RP1-40E16 on chromosome 6p24.1-25.3 
           Contains the gene for a novel protein similar to D.
           melanogaster  ).
          Length = 445

 Score =  147 bits (356), Expect = 4e-35
 Identities = 72/145 (49%), Positives = 93/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEA+  KYVPR +L+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+E+E     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVMPSPKVSDTVVEPYNATL 187



 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDL 42



 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 26/56 (46%), Positives = 32/56 (57%)
 Frame = +2

Query: 491 KGS*GLDCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           K S   DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 122 KESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSD 177


>AF141349-1|AAD33873.1|  444|Homo sapiens beta-tubulin protein.
          Length = 444

 Score =  147 bits (356), Expect = 4e-35
 Identities = 72/145 (49%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QL+RI+VYYNEA+ GKYVPR +L+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 42



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 177


>AF070600-1|AAC28654.1|  444|Homo sapiens beta-tubulin protein.
          Length = 444

 Score =  147 bits (356), Expect = 4e-35
 Identities = 72/145 (49%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QL+RI+VYYNEA+ GKYVPR +L+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 42



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 177


>AF070593-1|AAC28650.1|  444|Homo sapiens beta-tubulin protein.
          Length = 444

 Score =  147 bits (356), Expect = 4e-35
 Identities = 72/145 (49%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QL+RI+VYYNEA+ GKYVPR +L+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 42



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 177


>AF070561-1|AAC28642.1|  444|Homo sapiens beta-tubulin protein.
          Length = 444

 Score =  147 bits (356), Expect = 4e-35
 Identities = 72/145 (49%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QL+RI+VYYNEA+ GKYVPR +L+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 42



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 177


>AB202098-1|BAE78618.1|  444|Homo sapiens beta 5-tubulin protein.
          Length = 444

 Score =  147 bits (356), Expect = 4e-35
 Identities = 72/145 (49%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QL+RI+VYYNEA+ GKYVPR +L+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 42



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 177


>AB103606-1|BAF31267.1|  444|Homo sapiens beta-tubulin protein
           protein.
          Length = 444

 Score =  147 bits (356), Expect = 4e-35
 Identities = 72/145 (49%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QL+RI+VYYNEA+ GKYVPR +L+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 42



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 177


>AB088100-1|BAC54932.1|  444|Homo sapiens tubulin, beta polypeptide
           protein.
          Length = 444

 Score =  147 bits (356), Expect = 4e-35
 Identities = 72/145 (49%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QL+RI+VYYNEA+ GKYVPR +L+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 42



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 177


>AB062393-1|BAB93480.1|  444|Homo sapiens beta 5-tubulin protein.
          Length = 444

 Score =  147 bits (356), Expect = 4e-35
 Identities = 72/145 (49%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QL+RI+VYYNEA+ GKYVPR +L+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 34/42 (80%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 42



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 177


>AK022340-1|BAB14016.1|  446|Homo sapiens protein ( Homo sapiens
           cDNA FLJ12278 fis, clone MAMMA1001735, highly similar to
           TUBULIN BETA-5 CHAIN. ).
          Length = 446

 Score =  144 bits (348), Expect = 3e-34
 Identities = 72/145 (49%), Positives = 91/145 (62%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNE+S+ KYVPR  L+DL+P TMD+VRSGPFG LFRPDNFV+GQ  A NNWA
Sbjct: 43  QLERINVYYNESSSQKYVPRAALVDLEPGTMDSVRSGPFGQLFRPDNFVFGQTGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E++++ LDV+R+E E     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDAVLDVVRKECEHCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVMPSPKVSDTVVEPYNATL 187



 Score = 75.4 bits (177), Expect = 2e-13
 Identities = 32/42 (76%), Positives = 36/42 (85%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGIDP+G Y GDS L
Sbjct: 1   MREIVHIQAGQCGNQIGTKFWEVISDEHGIDPAGGYVGDSAL 42



 Score = 48.8 bits (111), Expect = 2e-05
 Identities = 23/50 (46%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREE+PDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVMPSPKVSD 177


>BC002654-1|AAH02654.1|  446|Homo sapiens tubulin, beta 6 protein.
          Length = 446

 Score =  143 bits (347), Expect = 5e-34
 Identities = 71/145 (48%), Positives = 91/145 (62%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNE+S+ KYVPR  L+DL+P TMD+VRSGPFG LFRPDNF++GQ  A NNWA
Sbjct: 43  QLERINVYYNESSSQKYVPRAALVDLEPGTMDSVRSGPFGQLFRPDNFIFGQTGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E++++ LDV+R+E E     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDAVLDVVRKECEHCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVMPSPKVSDTVVEPYNATL 187



 Score = 75.4 bits (177), Expect = 2e-13
 Identities = 32/42 (76%), Positives = 36/42 (85%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGIDP+G Y GDS L
Sbjct: 1   MREIVHIQAGQCGNQIGTKFWEVISDEHGIDPAGGYVGDSAL 42



 Score = 48.8 bits (111), Expect = 2e-05
 Identities = 23/50 (46%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREE+PDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVMPSPKVSD 177


>U47634-1|AAC52035.1|  450|Homo sapiens beta-tubulin protein.
          Length = 450

 Score =  142 bits (344), Expect = 1e-33
 Identities = 71/145 (48%), Positives = 92/145 (63%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERI+VYYNEAS+ KYVPR +L+DL+P TMD+VRSG FG LFRPDNF++GQ+ A NNWA
Sbjct: 43  QLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+E E     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 80.6 bits (190), Expect = 5e-15
 Identities = 34/42 (80%), Positives = 37/42 (88%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGIDPSG Y GDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDL 42



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 23/50 (46%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 ++++REEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSD 177


>BT006971-1|AAP35617.1|  797|Homo sapiens tubulin, beta, 4 protein.
          Length = 797

 Score =  142 bits (344), Expect = 1e-33
 Identities = 71/145 (48%), Positives = 92/145 (63%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERI+VYYNEAS+ KYVPR +L+DL+P TMD+VRSG FG LFRPDNF++GQ+ A NNWA
Sbjct: 390 QLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWA 449

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+E E     +   +T +              +   +  P  
Sbjct: 450 KGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDR 509

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 510 IMNTFSVVPSPKVSDTVVEPYNATL 534



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 21/24 (87%), Positives = 22/24 (91%)
 Frame = +1

Query: 184 KFWEVISDEHGIDPSGCYHGDSDL 255
           +FWEVISDEHGIDPSG Y GDSDL
Sbjct: 366 EFWEVISDEHGIDPSGNYVGDSDL 389



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 23/50 (46%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 ++++REEYPDRI+ TFSV PSP+VSD
Sbjct: 475 DCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSD 524


>BC111374-1|AAI11375.1|  447|Homo sapiens TUBB6 protein protein.
          Length = 447

 Score =  142 bits (344), Expect = 1e-33
 Identities = 71/145 (48%), Positives = 91/145 (62%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERI+VYYNE+S+ KYVPR  L+DL+P TMD+VRSGPFG LFRPDNF++GQ  A NNWA
Sbjct: 43  QLERISVYYNESSSKKYVPRAALVDLEPGTMDSVRSGPFGQLFRPDNFIFGQTGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+E E     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKECEHCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVMPSPKVSDTVVEPYNATL 187



 Score = 72.1 bits (169), Expect = 2e-12
 Identities = 31/42 (73%), Positives = 35/42 (83%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGID +G Y GDS L
Sbjct: 1   MREIVHIQAGQCGNQIGTKFWEVISDEHGIDQAGGYVGDSAL 42



 Score = 50.4 bits (115), Expect = 6e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSD 177


>BC003021-1|AAH03021.2|  450|Homo sapiens tubulin, beta 3 protein.
          Length = 450

 Score =  142 bits (344), Expect = 1e-33
 Identities = 71/145 (48%), Positives = 92/145 (63%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERI+VYYNEAS+ KYVPR +L+DL+P TMD+VRSG FG LFRPDNF++GQ+ A NNWA
Sbjct: 43  QLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+E E     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 80.6 bits (190), Expect = 5e-15
 Identities = 34/42 (80%), Positives = 37/42 (88%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGIDPSG Y GDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDL 42



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 23/50 (46%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 ++++REEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSD 177


>BC000748-1|AAH00748.1|  450|Homo sapiens tubulin, beta 3 protein.
          Length = 450

 Score =  142 bits (344), Expect = 1e-33
 Identities = 71/145 (48%), Positives = 92/145 (63%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERI+VYYNEAS+ KYVPR +L+DL+P TMD+VRSG FG LFRPDNF++GQ+ A NNWA
Sbjct: 43  QLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+E E     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 80.6 bits (190), Expect = 5e-15
 Identities = 34/42 (80%), Positives = 37/42 (88%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGIDPSG Y GDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDL 42



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 23/50 (46%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 ++++REEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSD 177


>AK223039-1|BAD96759.1|  450|Homo sapiens tubulin, beta, 4 variant
           protein.
          Length = 450

 Score =  142 bits (344), Expect = 1e-33
 Identities = 71/145 (48%), Positives = 92/145 (63%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERI+VYYNEAS+ KYVPR +L+DL+P TMD+VRSG FG LFRPDNF++GQ+ A NNWA
Sbjct: 43  QLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+E E     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 80.6 bits (190), Expect = 5e-15
 Identities = 34/42 (80%), Positives = 37/42 (88%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGIDPSG Y GDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDL 42



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 23/50 (46%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 ++++REEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSD 177


>AF427491-1|AAL28094.1|  450|Homo sapiens class III beta tubulin
           protein.
          Length = 450

 Score =  142 bits (344), Expect = 1e-33
 Identities = 71/145 (48%), Positives = 92/145 (63%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERI+VYYNEAS+ KYVPR +L+DL+P TMD+VRSG FG LFRPDNF++GQ+ A NNWA
Sbjct: 43  QLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+E E     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 80.6 bits (190), Expect = 5e-15
 Identities = 34/42 (80%), Positives = 37/42 (88%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWEVISDEHGIDPSG Y GDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDL 42



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 23/50 (46%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 ++++REEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSD 177


>BC001678-1|AAH01678.2|  406|Homo sapiens TUBB3 protein protein.
          Length = 406

 Score =  138 bits (335), Expect = 1e-32
 Identities = 69/143 (48%), Positives = 90/143 (62%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           ERI+VYYNEAS+ KYVPR +L+DL+P TMD+VRSG FG LFRPDNF++GQ+ A NNWAKG
Sbjct: 1   ERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKG 60

Query: 441 HYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTELY 620
           HYTEG E+++S LDV+R+E E     +   +T +              +   +  P  + 
Sbjct: 61  HYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIM 120

Query: 621 *PFQSFQVPECRICVVEPYNTTL 689
             F     P+    VVEPYN TL
Sbjct: 121 NTFSVVPSPKVSDTVVEPYNATL 143



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 23/50 (46%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 ++++REEYPDRI+ TFSV PSP+VSD
Sbjct: 84  DCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSD 133


>U83110-1|AAB41497.1|  434|Homo sapiens beta-tubulin protein.
          Length = 434

 Score =  132 bits (319), Expect = 1e-30
 Identities = 68/145 (46%), Positives = 89/145 (61%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINV+++EAS G+YVPR VL+DL+P TMD+VRSGPF  +FRPDNF+  Q  A NNWA
Sbjct: 43  QLERINVHHHEASGGRYVPRAVLVDLEPGTMDSVRSGPFAEVFRPDNFISRQCGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KG YTEG E++ES +DV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGRYTEGAELMESVMDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLLSKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IINTFSILPSPKVSDTVVEPYNATL 187



 Score = 73.3 bits (172), Expect = 7e-13
 Identities = 31/42 (73%), Positives = 33/42 (78%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+  Q G CGNQIG KFWEVISDEH ID +G YHGDS L
Sbjct: 1   MREIVLTQTGQCGNQIGAKFWEVISDEHAIDSAGTYHGDSHL 42



 Score = 50.4 bits (115), Expect = 6e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRII TFS+ PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLLSKIREEYPDRIINTFSILPSPKVSD 177


>U83668-1|AAB48456.1|  433|Homo sapiens beta-tubulin protein.
          Length = 433

 Score =  128 bits (308), Expect = 2e-29
 Identities = 68/145 (46%), Positives = 89/145 (61%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINV+++EAS G+YVPR VL+DL+P TMD+VRSGPF  +FRPDNF+  Q  A NNWA
Sbjct: 43  QLERINVHHHEAS-GRYVPRAVLVDLEPGTMDSVRSGPFAEVFRPDNFISRQCGAGNNWA 101

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KG YTEG E++ES +DV+R+EAE     +   +T +              +   +  P  
Sbjct: 102 KGRYTEGAELMESVMDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLLSKIREEYPDR 161

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 162 IINTFSILPSPKVSDTVVEPYNATL 186



 Score = 73.3 bits (172), Expect = 7e-13
 Identities = 31/42 (73%), Positives = 33/42 (78%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+  Q G CGNQIG KFWEVISDEH ID +G YHGDS L
Sbjct: 1   MREIVLTQTGQCGNQIGAKFWEVISDEHAIDSAGTYHGDSHL 42



 Score = 50.4 bits (115), Expect = 6e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRII TFS+ PSP+VSD
Sbjct: 127 DCLQGFQLTHSLGGGTGSGMGTLLLSKIREEYPDRIINTFSILPSPKVSD 176


>BC033679-1|AAH33679.1|  451|Homo sapiens tubulin, beta 1 protein.
          Length = 451

 Score =  125 bits (302), Expect = 1e-28
 Identities = 63/145 (43%), Positives = 84/145 (57%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERI+VYYNEA   KYVPR VL+DL+P TMD++RS   G LF+PD+FV+G + A NNWA
Sbjct: 43  QLERISVYYNEAYGRKYVPRAVLVDLEPGTMDSIRSSKLGALFQPDSFVHGNSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E++E+ L+V+R E+E     +   +  +                  +  P  
Sbjct: 103 KGHYTEGAELIENVLEVVRHESESCDCLQGFQIVHSLGGGTGSGMGTLLMNKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN  L
Sbjct: 163 IMNSFSVMPSPKVSDTVVEPYNAVL 187



 Score = 63.7 bits (148), Expect = 6e-10
 Identities = 26/42 (61%), Positives = 33/42 (78%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q+G CGNQIG KFWE+I +EHGID +G   G S L
Sbjct: 1   MREIVHIQIGQCGNQIGAKFWEMIGEEHGIDLAGSDRGASAL 42



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +N+IREEYPDRI+ +FSV PSP+VSD
Sbjct: 128 DCLQGFQIVHSLGGGTGSGMGTLLMNKIREEYPDRIMNSFSVMPSPKVSD 177


>AL109840-7|CAC09371.2|  451|Homo sapiens tubulin, beta 1 protein.
          Length = 451

 Score =  125 bits (302), Expect = 1e-28
 Identities = 63/145 (43%), Positives = 84/145 (57%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERI+VYYNEA   KYVPR VL+DL+P TMD++RS   G LF+PD+FV+G + A NNWA
Sbjct: 43  QLERISVYYNEAYGRKYVPRAVLVDLEPGTMDSIRSSKLGALFQPDSFVHGNSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E++E+ L+V+R E+E     +   +  +                  +  P  
Sbjct: 103 KGHYTEGAELIENVLEVVRHESESCDCLQGFQIVHSLGGGTGSGMGTLLMNKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN  L
Sbjct: 163 IMNSFSVMPSPKVSDTVVEPYNAVL 187



 Score = 63.7 bits (148), Expect = 6e-10
 Identities = 26/42 (61%), Positives = 33/42 (78%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q+G CGNQIG KFWE+I +EHGID +G   G S L
Sbjct: 1   MREIVHIQIGQCGNQIGAKFWEMIGEEHGIDLAGSDRGASAL 42



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +N+IREEYPDRI+ +FSV PSP+VSD
Sbjct: 128 DCLQGFQIVHSLGGGTGSGMGTLLMNKIREEYPDRIMNSFSVMPSPKVSD 177


>AJ292757-1|CAC16605.1|  451|Homo sapiens protein ( Homo sapiens
           TUBB1 gene for human beta tubulin 1, class VI. ).
          Length = 451

 Score =  125 bits (302), Expect = 1e-28
 Identities = 63/145 (43%), Positives = 84/145 (57%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERI+VYYNEA   KYVPR VL+DL+P TMD++RS   G LF+PD+FV+G + A NNWA
Sbjct: 43  QLERISVYYNEAYGRKYVPRAVLVDLEPGTMDSIRSSKLGALFQPDSFVHGNSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E++E+ L+V+R E+E     +   +  +                  +  P  
Sbjct: 103 KGHYTEGAELIENVLEVVRHESESCDCLQGFQIVHSLGGGTGSGMGTLLMNKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN  L
Sbjct: 163 IMNSFSVMPSPKVSDTVVEPYNAVL 187



 Score = 63.7 bits (148), Expect = 6e-10
 Identities = 26/42 (61%), Positives = 33/42 (78%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q+G CGNQIG KFWE+I +EHGID +G   G S L
Sbjct: 1   MREIVHIQIGQCGNQIGAKFWEMIGEEHGIDLAGSDRGASAL 42



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +N+IREEYPDRI+ +FSV PSP+VSD
Sbjct: 128 DCLQGFQIVHSLGGGTGSGMGTLLMNKIREEYPDRIMNSFSVMPSPKVSD 177


>BC047518-1|AAH47518.1|  280|Homo sapiens TUBB3 protein protein.
          Length = 280

 Score =  107 bits (256), Expect = 5e-23
 Identities = 54/124 (43%), Positives = 73/124 (58%)
 Frame = +3

Query: 318 VLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEGVEILESALDVIRRE 497
           +L+DL+P TMD+VRSG FG LFRPDNF++GQ+ A NNWAKGHYTEG E+++S LDV+R+E
Sbjct: 1   ILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKE 60

Query: 498 AEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTELY*PFQSFQVPECRICVVEPY 677
            E     +   +T +              +   +  P  +   F     P+    VVEPY
Sbjct: 61  CENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPY 120

Query: 678 NTTL 689
           N TL
Sbjct: 121 NATL 124



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 23/50 (46%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 ++++REEYPDRI+ TFSV PSP+VSD
Sbjct: 65  DCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSD 114


>BX248307-8|CAM25935.1|  372|Homo sapiens tubulin beta polypeptide
           protein.
          Length = 372

 Score = 98.3 bits (234), Expect = 2e-20
 Identities = 51/115 (44%), Positives = 67/115 (58%)
 Frame = +3

Query: 345 MDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEGVEILESALDVIRREAEGWIACKF 524
           MD+VRSGPFG +FRPDNFV+GQ+ A NNWAKGHYTEG E+++S LDV+R+EAE     + 
Sbjct: 1   MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQG 60

Query: 525 SDVTLARWRYRFRIRYATS*TGYAKSIPTELY*PFQSFQVPECRICVVEPYNTTL 689
             +T +              +   +  P  +   F     P+    VVEPYN TL
Sbjct: 61  FQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATL 115



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 56  DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 105


>AL845353-25|CAI41894.1|  372|Homo sapiens tubulin, beta polypeptide
           protein.
          Length = 372

 Score = 98.3 bits (234), Expect = 2e-20
 Identities = 51/115 (44%), Positives = 67/115 (58%)
 Frame = +3

Query: 345 MDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEGVEILESALDVIRREAEGWIACKF 524
           MD+VRSGPFG +FRPDNFV+GQ+ A NNWAKGHYTEG E+++S LDV+R+EAE     + 
Sbjct: 1   MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQG 60

Query: 525 SDVTLARWRYRFRIRYATS*TGYAKSIPTELY*PFQSFQVPECRICVVEPYNTTL 689
             +T +              +   +  P  +   F     P+    VVEPYN TL
Sbjct: 61  FQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATL 115



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 56  DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 105


>AL662848-9|CAI17442.1|  372|Homo sapiens tubulin, beta protein.
          Length = 372

 Score = 98.3 bits (234), Expect = 2e-20
 Identities = 51/115 (44%), Positives = 67/115 (58%)
 Frame = +3

Query: 345 MDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEGVEILESALDVIRREAEGWIACKF 524
           MD+VRSGPFG +FRPDNFV+GQ+ A NNWAKGHYTEG E+++S LDV+R+EAE     + 
Sbjct: 1   MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQG 60

Query: 525 SDVTLARWRYRFRIRYATS*TGYAKSIPTELY*PFQSFQVPECRICVVEPYNTTL 689
             +T +              +   +  P  +   F     P+    VVEPYN TL
Sbjct: 61  FQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATL 115



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 56  DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 105


>AL662797-13|CAI18197.1|  372|Homo sapiens tubulin, beta protein.
          Length = 372

 Score = 98.3 bits (234), Expect = 2e-20
 Identities = 51/115 (44%), Positives = 67/115 (58%)
 Frame = +3

Query: 345 MDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEGVEILESALDVIRREAEGWIACKF 524
           MD+VRSGPFG +FRPDNFV+GQ+ A NNWAKGHYTEG E+++S LDV+R+EAE     + 
Sbjct: 1   MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQG 60

Query: 525 SDVTLARWRYRFRIRYATS*TGYAKSIPTELY*PFQSFQVPECRICVVEPYNTTL 689
             +T +              +   +  P  +   F     P+    VVEPYN TL
Sbjct: 61  FQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATL 115



 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 56  DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 105


>BC127872-1|AAI27873.2|  188|Homo sapiens TUBB2B protein protein.
          Length = 188

 Score = 97.5 bits (232), Expect = 4e-20
 Identities = 50/115 (43%), Positives = 67/115 (58%)
 Frame = +3

Query: 345 MDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEGVEILESALDVIRREAEGWIACKF 524
           MD+VRSGPFG +FRPDNFV+GQ+ A NNWAKGHYTEG E+++S LDV+R+E+E     + 
Sbjct: 1   MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQG 60

Query: 525 SDVTLARWRYRFRIRYATS*TGYAKSIPTELY*PFQSFQVPECRICVVEPYNTTL 689
             +T +              +   +  P  +   F     P+    VVEPYN TL
Sbjct: 61  FQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATL 115



 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 26/56 (46%), Positives = 32/56 (57%)
 Frame = +2

Query: 491 KGS*GLDCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           K S   DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 50  KESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSD 105


>AL713922-2|CAI16219.1|  227|Homo sapiens novel protein similar to
           beta-tubulin 4Q (TUBB4Q)kinase) II gamma protein.
          Length = 227

 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 50/115 (43%), Positives = 66/115 (57%)
 Frame = +3

Query: 345 MDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEGVEILESALDVIRREAEGWIACKF 524
           MD+VRSGPFG +FRPDNF++GQ  A NNWAKGHYTEG E++ES +DV+R+EAE     + 
Sbjct: 1   MDSVRSGPFGQVFRPDNFIFGQCGAGNNWAKGHYTEGAELMESVMDVVRKEAESCDCLQG 60

Query: 525 SDVTLARWRYRFRIRYATS*TGYAKSIPTELY*PFQSFQVPECRICVVEPYNTTL 689
             +T +              +   +  P  +   F     P+    VVEPYN TL
Sbjct: 61  FQLTHSLGGGTGSGMGTLLLSKIREEYPDRIINTFSILPSPKVSDTVVEPYNATL 115



 Score = 50.4 bits (115), Expect = 6e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRII TFS+ PSP+VSD
Sbjct: 56  DCLQGFQLTHSLGGGTGSGMGTLLLSKIREEYPDRIINTFSILPSPKVSD 105


>X01703-1|CAA25855.1|  451|Homo sapiens alpha-tubulin protein.
          Length = 451

 Score = 89.0 bits (211), Expect = 1e-17
 Identities = 53/150 (35%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGWIAC-KFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G++    F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIIDLVLDRIRKLADQCTRLQGFLVFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FSIYPAPQVSTAVVEPYNSIL 189



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 51


>K00558-1|AAA91576.1|  451|Homo sapiens protein ( human
           alpha-tubulin mRNA, complete cds. ).
          Length = 451

 Score = 89.0 bits (211), Expect = 1e-17
 Identities = 53/150 (35%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGWIAC-KFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G++    F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIIDLVLDRIRKLADQCTRLQGFLVFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FSIYPAPQVSTAVVEPYNSIL 189



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 51


>DQ400107-1|ABD60581.1|  451|Homo sapiens alpha tubulin protein.
          Length = 451

 Score = 89.0 bits (211), Expect = 1e-17
 Identities = 53/150 (35%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGWIAC-KFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G++    F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FSIYPAPQVSTAVVEPYNSIL 189



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 51


>BC071904-1|AAH71904.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score = 89.0 bits (211), Expect = 1e-17
 Identities = 53/150 (35%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGWIAC-KFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G++    F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FSIYPAPQVSTAVVEPYNSIL 189



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 51


>BC063036-1|AAH63036.1|  449|Homo sapiens tubulin, alpha 1c protein.
          Length = 449

 Score = 89.0 bits (211), Expect = 1e-17
 Identities = 53/150 (35%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGWIAC-KFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G++    F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FSIYPAPQVSTAVVEPYNSIL 189



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 51


>BC051297-1|AAH51297.1|  449|Homo sapiens tubulin, alpha 1c protein.
          Length = 449

 Score = 89.0 bits (211), Expect = 1e-17
 Identities = 53/150 (35%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGWIAC-KFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G++    F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FSIYPAPQVSTAVVEPYNSIL 189



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 51


>BC050637-1|AAH50637.1|  451|Homo sapiens tubulin, alpha 1a protein.
          Length = 451

 Score = 89.0 bits (211), Expect = 1e-17
 Identities = 53/150 (35%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGWIAC-KFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G++    F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FSIYPAPQVSTAVVEPYNSIL 189



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 51


>BC030820-1|AAH30820.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score = 89.0 bits (211), Expect = 1e-17
 Identities = 53/150 (35%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGWIAC-KFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G++    F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FSIYPAPQVSTAVVEPYNSIL 189



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 51


>BC021088-1|AAH21088.1|  449|Homo sapiens tubulin, alpha 1c protein.
          Length = 449

 Score = 89.0 bits (211), Expect = 1e-17
 Identities = 53/150 (35%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGWIAC-KFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G++    F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FSIYPAPQVSTAVVEPYNSIL 189



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 51


>BC019298-1|AAH19298.1|  449|Homo sapiens tubulin, alpha 1c protein.
          Length = 449

 Score = 89.0 bits (211), Expect = 1e-17
 Identities = 53/150 (35%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGWIAC-KFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G++    F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FSIYPAPQVSTAVVEPYNSIL 189



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 51


>BC017004-1|AAH17004.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score = 89.0 bits (211), Expect = 1e-17
 Identities = 53/150 (35%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGWIAC-KFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G++    F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FSIYPAPQVSTAVVEPYNSIL 189



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 51


>BC015883-1|AAH15883.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score = 89.0 bits (211), Expect = 1e-17
 Identities = 53/150 (35%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGWIAC-KFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G++    F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FSIYPAPQVSTAVVEPYNSIL 189



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 51


>BC011790-1|AAH11790.1|  449|Homo sapiens tubulin, alpha 1c protein.
          Length = 449

 Score = 89.0 bits (211), Expect = 1e-17
 Identities = 53/150 (35%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGWIAC-KFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G++    F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FSIYPAPQVSTAVVEPYNSIL 189



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 51


>BC011572-1|AAH11572.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score = 89.0 bits (211), Expect = 1e-17
 Identities = 53/150 (35%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGWIAC-KFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G++    F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FSIYPAPQVSTAVVEPYNSIL 189



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 51


>BC010494-1|AAH10494.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score = 89.0 bits (211), Expect = 1e-17
 Identities = 53/150 (35%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGWIAC-KFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G++    F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FSIYPAPQVSTAVVEPYNSIL 189



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 51


>BC009513-1|AAH09513.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score = 89.0 bits (211), Expect = 1e-17
 Identities = 53/150 (35%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGWIAC-KFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G++    F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FSIYPAPQVSTAVVEPYNSIL 189



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 51


>BC009512-1|AAH09512.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score = 89.0 bits (211), Expect = 1e-17
 Identities = 53/150 (35%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGWIAC-KFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G++    F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FSIYPAPQVSTAVVEPYNSIL 189



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 51


>BC009509-1|AAH09509.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score = 89.0 bits (211), Expect = 1e-17
 Identities = 53/150 (35%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGWIAC-KFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G++    F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FSIYPAPQVSTAVVEPYNSIL 189



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 51


>BC009314-1|AAH09314.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score = 89.0 bits (211), Expect = 1e-17
 Identities = 53/150 (35%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGWIAC-KFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G++    F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FSIYPAPQVSTAVVEPYNSIL 189



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 51


>BC008659-1|AAH08659.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score = 89.0 bits (211), Expect = 1e-17
 Identities = 53/150 (35%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGWIAC-KFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G++    F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FSIYPAPQVSTAVVEPYNSIL 189



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 51


>BC006481-1|AAH06481.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score = 89.0 bits (211), Expect = 1e-17
 Identities = 53/150 (35%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGWIAC-KFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G++    F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FSIYPAPQVSTAVVEPYNSIL 189



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 51


>BC006468-1|AAH06468.1|  451|Homo sapiens tubulin, alpha 1a protein.
          Length = 451

 Score = 89.0 bits (211), Expect = 1e-17
 Identities = 53/150 (35%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGWIAC-KFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G++    F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FSIYPAPQVSTAVVEPYNSIL 189



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 51


>BC006379-1|AAH06379.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score = 89.0 bits (211), Expect = 1e-17
 Identities = 53/150 (35%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGWIAC-KFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G++    F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FSIYPAPQVSTAVVEPYNSIL 189



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 51


>BC005946-1|AAH05946.1|  449|Homo sapiens tubulin, alpha 1c protein.
          Length = 449

 Score = 89.0 bits (211), Expect = 1e-17
 Identities = 53/150 (35%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGWIAC-KFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G++    F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FSIYPAPQVSTAVVEPYNSIL 189



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 51


>BC004949-1|AAH04949.1|  449|Homo sapiens tubulin, alpha 1c protein.
          Length = 449

 Score = 89.0 bits (211), Expect = 1e-17
 Identities = 53/150 (35%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGWIAC-KFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G++    F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FSIYPAPQVSTAVVEPYNSIL 189



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 51


>BC001128-1|AAH01128.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score = 89.0 bits (211), Expect = 1e-17
 Identities = 53/150 (35%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGWIAC-KFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G++    F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FSIYPAPQVSTAVVEPYNSIL 189



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 51


>BC000696-1|AAH00696.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score = 89.0 bits (211), Expect = 1e-17
 Identities = 53/150 (35%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGWIAC-KFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G++    F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FSIYPAPQVSTAVVEPYNSIL 189



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 51


>AK223024-1|BAD96744.1|  449|Homo sapiens tubulin alpha 6 variant
           protein.
          Length = 449

 Score = 89.0 bits (211), Expect = 1e-17
 Identities = 53/150 (35%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGWIAC-KFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G++    F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FSIYPAPQVSTAVVEPYNSIL 189



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 51


>AF141347-1|AAD33871.1|  451|Homo sapiens alpha-tubulin protein.
          Length = 451

 Score = 89.0 bits (211), Expect = 1e-17
 Identities = 53/150 (35%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGWIAC-KFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G++    F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FSIYPAPQVSTAVVEPYNSIL 189



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 51


>AF081484-1|AAC31959.1|  451|Homo sapiens alpha-tubulin isoform 1
           protein.
          Length = 451

 Score = 89.0 bits (211), Expect = 1e-17
 Identities = 53/150 (35%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGWIAC-KFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G++    F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FSIYPAPQVSTAVVEPYNSIL 189



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 51


>DQ422808-1|ABD72607.1|  450|Homo sapiens tubulin, alpha 2 protein.
          Length = 450

 Score = 87.8 bits (208), Expect = 3e-17
 Identities = 54/150 (36%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGW-IACKFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G+ I   F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FAIYPAPQVSTAVVEPYNSIL 189



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 51


>BC057810-1|AAH57810.1|  450|Homo sapiens tubulin, alpha 3d protein.
          Length = 450

 Score = 87.8 bits (208), Expect = 3e-17
 Identities = 54/150 (36%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGW-IACKFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G+ I   F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FAIYPAPQVSTAVVEPYNSIL 189



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 51


>BC011721-1|AAH11721.1|  418|Homo sapiens tubulin, alpha 3c protein.
          Length = 418

 Score = 87.8 bits (208), Expect = 3e-17
 Identities = 54/150 (36%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGW-IACKFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G+ I   F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FAIYPAPQVSTAVVEPYNSIL 189



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 51


>AL139327-3|CAH73534.1|  450|Homo sapiens tubulin, alpha 3c protein.
          Length = 450

 Score = 87.8 bits (208), Expect = 3e-17
 Identities = 54/150 (36%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGW-IACKFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G+ I   F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FAIYPAPQVSTAVVEPYNSIL 189



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 51


>AF005392-1|AAC39578.1|  449|Homo sapiens alpha tubulin protein.
          Length = 449

 Score = 87.8 bits (208), Expect = 3e-17
 Identities = 54/150 (36%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 46  DSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARG 105

Query: 441 HYTEGVEILESALDVIRREA------EGW-IACKFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G+ I   F   T + +      R +     Y K
Sbjct: 106 HYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVD---YGK 162

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 163 KSKLE----FAIYPAPQVSTAVVEPYNSIL 188



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 19/50 (38%), Positives = 24/50 (48%)
 Frame = +1

Query: 133 REIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           RE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 50


>X06956-1|CAA30026.1|  447|Homo sapiens alpha-tubulin protein.
          Length = 447

 Score = 87.0 bits (206), Expect = 6e-17
 Identities = 51/150 (34%), Positives = 79/150 (52%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +    ++ E  AGK+VPR V +DL+P  +D +R+GP+  LF P+  + G+  AANN+A+G
Sbjct: 46  DSFTTFFCETGAGKHVPRAVFVDLEPTVIDEIRNGPYRQLFHPEQLITGKEDAANNYARG 105

Query: 441 HYTEGVEILESALDVIRREA------EGWIAC-KFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ +      +G++    F   T + +      R +     Y K
Sbjct: 106 HYTIGKEIIDPVLDRIRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVD---YGK 162

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 163 KSKLE----FSIYPAPQVSTAVVEPYNSIL 188



 Score = 40.7 bits (91), Expect = 0.005
 Identities = 19/50 (38%), Positives = 25/50 (50%)
 Frame = +1

Query: 133 REIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           RE I++ VG  G Q+G   WE+   EHGI P G    D  +     + TT
Sbjct: 1   RECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFTT 50


>BT006731-1|AAP35377.1|  448|Homo sapiens tubulin, alpha 1 (testis
           specific) protein.
          Length = 448

 Score = 87.0 bits (206), Expect = 6e-17
 Identities = 51/150 (34%), Positives = 79/150 (52%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +    ++ E  AGK+VPR V +DL+P  +D +R+GP+  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFTTFFCETGAGKHVPRAVFVDLEPTVIDEIRNGPYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGWIAC-KFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ +      +G++    F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIIDPVLDRIRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FSIYPAPQVSTAVVEPYNSIL 189



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 20/51 (39%), Positives = 26/51 (50%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G Q+G   WE+   EHGI P G    D  +     + TT
Sbjct: 1   MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFTT 51


>BC009238-1|AAH09238.1|  448|Homo sapiens tubulin, alpha 4a protein.
          Length = 448

 Score = 87.0 bits (206), Expect = 6e-17
 Identities = 51/150 (34%), Positives = 79/150 (52%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +    ++ E  AGK+VPR V +DL+P  +D +R+GP+  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFTTFFCETGAGKHVPRAVFVDLEPTVIDEIRNGPYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGWIAC-KFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ +      +G++    F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIIDPVLDRIRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FSIYPAPQVSTAVVEPYNSIL 189



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 20/51 (39%), Positives = 26/51 (50%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G Q+G   WE+   EHGI P G    D  +     + TT
Sbjct: 1   MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFTT 51


>AY895018-1|AAW65371.1|  448|Homo sapiens tubulin, alpha 1 (testis
           specific) protein.
          Length = 448

 Score = 87.0 bits (206), Expect = 6e-17
 Identities = 51/150 (34%), Positives = 79/150 (52%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +    ++ E  AGK+VPR V +DL+P  +D +R+GP+  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFTTFFCETGAGKHVPRAVFVDLEPTVIDEIRNGPYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGWIAC-KFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ +      +G++    F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIIDPVLDRIRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FSIYPAPQVSTAVVEPYNSIL 189



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 20/51 (39%), Positives = 26/51 (50%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G Q+G   WE+   EHGI P G    D  +     + TT
Sbjct: 1   MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFTT 51


>BC057811-1|AAH57811.1|  450|Homo sapiens tubulin, alpha 3e protein.
          Length = 450

 Score = 86.2 bits (204), Expect = 1e-16
 Identities = 53/150 (35%), Positives = 81/150 (54%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AA+N+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAASNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGW-IACKFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G+ I   F   T + +      R +     Y+K
Sbjct: 107 HYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVD---YSK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FAIYPAPQVSTAVVEPYNSIL 189



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 51


>BC033064-1|AAH33064.1|  325|Homo sapiens TUBA1C protein protein.
          Length = 325

 Score = 84.2 bits (199), Expect = 4e-16
 Identities = 35/78 (44%), Positives = 53/78 (67%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRR 494
           HYT G EI++  LD I +
Sbjct: 107 HYTIGKEIIDLVLDRIHK 124



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 51


>CR456600-1|CAG30486.1|  449|Homo sapiens TUBA8 protein.
          Length = 449

 Score = 80.6 bits (190), Expect = 5e-15
 Identities = 34/78 (43%), Positives = 52/78 (66%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +    +++E   GK+VPR V+IDL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFTTFFSETGNGKHVPRAVMIDLEPTVVDEVRAGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRR 494
           HYT G E ++  LD IR+
Sbjct: 107 HYTVGKESIDLVLDRIRK 124



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 21/58 (36%), Positives = 28/58 (48%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTTTRHRLGN 303
           MRE I++ VG  G QIG   WE+   EHGI   G +   +   +   + TT     GN
Sbjct: 1   MRECISVHVGQAGVQIGNACWELFCLEHGIQADGTFDAQASKINDDDSFTTFFSETGN 58


>BX537702-1|CAD97815.1|  479|Homo sapiens hypothetical protein
           protein.
          Length = 479

 Score = 80.6 bits (190), Expect = 5e-15
 Identities = 34/78 (43%), Positives = 52/78 (66%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +    +++E   GK+VPR V+IDL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 46  DSFTTFFSETGNGKHVPRAVMIDLEPTVVDEVRAGTYRQLFHPEQLITGKEDAANNYARG 105

Query: 441 HYTEGVEILESALDVIRR 494
           HYT G E ++  LD IR+
Sbjct: 106 HYTVGKESIDLVLDRIRK 123



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 20/57 (35%), Positives = 27/57 (47%)
 Frame = +1

Query: 133 REIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTTTRHRLGN 303
           RE I++ VG  G QIG   WE+   EHGI   G +   +   +   + TT     GN
Sbjct: 1   RECISVHVGQAGVQIGNACWELFCLEHGIQADGTFDAQASKINDDDSFTTFFSETGN 57


>BC104845-1|AAI04846.1|  449|Homo sapiens tubulin, alpha 8 protein.
          Length = 449

 Score = 80.6 bits (190), Expect = 5e-15
 Identities = 34/78 (43%), Positives = 52/78 (66%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +    +++E   GK+VPR V+IDL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFTTFFSETGNGKHVPRAVMIDLEPTVVDEVRAGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRR 494
           HYT G E ++  LD IR+
Sbjct: 107 HYTVGKESIDLVLDRIRK 124



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 21/58 (36%), Positives = 28/58 (48%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTTTRHRLGN 303
           MRE I++ VG  G QIG   WE+   EHGI   G +   +   +   + TT     GN
Sbjct: 1   MRECISVHVGQAGVQIGNACWELFCLEHGIQADGTFDAQASKINDDDSFTTFFSETGN 58


>BC074827-1|AAH74827.1|  449|Homo sapiens tubulin, alpha 8 protein.
          Length = 449

 Score = 80.6 bits (190), Expect = 5e-15
 Identities = 34/78 (43%), Positives = 52/78 (66%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +    +++E   GK+VPR V+IDL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFTTFFSETGNGKHVPRAVMIDLEPTVVDEVRAGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRR 494
           HYT G E ++  LD IR+
Sbjct: 107 HYTVGKESIDLVLDRIRK 124



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 21/58 (36%), Positives = 28/58 (48%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTTTRHRLGN 303
           MRE I++ VG  G QIG   WE+   EHGI   G +   +   +   + TT     GN
Sbjct: 1   MRECISVHVGQAGVQIGNACWELFCLEHGIQADGTFDAQASKINDDDSFTTFFSETGN 58


>AJ245922-1|CAB88036.1|  449|Homo sapiens alpha-tubulin 8 protein.
          Length = 449

 Score = 80.6 bits (190), Expect = 5e-15
 Identities = 34/78 (43%), Positives = 52/78 (66%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +    +++E   GK+VPR V+IDL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFTTFFSETGNGKHVPRAVMIDLEPTVVDEVRAGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRR 494
           HYT G E ++  LD IR+
Sbjct: 107 HYTVGKESIDLVLDRIRK 124



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 21/58 (36%), Positives = 28/58 (48%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTTTRHRLGN 303
           MRE I++ VG  G QIG   WE+   EHGI   G +   +   +   + TT     GN
Sbjct: 1   MRECISVHVGQAGVQIGNACWELFCLEHGIQADGTFDAQASKINDDDSFTTFFSETGN 58


>BC021564-1|AAH21564.1|  335|Homo sapiens TUBA1B protein protein.
          Length = 335

 Score = 74.1 bits (174), Expect = 4e-13
 Identities = 29/63 (46%), Positives = 44/63 (69%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYT 449
           HYT
Sbjct: 107 HYT 109



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 51


>BC105634-1|AAI05635.1|  446|Homo sapiens tubulin, alpha-like 3
           protein.
          Length = 446

 Score = 72.9 bits (171), Expect = 1e-12
 Identities = 30/78 (38%), Positives = 51/78 (65%)
 Frame = +3

Query: 270 NVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYT 449
           + ++ E  AGK+VPR + +DL+P  +D +R+G    LF P+  + G+  AANN+A+G Y+
Sbjct: 57  DTFFCETRAGKHVPRALFVDLEPTVIDGIRTGQHRSLFHPEQLLSGKEDAANNYARGRYS 116

Query: 450 EGVEILESALDVIRREAE 503
            G E+++  L+  R+ AE
Sbjct: 117 VGSEVIDLVLERTRKLAE 134



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 16/34 (47%), Positives = 22/34 (64%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           MRE +++ +G  G QIG   WE+   EHGI P+G
Sbjct: 1   MRECLSIHIGQAGIQIGDACWELYCLEHGIQPNG 34


>BC099716-1|AAH99716.1|  446|Homo sapiens tubulin, alpha-like 3
           protein.
          Length = 446

 Score = 72.9 bits (171), Expect = 1e-12
 Identities = 30/78 (38%), Positives = 51/78 (65%)
 Frame = +3

Query: 270 NVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYT 449
           + ++ E  AGK+VPR + +DL+P  +D +R+G    LF P+  + G+  AANN+A+G Y+
Sbjct: 57  DTFFCETRAGKHVPRALFVDLEPTVIDGIRTGQHRSLFHPEQLLSGKEDAANNYARGRYS 116

Query: 450 EGVEILESALDVIRREAE 503
            G E+++  L+  R+ AE
Sbjct: 117 VGSEVIDLVLERTRKLAE 134



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 16/34 (47%), Positives = 22/34 (64%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           MRE +++ +G  G QIG   WE+   EHGI P+G
Sbjct: 1   MRECLSIHIGQAGIQIGDACWELYCLEHGIQPNG 34


>BC098247-1|AAH98247.1|  406|Homo sapiens TUBAL3 protein protein.
          Length = 406

 Score = 72.9 bits (171), Expect = 1e-12
 Identities = 30/78 (38%), Positives = 51/78 (65%)
 Frame = +3

Query: 270 NVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYT 449
           + ++ E  AGK+VPR + +DL+P  +D +R+G    LF P+  + G+  AANN+A+G Y+
Sbjct: 17  DTFFCETRAGKHVPRALFVDLEPTVIDGIRTGQHRSLFHPEQLLSGKEDAANNYARGRYS 76

Query: 450 EGVEILESALDVIRREAE 503
            G E+++  L+  R+ AE
Sbjct: 77  VGSEVIDLVLERTRKLAE 94


>AL683826-2|CAI23625.1|  446|Homo sapiens tubulin, alpha-like 3
           protein.
          Length = 446

 Score = 72.9 bits (171), Expect = 1e-12
 Identities = 30/78 (38%), Positives = 51/78 (65%)
 Frame = +3

Query: 270 NVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYT 449
           + ++ E  AGK+VPR + +DL+P  +D +R+G    LF P+  + G+  AANN+A+G Y+
Sbjct: 57  DTFFCETRAGKHVPRALFVDLEPTVIDGIRTGQHRSLFHPEQLLSGKEDAANNYARGRYS 116

Query: 450 EGVEILESALDVIRREAE 503
            G E+++  L+  R+ AE
Sbjct: 117 VGSEVIDLVLERTRKLAE 134



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 16/34 (47%), Positives = 22/34 (64%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           MRE +++ +G  G QIG   WE+   EHGI P+G
Sbjct: 1   MRECLSIHIGQAGIQIGDACWELYCLEHGIQPNG 34


>AK025318-1|BAB15110.1|  446|Homo sapiens protein ( Homo sapiens
           cDNA: FLJ21665 fis, clone COL08913. ).
          Length = 446

 Score = 72.9 bits (171), Expect = 1e-12
 Identities = 30/78 (38%), Positives = 51/78 (65%)
 Frame = +3

Query: 270 NVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYT 449
           + ++ E  AGK+VPR + +DL+P  +D +R+G    LF P+  + G+  AANN+A+G Y+
Sbjct: 57  DTFFCETRAGKHVPRALFVDLEPTVIDGIRTGQHRSLFHPEQLLSGKEDAANNYARGRYS 116

Query: 450 EGVEILESALDVIRREAE 503
            G E+++  L+  R+ AE
Sbjct: 117 VGSEVIDLVLERTRKLAE 134



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 16/34 (47%), Positives = 22/34 (64%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           MRE +++ +G  G QIG   WE+   EHGI P+G
Sbjct: 1   MRECLSIHIGQAGIQIGDACWELYCLEHGIQPNG 34


>M61764-1|AAA52620.1|  451|Homo sapiens gamma-tubulin protein.
          Length = 451

 Score = 66.5 bits (155), Expect = 8e-11
 Identities = 30/84 (35%), Positives = 53/84 (63%), Gaps = 2/84 (2%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQN--CAANNWA 434
           +R +V++ +A    Y+PR VL+DL+P  + ++ + P+  L+ P+N    ++   A NNWA
Sbjct: 46  DRKDVFFYQADDEHYIPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWA 105

Query: 435 KGHYTEGVEILESALDVIRREAEG 506
            G +++G +I E   D+I REA+G
Sbjct: 106 SG-FSQGEKIHEDIFDIIDREADG 128



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 20/31 (64%), Positives = 24/31 (77%)
 Frame = +1

Query: 133 REIINLQVGSCGNQIGGKFWEVISDEHGIDP 225
           REII LQ+G CGNQIG +FW+ +  EHGI P
Sbjct: 3   REIITLQLGQCGNQIGFEFWKQLCAEHGISP 33



 Score = 30.7 bits (66), Expect = 5.2
 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 1/48 (2%)
 Frame = +2

Query: 503 GLDCLQVF-RCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPS 643
           G D L+ F  CH+            Y + R+ + YP +++ T+SVFP+
Sbjct: 128 GSDSLEGFVLCHS-IAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPN 174


>CR407642-1|CAG28570.1|  451|Homo sapiens TUBG1 protein.
          Length = 451

 Score = 66.5 bits (155), Expect = 8e-11
 Identities = 30/84 (35%), Positives = 53/84 (63%), Gaps = 2/84 (2%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQN--CAANNWA 434
           +R +V++ +A    Y+PR VL+DL+P  + ++ + P+  L+ P+N    ++   A NNWA
Sbjct: 46  DRKDVFFYQADDEHYIPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWA 105

Query: 435 KGHYTEGVEILESALDVIRREAEG 506
            G +++G +I E   D+I REA+G
Sbjct: 106 SG-FSQGEKIHEDIFDIIDREADG 128



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 21/33 (63%), Positives = 25/33 (75%)
 Frame = +1

Query: 133 REIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           REII LQ+G CGNQIG +FW+ +  EHGI P G
Sbjct: 3   REIITLQLGQCGNQIGFEFWKQLCAEHGISPEG 35



 Score = 30.7 bits (66), Expect = 5.2
 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 1/48 (2%)
 Frame = +2

Query: 503 GLDCLQVF-RCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPS 643
           G D L+ F  CH+            Y + R+ + YP +++ T+SVFP+
Sbjct: 128 GSDSLEGFVLCHS-IAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPN 174


>BT019931-1|AAV38734.1|  451|Homo sapiens tubulin, gamma 1 protein.
          Length = 451

 Score = 66.5 bits (155), Expect = 8e-11
 Identities = 30/84 (35%), Positives = 53/84 (63%), Gaps = 2/84 (2%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQN--CAANNWA 434
           +R +V++ +A    Y+PR VL+DL+P  + ++ + P+  L+ P+N    ++   A NNWA
Sbjct: 46  DRKDVFFYQADDEHYIPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWA 105

Query: 435 KGHYTEGVEILESALDVIRREAEG 506
            G +++G +I E   D+I REA+G
Sbjct: 106 SG-FSQGEKIHEDIFDIIDREADG 128



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 21/33 (63%), Positives = 25/33 (75%)
 Frame = +1

Query: 133 REIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           REII LQ+G CGNQIG +FW+ +  EHGI P G
Sbjct: 3   REIITLQLGQCGNQIGFEFWKQLCAEHGISPEG 35



 Score = 30.7 bits (66), Expect = 5.2
 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 1/48 (2%)
 Frame = +2

Query: 503 GLDCLQVF-RCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPS 643
           G D L+ F  CH+            Y + R+ + YP +++ T+SVFP+
Sbjct: 128 GSDSLEGFVLCHS-IAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPN 174


>BC108739-1|AAI08740.1|  451|Homo sapiens tubulin, gamma 2 protein.
          Length = 451

 Score = 66.5 bits (155), Expect = 8e-11
 Identities = 30/84 (35%), Positives = 53/84 (63%), Gaps = 2/84 (2%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQN--CAANNWA 434
           +R +V++ +A    Y+PR VL+DL+P  + ++ + P+  L+ P+N    ++   A NNWA
Sbjct: 46  DRKDVFFYQADDEHYIPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWA 105

Query: 435 KGHYTEGVEILESALDVIRREAEG 506
            G +++G +I E   D+I REA+G
Sbjct: 106 SG-FSQGEKIHEDIFDIIDREADG 128



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 21/33 (63%), Positives = 25/33 (75%)
 Frame = +1

Query: 133 REIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           REII LQ+G CGNQIG +FW+ +  EHGI P G
Sbjct: 3   REIITLQLGQCGNQIGFEFWKQLCAEHGISPEG 35



 Score = 30.3 bits (65), Expect = 6.8
 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 1/47 (2%)
 Frame = +2

Query: 503 GLDCLQVF-RCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFP 640
           G D L+ F  CH+            Y + R+ + YP +++ T+SVFP
Sbjct: 128 GSDSLEGFVLCHS-IAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFP 173


>BC051890-1|AAH51890.1|  451|Homo sapiens tubulin, gamma 2 protein.
          Length = 451

 Score = 66.5 bits (155), Expect = 8e-11
 Identities = 30/84 (35%), Positives = 53/84 (63%), Gaps = 2/84 (2%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQN--CAANNWA 434
           +R +V++ +A    Y+PR VL+DL+P  + ++ + P+  L+ P+N    ++   A NNWA
Sbjct: 46  DRKDVFFYQADDEHYIPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWA 105

Query: 435 KGHYTEGVEILESALDVIRREAEG 506
            G +++G +I E   D+I REA+G
Sbjct: 106 SG-FSQGEKIHEDIFDIIDREADG 128



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 21/33 (63%), Positives = 25/33 (75%)
 Frame = +1

Query: 133 REIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           REII LQ+G CGNQIG +FW+ +  EHGI P G
Sbjct: 3   REIITLQLGQCGNQIGFEFWKQLCAEHGISPEG 35



 Score = 30.3 bits (65), Expect = 6.8
 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 1/47 (2%)
 Frame = +2

Query: 503 GLDCLQVF-RCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFP 640
           G D L+ F  CH+            Y + R+ + YP +++ T+SVFP
Sbjct: 128 GSDSLEGFVLCHS-IAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFP 173


>BC009670-1|AAH09670.1|  451|Homo sapiens tubulin, gamma 2 protein.
          Length = 451

 Score = 66.5 bits (155), Expect = 8e-11
 Identities = 30/84 (35%), Positives = 53/84 (63%), Gaps = 2/84 (2%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQN--CAANNWA 434
           +R +V++ +A    Y+PR VL+DL+P  + ++ + P+  L+ P+N    ++   A NNWA
Sbjct: 46  DRKDVFFYQADDEHYIPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWA 105

Query: 435 KGHYTEGVEILESALDVIRREAEG 506
            G +++G +I E   D+I REA+G
Sbjct: 106 SG-FSQGEKIHEDIFDIIDREADG 128



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 21/33 (63%), Positives = 25/33 (75%)
 Frame = +1

Query: 133 REIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           REII LQ+G CGNQIG +FW+ +  EHGI P G
Sbjct: 3   REIITLQLGQCGNQIGFEFWKQLCAEHGISPEG 35



 Score = 30.3 bits (65), Expect = 6.8
 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 1/47 (2%)
 Frame = +2

Query: 503 GLDCLQVF-RCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFP 640
           G D L+ F  CH+            Y + R+ + YP +++ T+SVFP
Sbjct: 128 GSDSLEGFVLCHS-IAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFP 173


>BC000619-1|AAH00619.1|  451|Homo sapiens tubulin, gamma 1 protein.
          Length = 451

 Score = 66.5 bits (155), Expect = 8e-11
 Identities = 30/84 (35%), Positives = 53/84 (63%), Gaps = 2/84 (2%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQN--CAANNWA 434
           +R +V++ +A    Y+PR VL+DL+P  + ++ + P+  L+ P+N    ++   A NNWA
Sbjct: 46  DRKDVFFYQADDEHYIPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWA 105

Query: 435 KGHYTEGVEILESALDVIRREAEG 506
            G +++G +I E   D+I REA+G
Sbjct: 106 SG-FSQGEKIHEDIFDIIDREADG 128



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 21/33 (63%), Positives = 25/33 (75%)
 Frame = +1

Query: 133 REIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           REII LQ+G CGNQIG +FW+ +  EHGI P G
Sbjct: 3   REIITLQLGQCGNQIGFEFWKQLCAEHGISPEG 35



 Score = 30.7 bits (66), Expect = 5.2
 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 1/48 (2%)
 Frame = +2

Query: 503 GLDCLQVF-RCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPS 643
           G D L+ F  CH+            Y + R+ + YP +++ T+SVFP+
Sbjct: 128 GSDSLEGFVLCHS-IAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPN 174


>AK022324-1|BAB14012.1|  451|Homo sapiens protein ( Homo sapiens
           cDNA FLJ12262 fis, clone MAMMA1001576, highly similar to
           Human gamma-tubulin mRNA. ).
          Length = 451

 Score = 66.5 bits (155), Expect = 8e-11
 Identities = 30/84 (35%), Positives = 53/84 (63%), Gaps = 2/84 (2%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQN--CAANNWA 434
           +R +V++ +A    Y+PR VL+DL+P  + ++ + P+  L+ P+N    ++   A NNWA
Sbjct: 46  DRKDVFFYQADDEHYIPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWA 105

Query: 435 KGHYTEGVEILESALDVIRREAEG 506
            G +++G +I E   D+I REA+G
Sbjct: 106 SG-FSQGEKIHEDIFDIIDREADG 128



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 21/33 (63%), Positives = 25/33 (75%)
 Frame = +1

Query: 133 REIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           REII LQ+G CGNQIG +FW+ +  EHGI P G
Sbjct: 3   REIITLQLGQCGNQIGFEFWKQLCAEHGISPEG 35



 Score = 30.3 bits (65), Expect = 6.8
 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 1/47 (2%)
 Frame = +2

Query: 503 GLDCLQVF-RCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFP 640
           G D L+ F  CH+            Y + R+ + YP +++ T+SVFP
Sbjct: 128 GSDSLEGFVLCHS-IAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFP 173


>AF225971-1|AAF34188.1|  451|Homo sapiens gamma-tubulin protein.
          Length = 451

 Score = 66.5 bits (155), Expect = 8e-11
 Identities = 30/84 (35%), Positives = 53/84 (63%), Gaps = 2/84 (2%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQN--CAANNWA 434
           +R +V++ +A    Y+PR VL+DL+P  + ++ + P+  L+ P+N    ++   A NNWA
Sbjct: 46  DRKDVFFYQADDEHYIPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWA 105

Query: 435 KGHYTEGVEILESALDVIRREAEG 506
            G +++G +I E   D+I REA+G
Sbjct: 106 SG-FSQGEKIHEDIFDIIDREADG 128



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 21/33 (63%), Positives = 25/33 (75%)
 Frame = +1

Query: 133 REIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           REII LQ+G CGNQIG +FW+ +  EHGI P G
Sbjct: 3   REIITLQLGQCGNQIGFEFWKQLCAEHGISPEG 35



 Score = 30.3 bits (65), Expect = 6.8
 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 1/47 (2%)
 Frame = +2

Query: 503 GLDCLQVF-RCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFP 640
           G D L+ F  CH+            Y + R+ + YP +++ T+SVFP
Sbjct: 128 GSDSLEGFVLCHS-IAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFP 173


>AL713922-3|CAI16220.1|  410|Homo sapiens novel protein similar to
           beta-tubulin 4Q (TUBB4Q)kinase) II gamma protein.
          Length = 410

 Score = 61.7 bits (143), Expect = 2e-09
 Identities = 36/97 (37%), Positives = 48/97 (49%)
 Frame = +3

Query: 399 VYGQNCAANNWAKGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYAT 578
           V GQ  A NNWAKGHYTEG E++ES +DV+R+EAE     +   +T +            
Sbjct: 57  VAGQCGAGNNWAKGHYTEGAELMESVMDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTL 116

Query: 579 S*TGYAKSIPTELY*PFQSFQVPECRICVVEPYNTTL 689
             +   +  P  +   F     P+    VVEPYN TL
Sbjct: 117 LLSKIREEYPDRIINTFSILPSPKVSDTVVEPYNATL 153



 Score = 50.4 bits (115), Expect = 6e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRII TFS+ PSP+VSD
Sbjct: 94  DCLQGFQLTHSLGGGTGSGMGTLLLSKIREEYPDRIINTFSILPSPKVSD 143


>AY533484-1|AAS86429.1|   98|Homo sapiens tubulin alpha-1 protein.
          Length = 98

 Score = 52.8 bits (121), Expect = 1e-06
 Identities = 24/53 (45%), Positives = 36/53 (67%)
 Frame = +3

Query: 345 MDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEGVEILESALDVIRREAE 503
           +D VR+G +  LF P+  + G+  AANN+A+GHYT G EI++  L  IR+ A+
Sbjct: 1   IDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLYRIRKLAD 53


>BC127874-1|AAI27875.1|  151|Homo sapiens Unknown (protein for
           IMAGE:40134249) protein.
          Length = 151

 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 26/56 (46%), Positives = 32/56 (57%)
 Frame = +2

Query: 491 KGS*GLDCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           K S   DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 8   KESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSD 63


>AL050056-1|CAB43252.1|  325|Homo sapiens hypothetical protein
           protein.
          Length = 325

 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 26/56 (46%), Positives = 32/56 (57%)
 Frame = +2

Query: 491 KGS*GLDCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           K S   DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 2   KESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSD 57


>AF035316-1|AAB88188.1|  342|Homo sapiens protein ( Homo sapiens
           clone 23678 mRNA, partial cds. ).
          Length = 342

 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 26/56 (46%), Positives = 32/56 (57%)
 Frame = +2

Query: 491 KGS*GLDCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           K S   DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 19  KESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSD 74



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 26/84 (30%), Positives = 39/84 (46%)
 Frame = +3

Query: 438 GHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTEL 617
           GHYTEG E+++S LDV+R+E+E     +   +T +              +   +  P  +
Sbjct: 1   GHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRI 60

Query: 618 Y*PFQSFQVPECRICVVEPYNTTL 689
              F     P+    VVEPYN TL
Sbjct: 61  MNTFSVMPSPKVSDTVVEPYNATL 84


>BC001896-1|AAH01896.1|  340|Homo sapiens TUBB protein protein.
          Length = 340

 Score = 50.0 bits (114), Expect = 8e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 24  DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 73



 Score = 40.7 bits (91), Expect = 0.005
 Identities = 26/83 (31%), Positives = 38/83 (45%)
 Frame = +3

Query: 441 HYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTELY 620
           HYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  + 
Sbjct: 1   HYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIM 60

Query: 621 *PFQSFQVPECRICVVEPYNTTL 689
             F     P+    VVEPYN TL
Sbjct: 61  NTFSVVPSPKVSDTVVEPYNATL 83


>DQ457058-1|ABE96641.1|  208|Homo sapiens XTP3TPA-transactivated
           protein 1 protein.
          Length = 208

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 19/26 (73%), Positives = 24/26 (92%)
 Frame = +2

Query: 581 VNRIREEYPDRIILTFSVFPSPRVSD 658
           +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 6   ISKIREEYPDRIMNTFSVVPSPKVSD 31


>AK024002-1|BAB14767.1|  241|Homo sapiens protein ( Homo sapiens
           cDNA FLJ13940 fis, clone Y79AA1000833, moderately
           similar to TUBULIN ALPHA-1 CHAIN. ).
          Length = 241

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 20/47 (42%), Positives = 30/47 (63%)
 Frame = +3

Query: 363 GPFGCLFRPDNFVYGQNCAANNWAKGHYTEGVEILESALDVIRREAE 503
           G +  +F P+  + G+  AANN+A GHYT G E ++  LD IR+ A+
Sbjct: 20  GTYRQIFHPEQLITGKEDAANNYAWGHYTIGKEFIDLLLDRIRKLAD 66


>Z99289-5|CAI42328.1|  163|Homo sapiens tubulin, epsilon 1 protein.
          Length = 163

 Score = 39.1 bits (87), Expect = 0.015
 Identities = 19/64 (29%), Positives = 31/64 (48%)
 Frame = +3

Query: 312 RTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEGVEILESALDVIR 491
           R VLID++   ++ +  GP   +F     +   + + NNWA GH   G    +  L+  R
Sbjct: 70  RAVLIDMEEGVVNEILQGPLRDVFDTKQLITDISGSGNNWAVGHKVFGSLYQDQILEKFR 129

Query: 492 REAE 503
           + AE
Sbjct: 130 KSAE 133



 Score = 37.1 bits (82), Expect = 0.059
 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 1/37 (2%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEH-GIDPSGCY 237
           M + + +QVG CGNQIG  FW++   EH  ++  G Y
Sbjct: 1   MTQSVVVQVGQCGNQIGCCFWDLALREHAAVNQKGIY 37


>Z99289-4|CAI42327.1|  475|Homo sapiens tubulin, epsilon 1 protein.
          Length = 475

 Score = 39.1 bits (87), Expect = 0.015
 Identities = 19/64 (29%), Positives = 31/64 (48%)
 Frame = +3

Query: 312 RTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEGVEILESALDVIR 491
           R VLID++   ++ +  GP   +F     +   + + NNWA GH   G    +  L+  R
Sbjct: 70  RAVLIDMEEGVVNEILQGPLRDVFDTKQLITDISGSGNNWAVGHKVFGSLYQDQILEKFR 129

Query: 492 REAE 503
           + AE
Sbjct: 130 KSAE 133



 Score = 37.1 bits (82), Expect = 0.059
 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 1/37 (2%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEH-GIDPSGCY 237
           M + + +QVG CGNQIG  FW++   EH  ++  G Y
Sbjct: 1   MTQSVVVQVGQCGNQIGCCFWDLALREHAAVNQKGIY 37


>Z99289-3|CAI42326.1|  206|Homo sapiens tubulin, epsilon 1 protein.
          Length = 206

 Score = 39.1 bits (87), Expect = 0.015
 Identities = 19/64 (29%), Positives = 31/64 (48%)
 Frame = +3

Query: 312 RTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEGVEILESALDVIR 491
           R VLID++   ++ +  GP   +F     +   + + NNWA GH   G    +  L+  R
Sbjct: 26  RAVLIDMEEGVVNEILQGPLRDVFDTKQLITDISGSGNNWAVGHKVFGSLYQDQILEKFR 85

Query: 492 REAE 503
           + AE
Sbjct: 86  KSAE 89


>BC031101-1|AAH31101.1|  475|Homo sapiens tubulin, epsilon 1
           protein.
          Length = 475

 Score = 39.1 bits (87), Expect = 0.015
 Identities = 19/64 (29%), Positives = 31/64 (48%)
 Frame = +3

Query: 312 RTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEGVEILESALDVIR 491
           R VLID++   ++ +  GP   +F     +   + + NNWA GH   G    +  L+  R
Sbjct: 70  RAVLIDMEEGVVNEILQGPLRGVFDTKQLITDISGSGNNWAVGHKVFGSLYQDQILEKFR 129

Query: 492 REAE 503
           + AE
Sbjct: 130 KSAE 133



 Score = 37.1 bits (82), Expect = 0.059
 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 1/37 (2%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEH-GIDPSGCY 237
           M + + +QVG CGNQIG  FW++   EH  ++  G Y
Sbjct: 1   MTQSVVVQVGQCGNQIGCCFWDLALREHAAVNQKGIY 37


>BC025405-1|AAH25405.1|  475|Homo sapiens tubulin, epsilon 1
           protein.
          Length = 475

 Score = 39.1 bits (87), Expect = 0.015
 Identities = 19/64 (29%), Positives = 31/64 (48%)
 Frame = +3

Query: 312 RTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEGVEILESALDVIR 491
           R VLID++   ++ +  GP   +F     +   + + NNWA GH   G    +  L+  R
Sbjct: 70  RAVLIDMEEGVVNEILQGPLRDVFDTKQLITDISGSGNNWAVGHKVFGSLYQDQILEKFR 129

Query: 492 REAE 503
           + AE
Sbjct: 130 KSAE 133



 Score = 37.1 bits (82), Expect = 0.059
 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 1/37 (2%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEH-GIDPSGCY 237
           M + + +QVG CGNQIG  FW++   EH  ++  G Y
Sbjct: 1   MTQSVVVQVGQCGNQIGCCFWDLALREHAAVNQKGIY 37


>AF201334-1|AAF09585.1|  475|Homo sapiens epsilon-tubulin protein.
          Length = 475

 Score = 39.1 bits (87), Expect = 0.015
 Identities = 19/64 (29%), Positives = 31/64 (48%)
 Frame = +3

Query: 312 RTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEGVEILESALDVIR 491
           R VLID++   ++ +  GP   +F     +   + + NNWA GH   G    +  L+  R
Sbjct: 70  RAVLIDMEEGVVNEILQGPLRDVFDTKQLITDISGSGNNWAVGHKVFGSLYQDQILEKFR 129

Query: 492 REAE 503
           + AE
Sbjct: 130 KSAE 133



 Score = 37.1 bits (82), Expect = 0.059
 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 1/37 (2%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEH-GIDPSGCY 237
           M + + +QVG CGNQIG  FW++   EH  ++  G Y
Sbjct: 1   MTQSVVVQVGQCGNQIGCCFWDLALREHAAVNQKGIY 37


>BC000258-1|AAH00258.1|  398|Homo sapiens TUBD1 protein protein.
          Length = 398

 Score = 37.9 bits (84), Expect = 0.034
 Identities = 23/83 (27%), Positives = 42/83 (50%), Gaps = 7/83 (8%)
 Frame = +3

Query: 276 YYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNC-------AANNWA 434
           +++E   G  + R VL+D++P  ++ + S       +   + YGQ+        + NNWA
Sbjct: 50  FFSEEENGVPIARAVLVDMEPKVINQMLSKAA----QSGQWKYGQHACFCQKQGSGNNWA 105

Query: 435 KGHYTEGVEILESALDVIRREAE 503
            G+   G    ES +++IR+E E
Sbjct: 106 YGYSVHGPRHEESIMNIIRKEVE 128



 Score = 30.7 bits (66), Expect = 5.2
 Identities = 12/26 (46%), Positives = 20/26 (76%), Gaps = 1/26 (3%)
 Frame = +1

Query: 139 IINLQVGSCGNQIGGKFWE-VISDEH 213
           I+ +Q+G CGNQIG + ++ ++SD H
Sbjct: 3   IVTVQLGQCGNQIGFEVFDALLSDSH 28


>AF201333-1|AAF09584.1|  453|Homo sapiens delta-tubulin protein.
          Length = 453

 Score = 37.5 bits (83), Expect = 0.045
 Identities = 23/83 (27%), Positives = 41/83 (49%), Gaps = 7/83 (8%)
 Frame = +3

Query: 276 YYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNC-------AANNWA 434
           +++E   G  + R VL+D++P  ++   S       +   + YGQ+        + NNWA
Sbjct: 50  FFSEEENGVPIARAVLVDMEPKVINQTLSKAA----QSGQWKYGQHACFCQKQGSGNNWA 105

Query: 435 KGHYTEGVEILESALDVIRREAE 503
            G+   G    ES +++IR+E E
Sbjct: 106 YGYSVHGPRHEESIMNIIRKEVE 128



 Score = 30.7 bits (66), Expect = 5.2
 Identities = 12/26 (46%), Positives = 20/26 (76%), Gaps = 1/26 (3%)
 Frame = +1

Query: 139 IINLQVGSCGNQIGGKFWE-VISDEH 213
           I+ +Q+G CGNQIG + ++ ++SD H
Sbjct: 3   IVTVQLGQCGNQIGFEVFDALLSDSH 28


>AB031045-1|BAD83581.1|  351|Homo sapiens delta-tubulin isoform
           protein.
          Length = 351

 Score = 37.5 bits (83), Expect = 0.045
 Identities = 23/83 (27%), Positives = 41/83 (49%), Gaps = 7/83 (8%)
 Frame = +3

Query: 276 YYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNC-------AANNWA 434
           +++E   G  + R VL+D++P  ++   S       +   + YGQ+        + NNWA
Sbjct: 50  FFSEEENGVPIARAVLVDMEPKVINQTLSKAA----QSGQWKYGQHACFCQKQGSGNNWA 105

Query: 435 KGHYTEGVEILESALDVIRREAE 503
            G+   G    ES +++IR+E E
Sbjct: 106 YGYSVHGPRHEESIMNIIRKEVE 128



 Score = 30.7 bits (66), Expect = 5.2
 Identities = 12/26 (46%), Positives = 20/26 (76%), Gaps = 1/26 (3%)
 Frame = +1

Query: 139 IINLQVGSCGNQIGGKFWE-VISDEH 213
           I+ +Q+G CGNQIG + ++ ++SD H
Sbjct: 3   IVTVQLGQCGNQIGFEVFDALLSDSH 28


>AB031044-1|BAD83580.1|  398|Homo sapiens delta-tubulin isoform
           protein.
          Length = 398

 Score = 37.5 bits (83), Expect = 0.045
 Identities = 23/83 (27%), Positives = 41/83 (49%), Gaps = 7/83 (8%)
 Frame = +3

Query: 276 YYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNC-------AANNWA 434
           +++E   G  + R VL+D++P  ++   S       +   + YGQ+        + NNWA
Sbjct: 50  FFSEEENGVPIARAVLVDMEPKVINQTLSKAA----QSGQWKYGQHACFCQKQGSGNNWA 105

Query: 435 KGHYTEGVEILESALDVIRREAE 503
            G+   G    ES +++IR+E E
Sbjct: 106 YGYSVHGPRHEESIMNIIRKEVE 128



 Score = 30.7 bits (66), Expect = 5.2
 Identities = 12/26 (46%), Positives = 20/26 (76%), Gaps = 1/26 (3%)
 Frame = +1

Query: 139 IINLQVGSCGNQIGGKFWE-VISDEH 213
           I+ +Q+G CGNQIG + ++ ++SD H
Sbjct: 3   IVTVQLGQCGNQIGFEVFDALLSDSH 28


>AB030837-1|BAD16590.1|  453|Homo sapiens delta tubulin protein.
          Length = 453

 Score = 37.5 bits (83), Expect = 0.045
 Identities = 23/83 (27%), Positives = 41/83 (49%), Gaps = 7/83 (8%)
 Frame = +3

Query: 276 YYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNC-------AANNWA 434
           +++E   G  + R VL+D++P  ++   S       +   + YGQ+        + NNWA
Sbjct: 50  FFSEEENGVPIARAVLVDMEPKVINQTLSKAA----QSGQWKYGQHACFCQKQGSGNNWA 105

Query: 435 KGHYTEGVEILESALDVIRREAE 503
            G+   G    ES +++IR+E E
Sbjct: 106 YGYSVHGPRHEESIMNIIRKEVE 128



 Score = 30.7 bits (66), Expect = 5.2
 Identities = 12/26 (46%), Positives = 20/26 (76%), Gaps = 1/26 (3%)
 Frame = +1

Query: 139 IINLQVGSCGNQIGGKFWE-VISDEH 213
           I+ +Q+G CGNQIG + ++ ++SD H
Sbjct: 3   IVTVQLGQCGNQIGFEVFDALLSDSH 28


>AK024391-1|BAB14906.1| 1811|Homo sapiens protein ( Homo sapiens cDNA
            FLJ14329 fis, clone PLACE4000259, highly similar to
            H.sapiens gene for U5 snRNP-specific 200kD protein. ).
          Length = 1811

 Score = 31.5 bits (68), Expect = 3.0
 Identities = 15/35 (42%), Positives = 22/35 (62%)
 Frame = +3

Query: 300  KYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVY 404
            KY P T L+DL+P  + A+R+  F  L+R D F +
Sbjct: 969  KYPPPTELLDLQPLPVSALRNSAFESLYR-DKFPF 1002


>D87717-1|BAA13442.2| 1086|Homo sapiens KIAA0013 protein.
          Length = 1086

 Score = 30.7 bits (66), Expect = 5.2
 Identities = 18/57 (31%), Positives = 30/57 (52%)
 Frame = +3

Query: 99  ICDEKSIN*QDEGNYQSPGRFLWKPNRRKVLGGDI*RARHRSKRMLPRRLRPQLERI 269
           +C   S+   +EG Y++PG +  K  RR+ +G  +  A ++ K      + PQ ERI
Sbjct: 321 LCATPSLEGFEEGEYETPGEY--KRKRRQSVGDFVSGALNKFKPNRTPSITPQEERI 375


>BC063444-1|AAH63444.1|  501|Homo sapiens Rho GTPase activating
           protein 11A protein.
          Length = 501

 Score = 30.7 bits (66), Expect = 5.2
 Identities = 18/57 (31%), Positives = 30/57 (52%)
 Frame = +3

Query: 99  ICDEKSIN*QDEGNYQSPGRFLWKPNRRKVLGGDI*RARHRSKRMLPRRLRPQLERI 269
           +C   S+   +EG Y++PG +  K  RR+ +G  +  A ++ K      + PQ ERI
Sbjct: 258 LCATPSLEGFEEGEYETPGEY--KRKRRQSVGDFVSGALNKFKPNRTPSITPQEERI 312


>BC039563-1|AAH39563.1| 1023|Homo sapiens Rho GTPase activating
           protein 11A protein.
          Length = 1023

 Score = 30.7 bits (66), Expect = 5.2
 Identities = 18/57 (31%), Positives = 30/57 (52%)
 Frame = +3

Query: 99  ICDEKSIN*QDEGNYQSPGRFLWKPNRRKVLGGDI*RARHRSKRMLPRRLRPQLERI 269
           +C   S+   +EG Y++PG +  K  RR+ +G  +  A ++ K      + PQ ERI
Sbjct: 258 LCATPSLEGFEEGEYETPGEY--KRKRRQSVGDFVSGALNKFKPNRTPSITPQEERI 312


>AK024096-1|BAB14825.1|  199|Homo sapiens protein ( Homo sapiens
           cDNA FLJ14034 fis, clone HEMBA1004499, weakly similar to
           Homo sapiens delta-tubulin mRNA. ).
          Length = 199

 Score = 30.7 bits (66), Expect = 5.2
 Identities = 12/26 (46%), Positives = 20/26 (76%), Gaps = 1/26 (3%)
 Frame = +1

Query: 139 IINLQVGSCGNQIGGKFWE-VISDEH 213
           I+ +Q+G CGNQIG + ++ ++SD H
Sbjct: 3   IVTVQLGQCGNQIGFEVFDALLSDSH 28


>Z70200-1|CAA94089.1| 1701|Homo sapiens U5 snRNP-specific 200kD
           protein protein.
          Length = 1701

 Score = 29.9 bits (64), Expect = 9.0
 Identities = 14/35 (40%), Positives = 22/35 (62%)
 Frame = +3

Query: 300 KYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVY 404
           KY P T L+DL+P  + A+R+  F  L++ D F +
Sbjct: 859 KYPPPTELLDLQPLPVSALRNSAFESLYQ-DKFPF 892


>BC112891-1|AAI12892.1| 1887|Homo sapiens ASCC3L1 protein protein.
          Length = 1887

 Score = 29.9 bits (64), Expect = 9.0
 Identities = 14/35 (40%), Positives = 22/35 (62%)
 Frame = +3

Query: 300  KYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVY 404
            KY P T L+DL+P  + A+R+  F  L++ D F +
Sbjct: 1045 KYPPPTELLDLQPLPVSALRNSAFESLYQ-DKFPF 1078


>BC065924-1|AAH65924.1| 1821|Homo sapiens ASCC3L1 protein protein.
          Length = 1821

 Score = 29.9 bits (64), Expect = 9.0
 Identities = 14/35 (40%), Positives = 22/35 (62%)
 Frame = +3

Query: 300  KYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVY 404
            KY P T L+DL+P  + A+R+  F  L++ D F +
Sbjct: 979  KYPPPTELLDLQPLPVSALRNSAFESLYQ-DKFPF 1012


>BC007577-1|AAH07577.1| 1308|Homo sapiens ASCC3L1 protein protein.
          Length = 1308

 Score = 29.9 bits (64), Expect = 9.0
 Identities = 14/35 (40%), Positives = 22/35 (62%)
 Frame = +3

Query: 300 KYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVY 404
           KY P T L+DL+P  + A+R+  F  L++ D F +
Sbjct: 466 KYPPPTELLDLQPLPVSALRNSAFESLYQ-DKFPF 499


>AY572488-1|AAS78571.1| 2136|Homo sapiens 200 kDa U5 snRNP-specific
            spliceosomal protein protein.
          Length = 2136

 Score = 29.9 bits (64), Expect = 9.0
 Identities = 14/35 (40%), Positives = 22/35 (62%)
 Frame = +3

Query: 300  KYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVY 404
            KY P T L+DL+P  + A+R+  F  L++ D F +
Sbjct: 1294 KYPPPTELLDLQPLPVSALRNSAFESLYQ-DKFPF 1327


>AY236487-1|AAP74807.1|  766|Homo sapiens proliferation-inducing
           gene 6 protein.
          Length = 766

 Score = 29.9 bits (64), Expect = 9.0
 Identities = 15/67 (22%), Positives = 30/67 (44%)
 Frame = -1

Query: 607 GILFAYPVHEVAYLIRNRYRHLASVTSENLQAIQPSASLRMTSKADSRISTPSV*CPFAQ 428
           G++ + P+ E   L + R   L +  +  +   +P + +R+    +S   TP    P+  
Sbjct: 597 GVIISIPLTETVILHQGRLLGLRANKTSGVPGNRPGSVIRVYGDENSDKVTPGTFIPYCS 656

Query: 427 LLAAQFC 407
           +  AQ C
Sbjct: 657 MAHAQLC 663


>AF542172-1|AAQ11383.1|  508|Homo sapiens HLC-6 protein.
          Length = 508

 Score = 29.9 bits (64), Expect = 9.0
 Identities = 15/67 (22%), Positives = 30/67 (44%)
 Frame = -1

Query: 607 GILFAYPVHEVAYLIRNRYRHLASVTSENLQAIQPSASLRMTSKADSRISTPSV*CPFAQ 428
           G++ + P+ E   L + R   L +  +  +   +P + +R+    +S   TP    P+  
Sbjct: 339 GVIISIPLTETVILHQGRLLGLRANKTSGVPGNRPGSVIRVYGDENSDKVTPGTFIPYCS 398

Query: 427 LLAAQFC 407
           +  AQ C
Sbjct: 399 MAHAQLC 405


>AB018331-1|BAA34508.2| 2026|Homo sapiens KIAA0788 protein protein.
          Length = 2026

 Score = 29.9 bits (64), Expect = 9.0
 Identities = 14/35 (40%), Positives = 22/35 (62%)
 Frame = +3

Query: 300  KYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVY 404
            KY P T L+DL+P  + A+R+  F  L++ D F +
Sbjct: 1184 KYPPPTELLDLQPLPVSALRNSAFESLYQ-DKFPF 1217


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 98,545,919
Number of Sequences: 237096
Number of extensions: 2060307
Number of successful extensions: 4655
Number of sequences better than 10.0: 179
Number of HSP's better than 10.0 without gapping: 3988
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4645
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 7951235188
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -