SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30122.Seq
         (669 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X57958-1|CAA41026.1|  253|Homo sapiens ribosomal protein L7 prot...   105   2e-22
X57959-1|CAA41027.1|  248|Homo sapiens ribosomal protein L7 prot...   104   3e-22
X52967-1|CAA37139.1|  248|Homo sapiens ribosomal protein L7 prot...   102   1e-21
CR456773-1|CAG33054.1|  248|Homo sapiens RPL7 protein.                102   1e-21
BC106056-1|AAI06057.1|  318|Homo sapiens RPL7 protein protein.        102   1e-21
BC087837-1|AAH87837.1|  248|Homo sapiens ribosomal protein L7 pr...   102   1e-21
BC071895-1|AAH71895.1|  248|Homo sapiens ribosomal protein L7 pr...   102   1e-21
BC071894-1|AAH71894.1|  248|Homo sapiens ribosomal protein L7 pr...   102   1e-21
BC071671-1|AAH71671.1|  248|Homo sapiens ribosomal protein L7 pr...   102   1e-21
BC009599-1|AAH09599.1|  248|Homo sapiens ribosomal protein L7 pr...   102   1e-21
BC008850-1|AAH08850.1|  248|Homo sapiens ribosomal protein L7 pr...   102   1e-21
BC006095-1|AAH06095.1|  248|Homo sapiens ribosomal protein L7 pr...   102   1e-21
AC005058-2|AAD08846.1|  247|Homo sapiens WUGSC:H_RG054D04.1 prot...   102   1e-21
L16558-1|AAA03081.1|  248|Homo sapiens ribosomal protein L7 prot...   101   2e-21
BC073890-1|AAH73890.1|  246|Homo sapiens ribosomal protein L7-li...    73   1e-12
BC058020-1|AAH58020.1|  246|Homo sapiens RPL7L1 protein protein.       73   1e-12
AL035587-3|CAI21486.1|  246|Homo sapiens ribosomal protein L7-li...    73   1e-12
U04840-1|AAA16022.1|  510|Homo sapiens onconeural ventral antige...    31   3.7  
BC075039-1|AAH75039.1|  507|Homo sapiens neuro-oncological ventr...    31   3.7  
BC075038-1|AAH75038.1|  507|Homo sapiens neuro-oncological ventr...    31   3.7  

>X57958-1|CAA41026.1|  253|Homo sapiens ribosomal protein L7
           protein.
          Length = 253

 Score =  105 bits (251), Expect = 2e-22
 Identities = 52/88 (59%), Positives = 61/88 (69%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*V 534
           +VRKVLQL RLRQI NG FV+LNKA++NMLRI EPYIAWGYPNLKSV EL+  +      
Sbjct: 109 KVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYIAWGYPNLKSVNELIYKLGYAKIN 168

Query: 535 DNVYQSLPTALLRRGFHKHNIICVEDLI 618
                    AL+ R   K+ IIC+EDLI
Sbjct: 169 KKQIALTDNALIARSLGKYGIICMEDLI 196



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 24/34 (70%), Positives = 25/34 (73%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSPKSVKFCNCL 382
           GN+YVP E KLAFVIRIRGIN VSPK  K    L
Sbjct: 84  GNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLL 117



 Score = 36.7 bits (81), Expect = 0.075
 Identities = 19/67 (28%), Positives = 35/67 (52%)
 Frame = +3

Query: 54  KGKEDSKKLPAVPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKEYR 233
           + +E  K++PAVPE++ K            L+    ++     +++ I+++A+ Y KEYR
Sbjct: 8   RAEEKKKEVPAVPETLKKKRRNFAELKIKRLRKKFAQKMLRKARRKLIYEKAKHYHKEYR 67

Query: 234 IKERDEI 254
              R EI
Sbjct: 68  QMYRTEI 74



 Score = 29.9 bits (64), Expect = 8.6
 Identities = 11/16 (68%), Positives = 15/16 (93%)
 Frame = +2

Query: 620 HEIFTVGEKFKYASNF 667
           HEI+TVG++FK A+NF
Sbjct: 197 HEIYTVGKRFKEANNF 212


>X57959-1|CAA41027.1|  248|Homo sapiens ribosomal protein L7
           protein.
          Length = 248

 Score =  104 bits (249), Expect = 3e-22
 Identities = 52/88 (59%), Positives = 61/88 (69%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*V 534
           +VRKVLQL RLRQI NG FV+LNKA++NMLRI EPYIAWGYPNLKSV EL+  +      
Sbjct: 104 KVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYIAWGYPNLKSVNELIYKLGYGKIN 163

Query: 535 DNVYQSLPTALLRRGFHKHNIICVEDLI 618
                    AL+ R   K+ IIC+EDLI
Sbjct: 164 KKRIALTDNALIARSLGKYGIICMEDLI 191



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 24/34 (70%), Positives = 25/34 (73%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSPKSVKFCNCL 382
           GN+YVP E KLAFVIRIRGIN VSPK  K    L
Sbjct: 79  GNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLL 112



 Score = 36.3 bits (80), Expect = 0.099
 Identities = 21/69 (30%), Positives = 37/69 (53%), Gaps = 1/69 (1%)
 Frame = +3

Query: 51  VKGKEDSKK-LPAVPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKE 227
           ++G E+ KK +PAVPE++ K            L+    ++     +++ I+++A+ Y KE
Sbjct: 1   MEGVEEKKKEVPAVPETLKKKRRNFAELKIKRLRKKFAQKMLRKARRKLIYEKAKHYHKE 60

Query: 228 YRIKERDEI 254
           YR   R EI
Sbjct: 61  YRQMYRTEI 69



 Score = 29.9 bits (64), Expect = 8.6
 Identities = 11/16 (68%), Positives = 15/16 (93%)
 Frame = +2

Query: 620 HEIFTVGEKFKYASNF 667
           HEI+TVG++FK A+NF
Sbjct: 192 HEIYTVGKRFKEANNF 207


>X52967-1|CAA37139.1|  248|Homo sapiens ribosomal protein L7
           protein.
          Length = 248

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/88 (59%), Positives = 60/88 (68%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*V 534
           +VRKVLQL RLRQI NG FV+LNKA++NMLRI EPYIAWGYPNLKSV EL+         
Sbjct: 104 KVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKIN 163

Query: 535 DNVYQSLPTALLRRGFHKHNIICVEDLI 618
                    AL+ R   K+ IIC+EDLI
Sbjct: 164 KKRIALTDNALIARSLGKYGIICMEDLI 191



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 24/34 (70%), Positives = 25/34 (73%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSPKSVKFCNCL 382
           GN+YVP E KLAFVIRIRGIN VSPK  K    L
Sbjct: 79  GNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLL 112



 Score = 36.3 bits (80), Expect = 0.099
 Identities = 21/69 (30%), Positives = 37/69 (53%), Gaps = 1/69 (1%)
 Frame = +3

Query: 51  VKGKEDSKK-LPAVPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKE 227
           ++G E+ KK +PAVPE++ K            L+    ++     +++ I+++A+ Y KE
Sbjct: 1   MEGVEEKKKEVPAVPETLKKKRRNFAELKIKRLRKKFAQKMLRKARRKLIYEKAKHYHKE 60

Query: 228 YRIKERDEI 254
           YR   R EI
Sbjct: 61  YRQMYRTEI 69



 Score = 29.9 bits (64), Expect = 8.6
 Identities = 11/16 (68%), Positives = 15/16 (93%)
 Frame = +2

Query: 620 HEIFTVGEKFKYASNF 667
           HEI+TVG++FK A+NF
Sbjct: 192 HEIYTVGKRFKEANNF 207


>CR456773-1|CAG33054.1|  248|Homo sapiens RPL7 protein.
          Length = 248

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/88 (59%), Positives = 60/88 (68%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*V 534
           +VRKVLQL RLRQI NG FV+LNKA++NMLRI EPYIAWGYPNLKSV EL+         
Sbjct: 104 KVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKIN 163

Query: 535 DNVYQSLPTALLRRGFHKHNIICVEDLI 618
                    AL+ R   K+ IIC+EDLI
Sbjct: 164 KKRIALTDNALIARSLGKYGIICMEDLI 191



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 24/34 (70%), Positives = 25/34 (73%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSPKSVKFCNCL 382
           GN+YVP E KLAFVIRIRGIN VSPK  K    L
Sbjct: 79  GNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLL 112



 Score = 35.5 bits (78), Expect = 0.17
 Identities = 21/69 (30%), Positives = 36/69 (52%), Gaps = 1/69 (1%)
 Frame = +3

Query: 51  VKGKEDSKK-LPAVPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKE 227
           ++G E+ KK +PAVPE++ K            L+    ++     ++  I+++A+ Y KE
Sbjct: 1   MEGVEEKKKEVPAVPETLKKKRRNFAELKIKRLRKKFAQKMLRKARRELIYEKAKHYHKE 60

Query: 228 YRIKERDEI 254
           YR   R EI
Sbjct: 61  YRQMYRTEI 69


>BC106056-1|AAI06057.1|  318|Homo sapiens RPL7 protein protein.
          Length = 318

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/88 (59%), Positives = 60/88 (68%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*V 534
           +VRKVLQL RLRQI NG FV+LNKA++NMLRI EPYIAWGYPNLKSV EL+         
Sbjct: 174 KVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKIN 233

Query: 535 DNVYQSLPTALLRRGFHKHNIICVEDLI 618
                    AL+ R   K+ IIC+EDLI
Sbjct: 234 KKRIALTDNALIARSLGKYGIICMEDLI 261



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 24/34 (70%), Positives = 25/34 (73%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSPKSVKFCNCL 382
           GN+YVP E KLAFVIRIRGIN VSPK  K    L
Sbjct: 149 GNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLL 182



 Score = 36.3 bits (80), Expect = 0.099
 Identities = 21/69 (30%), Positives = 37/69 (53%), Gaps = 1/69 (1%)
 Frame = +3

Query: 51  VKGKEDSKK-LPAVPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKE 227
           ++G E+ KK +PAVPE++ K            L+    ++     +++ I+++A+ Y KE
Sbjct: 71  MEGVEEKKKEVPAVPETLKKKRRNFAELKIKRLRKKFAQKMLRKARRKLIYEKAKHYHKE 130

Query: 228 YRIKERDEI 254
           YR   R EI
Sbjct: 131 YRQMYRTEI 139



 Score = 29.9 bits (64), Expect = 8.6
 Identities = 11/16 (68%), Positives = 15/16 (93%)
 Frame = +2

Query: 620 HEIFTVGEKFKYASNF 667
           HEI+TVG++FK A+NF
Sbjct: 262 HEIYTVGKRFKEANNF 277


>BC087837-1|AAH87837.1|  248|Homo sapiens ribosomal protein L7
           protein.
          Length = 248

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/88 (59%), Positives = 60/88 (68%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*V 534
           +VRKVLQL RLRQI NG FV+LNKA++NMLRI EPYIAWGYPNLKSV EL+         
Sbjct: 104 KVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKIN 163

Query: 535 DNVYQSLPTALLRRGFHKHNIICVEDLI 618
                    AL+ R   K+ IIC+EDLI
Sbjct: 164 KKRIALTDNALIARSLGKYGIICMEDLI 191



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 24/34 (70%), Positives = 25/34 (73%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSPKSVKFCNCL 382
           GN+YVP E KLAFVIRIRGIN VSPK  K    L
Sbjct: 79  GNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLL 112



 Score = 36.3 bits (80), Expect = 0.099
 Identities = 21/69 (30%), Positives = 37/69 (53%), Gaps = 1/69 (1%)
 Frame = +3

Query: 51  VKGKEDSKK-LPAVPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKE 227
           ++G E+ KK +PAVPE++ K            L+    ++     +++ I+++A+ Y KE
Sbjct: 1   MEGVEEKKKEVPAVPETLKKKRRNFAELKIKRLRKKFAQKMLRKARRKLIYEKAKHYHKE 60

Query: 228 YRIKERDEI 254
           YR   R EI
Sbjct: 61  YRQMYRTEI 69



 Score = 29.9 bits (64), Expect = 8.6
 Identities = 11/16 (68%), Positives = 15/16 (93%)
 Frame = +2

Query: 620 HEIFTVGEKFKYASNF 667
           HEI+TVG++FK A+NF
Sbjct: 192 HEIYTVGKRFKEANNF 207


>BC071895-1|AAH71895.1|  248|Homo sapiens ribosomal protein L7
           protein.
          Length = 248

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/88 (59%), Positives = 60/88 (68%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*V 534
           +VRKVLQL RLRQI NG FV+LNKA++NMLRI EPYIAWGYPNLKSV EL+         
Sbjct: 104 KVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKIN 163

Query: 535 DNVYQSLPTALLRRGFHKHNIICVEDLI 618
                    AL+ R   K+ IIC+EDLI
Sbjct: 164 KKRIALTDNALIARSLGKYGIICMEDLI 191



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 24/34 (70%), Positives = 25/34 (73%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSPKSVKFCNCL 382
           GN+YVP E KLAFVIRIRGIN VSPK  K    L
Sbjct: 79  GNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLL 112



 Score = 36.3 bits (80), Expect = 0.099
 Identities = 21/69 (30%), Positives = 37/69 (53%), Gaps = 1/69 (1%)
 Frame = +3

Query: 51  VKGKEDSKK-LPAVPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKE 227
           ++G E+ KK +PAVPE++ K            L+    ++     +++ I+++A+ Y KE
Sbjct: 1   MEGVEEKKKEVPAVPETLKKKRRNFAELKIKRLRKKFAQKMLRKARRKLIYEKAKHYHKE 60

Query: 228 YRIKERDEI 254
           YR   R EI
Sbjct: 61  YRQMYRTEI 69



 Score = 29.9 bits (64), Expect = 8.6
 Identities = 11/16 (68%), Positives = 15/16 (93%)
 Frame = +2

Query: 620 HEIFTVGEKFKYASNF 667
           HEI+TVG++FK A+NF
Sbjct: 192 HEIYTVGKRFKEANNF 207


>BC071894-1|AAH71894.1|  248|Homo sapiens ribosomal protein L7
           protein.
          Length = 248

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/88 (59%), Positives = 60/88 (68%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*V 534
           +VRKVLQL RLRQI NG FV+LNKA++NMLRI EPYIAWGYPNLKSV EL+         
Sbjct: 104 KVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKIN 163

Query: 535 DNVYQSLPTALLRRGFHKHNIICVEDLI 618
                    AL+ R   K+ IIC+EDLI
Sbjct: 164 KKRIALTDNALIARSLGKYGIICMEDLI 191



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 24/34 (70%), Positives = 25/34 (73%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSPKSVKFCNCL 382
           GN+YVP E KLAFVIRIRGIN VSPK  K    L
Sbjct: 79  GNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLL 112



 Score = 36.3 bits (80), Expect = 0.099
 Identities = 21/69 (30%), Positives = 37/69 (53%), Gaps = 1/69 (1%)
 Frame = +3

Query: 51  VKGKEDSKK-LPAVPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKE 227
           ++G E+ KK +PAVPE++ K            L+    ++     +++ I+++A+ Y KE
Sbjct: 1   MEGVEEKKKEVPAVPETLKKKRRNFAELKIKRLRKKFAQKMLRKARRKLIYEKAKHYHKE 60

Query: 228 YRIKERDEI 254
           YR   R EI
Sbjct: 61  YRQMYRTEI 69



 Score = 29.9 bits (64), Expect = 8.6
 Identities = 11/16 (68%), Positives = 15/16 (93%)
 Frame = +2

Query: 620 HEIFTVGEKFKYASNF 667
           HEI+TVG++FK A+NF
Sbjct: 192 HEIYTVGKRFKEANNF 207


>BC071671-1|AAH71671.1|  248|Homo sapiens ribosomal protein L7
           protein.
          Length = 248

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/88 (59%), Positives = 60/88 (68%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*V 534
           +VRKVLQL RLRQI NG FV+LNKA++NMLRI EPYIAWGYPNLKSV EL+         
Sbjct: 104 KVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKIN 163

Query: 535 DNVYQSLPTALLRRGFHKHNIICVEDLI 618
                    AL+ R   K+ IIC+EDLI
Sbjct: 164 KKRIALTDNALIARSLGKYGIICMEDLI 191



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 24/34 (70%), Positives = 25/34 (73%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSPKSVKFCNCL 382
           GN+YVP E KLAFVIRIRGIN VSPK  K    L
Sbjct: 79  GNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLL 112



 Score = 36.3 bits (80), Expect = 0.099
 Identities = 21/69 (30%), Positives = 37/69 (53%), Gaps = 1/69 (1%)
 Frame = +3

Query: 51  VKGKEDSKK-LPAVPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKE 227
           ++G E+ KK +PAVPE++ K            L+    ++     +++ I+++A+ Y KE
Sbjct: 1   MEGVEEKKKEVPAVPETLKKKRRNFAELKIKRLRKKFAQKMLRKARRKLIYEKAKHYHKE 60

Query: 228 YRIKERDEI 254
           YR   R EI
Sbjct: 61  YRQMYRTEI 69



 Score = 29.9 bits (64), Expect = 8.6
 Identities = 11/16 (68%), Positives = 15/16 (93%)
 Frame = +2

Query: 620 HEIFTVGEKFKYASNF 667
           HEI+TVG++FK A+NF
Sbjct: 192 HEIYTVGKRFKEANNF 207


>BC009599-1|AAH09599.1|  248|Homo sapiens ribosomal protein L7
           protein.
          Length = 248

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/88 (59%), Positives = 60/88 (68%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*V 534
           +VRKVLQL RLRQI NG FV+LNKA++NMLRI EPYIAWGYPNLKSV EL+         
Sbjct: 104 KVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKIN 163

Query: 535 DNVYQSLPTALLRRGFHKHNIICVEDLI 618
                    AL+ R   K+ IIC+EDLI
Sbjct: 164 KKRIALTDNALIARSLGKYGIICMEDLI 191



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 24/34 (70%), Positives = 25/34 (73%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSPKSVKFCNCL 382
           GN+YVP E KLAFVIRIRGIN VSPK  K    L
Sbjct: 79  GNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLL 112



 Score = 36.3 bits (80), Expect = 0.099
 Identities = 21/69 (30%), Positives = 37/69 (53%), Gaps = 1/69 (1%)
 Frame = +3

Query: 51  VKGKEDSKK-LPAVPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKE 227
           ++G E+ KK +PAVPE++ K            L+    ++     +++ I+++A+ Y KE
Sbjct: 1   MEGVEEKKKEVPAVPETLKKKRRNFAELKIKRLRKKFAQKMLRKARRKLIYEKAKHYHKE 60

Query: 228 YRIKERDEI 254
           YR   R EI
Sbjct: 61  YRQMYRTEI 69



 Score = 29.9 bits (64), Expect = 8.6
 Identities = 11/16 (68%), Positives = 15/16 (93%)
 Frame = +2

Query: 620 HEIFTVGEKFKYASNF 667
           HEI+TVG++FK A+NF
Sbjct: 192 HEIYTVGKRFKEANNF 207


>BC008850-1|AAH08850.1|  248|Homo sapiens ribosomal protein L7
           protein.
          Length = 248

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/88 (59%), Positives = 60/88 (68%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*V 534
           +VRKVLQL RLRQI NG FV+LNKA++NMLRI EPYIAWGYPNLKSV EL+         
Sbjct: 104 KVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKIN 163

Query: 535 DNVYQSLPTALLRRGFHKHNIICVEDLI 618
                    AL+ R   K+ IIC+EDLI
Sbjct: 164 KKRIALTDNALIARSLGKYGIICMEDLI 191



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 24/34 (70%), Positives = 25/34 (73%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSPKSVKFCNCL 382
           GN+YVP E KLAFVIRIRGIN VSPK  K    L
Sbjct: 79  GNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLL 112



 Score = 36.3 bits (80), Expect = 0.099
 Identities = 21/69 (30%), Positives = 37/69 (53%), Gaps = 1/69 (1%)
 Frame = +3

Query: 51  VKGKEDSKK-LPAVPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKE 227
           ++G E+ KK +PAVPE++ K            L+    ++     +++ I+++A+ Y KE
Sbjct: 1   MEGVEEKKKEVPAVPETLKKKRRNFAELKIKRLRKKFAQKMLRKARRKLIYEKAKHYHKE 60

Query: 228 YRIKERDEI 254
           YR   R EI
Sbjct: 61  YRQMYRTEI 69



 Score = 29.9 bits (64), Expect = 8.6
 Identities = 11/16 (68%), Positives = 15/16 (93%)
 Frame = +2

Query: 620 HEIFTVGEKFKYASNF 667
           HEI+TVG++FK A+NF
Sbjct: 192 HEIYTVGKRFKEANNF 207


>BC006095-1|AAH06095.1|  248|Homo sapiens ribosomal protein L7
           protein.
          Length = 248

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/88 (59%), Positives = 60/88 (68%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*V 534
           +VRKVLQL RLRQI NG FV+LNKA++NMLRI EPYIAWGYPNLKSV EL+         
Sbjct: 104 KVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKIN 163

Query: 535 DNVYQSLPTALLRRGFHKHNIICVEDLI 618
                    AL+ R   K+ IIC+EDLI
Sbjct: 164 KKRIALTDNALIARSLGKYGIICMEDLI 191



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 24/34 (70%), Positives = 25/34 (73%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSPKSVKFCNCL 382
           GN+YVP E KLAFVIRIRGIN VSPK  K    L
Sbjct: 79  GNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLL 112



 Score = 36.3 bits (80), Expect = 0.099
 Identities = 21/69 (30%), Positives = 37/69 (53%), Gaps = 1/69 (1%)
 Frame = +3

Query: 51  VKGKEDSKK-LPAVPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKE 227
           ++G E+ KK +PAVPE++ K            L+    ++     +++ I+++A+ Y KE
Sbjct: 1   MEGVEEKKKEVPAVPETLKKKRRNFAELKIKRLRKKFAQKMLRKARRKLIYEKAKHYHKE 60

Query: 228 YRIKERDEI 254
           YR   R EI
Sbjct: 61  YRQMYRTEI 69



 Score = 29.9 bits (64), Expect = 8.6
 Identities = 11/16 (68%), Positives = 15/16 (93%)
 Frame = +2

Query: 620 HEIFTVGEKFKYASNF 667
           HEI+TVG++FK A+NF
Sbjct: 192 HEIYTVGKRFKEANNF 207


>AC005058-2|AAD08846.1|  247|Homo sapiens WUGSC:H_RG054D04.1
           protein.
          Length = 247

 Score =  102 bits (244), Expect = 1e-21
 Identities = 52/88 (59%), Positives = 59/88 (67%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*V 534
           +VRKVLQL RLRQI NG FV+LNKA+ NMLRI EPYIAWGYPNLKSV EL+         
Sbjct: 103 KVRKVLQLLRLRQIYNGTFVKLNKASTNMLRIVEPYIAWGYPNLKSVNELIYKSGYGKIN 162

Query: 535 DNVYQSLPTALLRRGFHKHNIICVEDLI 618
                    AL+ R   K+ IIC+EDLI
Sbjct: 163 KKRIALTDNALIARSLGKYGIICMEDLI 190



 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 23/34 (67%), Positives = 25/34 (73%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSPKSVKFCNCL 382
           GNY+VP E KLAFVIRIRGI+ VSPK  K    L
Sbjct: 78  GNYFVPAEPKLAFVIRIRGISGVSPKVRKVLQLL 111



 Score = 38.7 bits (86), Expect = 0.019
 Identities = 20/66 (30%), Positives = 35/66 (53%)
 Frame = +3

Query: 57  GKEDSKKLPAVPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKEYRI 236
           G E+ KK+PAVPE++ K            L+    ++     +++ I+++A+ Y +EYR 
Sbjct: 3   GVEEKKKVPAVPETLKKKRRNFSELKMKRLRKKFAQKMLRKARRKLIYEKAKHYHREYRQ 62

Query: 237 KERDEI 254
             R EI
Sbjct: 63  MYRTEI 68



 Score = 29.9 bits (64), Expect = 8.6
 Identities = 11/16 (68%), Positives = 15/16 (93%)
 Frame = +2

Query: 620 HEIFTVGEKFKYASNF 667
           HEI+TVG++FK A+NF
Sbjct: 191 HEIYTVGKRFKEANNF 206


>L16558-1|AAA03081.1|  248|Homo sapiens ribosomal protein L7
           protein.
          Length = 248

 Score =  101 bits (242), Expect = 2e-21
 Identities = 51/88 (57%), Positives = 60/88 (68%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*V 534
           +VRKVLQL RLRQI NG FV+LNKA++NMLRI EPYIAWGYPNLKSV EL+         
Sbjct: 104 KVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKIN 163

Query: 535 DNVYQSLPTALLRRGFHKHNIICVEDLI 618
                    +L+ R   K+ IIC+EDLI
Sbjct: 164 KKRIALTDNSLIARSLGKYGIICMEDLI 191



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 24/34 (70%), Positives = 25/34 (73%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSPKSVKFCNCL 382
           GN+YVP E KLAFVIRIRGIN VSPK  K    L
Sbjct: 79  GNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLL 112



 Score = 36.3 bits (80), Expect = 0.099
 Identities = 21/69 (30%), Positives = 37/69 (53%), Gaps = 1/69 (1%)
 Frame = +3

Query: 51  VKGKEDSKK-LPAVPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKE 227
           ++G E+ KK +PAVPE++ K            L+    ++     +++ I+++A+ Y KE
Sbjct: 1   MEGVEEKKKEVPAVPETLKKKRRNFAELKIKRLRKKFAQKMLRKARRKLIYEKAKHYHKE 60

Query: 228 YRIKERDEI 254
           YR   R EI
Sbjct: 61  YRQMYRTEI 69



 Score = 29.9 bits (64), Expect = 8.6
 Identities = 11/16 (68%), Positives = 15/16 (93%)
 Frame = +2

Query: 620 HEIFTVGEKFKYASNF 667
           HEI+TVG++FK A+NF
Sbjct: 192 HEIYTVGKRFKEANNF 207


>BC073890-1|AAH73890.1|  246|Homo sapiens ribosomal protein L7-like
           1 protein.
          Length = 246

 Score = 72.5 bits (170), Expect = 1e-12
 Identities = 33/87 (37%), Positives = 50/87 (57%)
 Frame = +1

Query: 358 VRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*VD 537
           V++ +   RL++I +GVFV++    + MLRI EPY+ WG+PNLKSVREL+         +
Sbjct: 103 VQRTIARLRLKKIFSGVFVKVTPQNLKMLRIVEPYVTWGFPNLKSVRELILKRGQAKVKN 162

Query: 538 NVYQSLPTALLRRGFHKHNIICVEDLI 618
                    ++     K  +IC+EDLI
Sbjct: 163 KTIPLTDNTVIEEHLGKFGVICLEDLI 189



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 42/186 (22%), Positives = 76/186 (40%), Gaps = 12/186 (6%)
 Frame = +3

Query: 60  KEDSKKLPAVPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKEYRIK 239
           +++ +K+P VPE++LK             +  L  +    K K   FKR E ++ +   +
Sbjct: 3   EQEQRKIPLVPENLLKKRKAYQALKATQAKQALLAKKEQKKGKGLRFKRLESFLHDSWRQ 62

Query: 240 ERDEI------------D*PDKHAIVATTTFPGKPNWHLSSESVVSTKFHRSP*SSATV* 383
           +RD++            + PDKH++             L  +  ++    +   S   V 
Sbjct: 63  KRDKVRLRRLEVKPHALELPDKHSLAFVVRIERIDGVSLLVQRTIARLRLKKIFSGVFVK 122

Query: 384 TAPNKQWCVCTSE*GYCEYATYRRALHCLGIPQLKECP*VSIKRGFAKLSGQRIPITSNS 563
             P     +   E     Y T+       G P LK    + +KRG AK+  + IP+T N+
Sbjct: 123 VTPQNLKMLRIVE----PYVTW-------GFPNLKSVRELILKRGQAKVKNKTIPLTDNT 171

Query: 564 IVEKRL 581
           ++E+ L
Sbjct: 172 VIEEHL 177


>BC058020-1|AAH58020.1|  246|Homo sapiens RPL7L1 protein protein.
          Length = 246

 Score = 72.5 bits (170), Expect = 1e-12
 Identities = 33/87 (37%), Positives = 50/87 (57%)
 Frame = +1

Query: 358 VRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*VD 537
           V++ +   RL++I +GVFV++    + MLRI EPY+ WG+PNLKSVREL+         +
Sbjct: 103 VQRTIARLRLKKIFSGVFVKVTPQNLKMLRIVEPYVTWGFPNLKSVRELILKRGQAKVKN 162

Query: 538 NVYQSLPTALLRRGFHKHNIICVEDLI 618
                    ++     K  +IC+EDLI
Sbjct: 163 KTIPLTDNTVIEEHLGKFGVICLEDLI 189



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 42/186 (22%), Positives = 76/186 (40%), Gaps = 12/186 (6%)
 Frame = +3

Query: 60  KEDSKKLPAVPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKEYRIK 239
           +++ +K+P VPE++LK             +  L  +    K K   FKR E ++ +   +
Sbjct: 3   EQEQRKIPLVPENLLKKRKAYQALKATQAKQALLAKKEQKKGKGLRFKRLESFLHDSWRQ 62

Query: 240 ERDEI------------D*PDKHAIVATTTFPGKPNWHLSSESVVSTKFHRSP*SSATV* 383
           +RD++            + PDKH++             L  +  ++    +   S   V 
Sbjct: 63  KRDKVRLRRLEVKPHALELPDKHSLAFVVRIERIDGVSLLVQRTIARLRLKKIFSGVFVK 122

Query: 384 TAPNKQWCVCTSE*GYCEYATYRRALHCLGIPQLKECP*VSIKRGFAKLSGQRIPITSNS 563
             P     +   E     Y T+       G P LK    + +KRG AK+  + IP+T N+
Sbjct: 123 VTPQNLKMLRIVE----PYVTW-------GFPNLKSVRELILKRGQAKVKNKTIPLTDNT 171

Query: 564 IVEKRL 581
           ++E+ L
Sbjct: 172 VIEEHL 177


>AL035587-3|CAI21486.1|  246|Homo sapiens ribosomal protein L7-like
           1 protein.
          Length = 246

 Score = 72.5 bits (170), Expect = 1e-12
 Identities = 33/87 (37%), Positives = 50/87 (57%)
 Frame = +1

Query: 358 VRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*VD 537
           V++ +   RL++I +GVFV++    + MLRI EPY+ WG+PNLKSVREL+         +
Sbjct: 103 VQRTIARLRLKKIFSGVFVKVTPQNLKMLRIVEPYVTWGFPNLKSVRELILKRGQAKVKN 162

Query: 538 NVYQSLPTALLRRGFHKHNIICVEDLI 618
                    ++     K  +IC+EDLI
Sbjct: 163 KTIPLTDNTVIEEHLGKFGVICLEDLI 189



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 42/186 (22%), Positives = 76/186 (40%), Gaps = 12/186 (6%)
 Frame = +3

Query: 60  KEDSKKLPAVPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKEYRIK 239
           +++ +K+P VPE++LK             +  L  +    K K   FKR E ++ +   +
Sbjct: 3   EQEQRKIPLVPENLLKKRKAYQALKATQAKQALLAKKEQKKGKGLRFKRLESFLHDSWRQ 62

Query: 240 ERDEI------------D*PDKHAIVATTTFPGKPNWHLSSESVVSTKFHRSP*SSATV* 383
           +RD++            + PDKH++             L  +  ++    +   S   V 
Sbjct: 63  KRDKVRLRRLEVKPHALELPDKHSLAFVVRIERIDGVSLLVQRTIARLRLKKIFSGVFVK 122

Query: 384 TAPNKQWCVCTSE*GYCEYATYRRALHCLGIPQLKECP*VSIKRGFAKLSGQRIPITSNS 563
             P     +   E     Y T+       G P LK    + +KRG AK+  + IP+T N+
Sbjct: 123 VTPQNLKMLRIVE----PYVTW-------GFPNLKSVRELILKRGQAKVKNKTIPLTDNT 171

Query: 564 IVEKRL 581
           ++E+ L
Sbjct: 172 VIEEHL 177


>U04840-1|AAA16022.1|  510|Homo sapiens onconeural ventral antigen-1
           protein.
          Length = 510

 Score = 31.1 bits (67), Expect = 3.7
 Identities = 26/82 (31%), Positives = 34/82 (41%)
 Frame = -3

Query: 307 GFPGNVVVATIACLSG*SISSRSLMRYSLTYCSALLKISLFFLMAEERLFSVTCNLLVRR 128
           GF GN +VA  + L+  +    +L    L    A    +L    A     +   NLL   
Sbjct: 309 GFTGNDLVAITSALNTLASYGYNLNTLGLGLSQAAATGALAAAAASANPAAAAANLLATY 368

Query: 127 ASLLLRCLSTDSGTAGSFLLSS 62
           AS      ST  GTAG+F L S
Sbjct: 369 ASEASASGSTAGGTAGTFALGS 390


>BC075039-1|AAH75039.1|  507|Homo sapiens neuro-oncological ventral
           antigen 1 protein.
          Length = 507

 Score = 31.1 bits (67), Expect = 3.7
 Identities = 26/82 (31%), Positives = 34/82 (41%)
 Frame = -3

Query: 307 GFPGNVVVATIACLSG*SISSRSLMRYSLTYCSALLKISLFFLMAEERLFSVTCNLLVRR 128
           GF GN +VA  + L+  +    +L    L    A    +L    A     +   NLL   
Sbjct: 306 GFTGNDLVAITSALNTLASYGYNLNTLGLGLSQAAATGALAAAAASANPAAAAANLLATY 365

Query: 127 ASLLLRCLSTDSGTAGSFLLSS 62
           AS      ST  GTAG+F L S
Sbjct: 366 ASEASASGSTAGGTAGTFALGS 387


>BC075038-1|AAH75038.1|  507|Homo sapiens neuro-oncological ventral
           antigen 1 protein.
          Length = 507

 Score = 31.1 bits (67), Expect = 3.7
 Identities = 26/82 (31%), Positives = 34/82 (41%)
 Frame = -3

Query: 307 GFPGNVVVATIACLSG*SISSRSLMRYSLTYCSALLKISLFFLMAEERLFSVTCNLLVRR 128
           GF GN +VA  + L+  +    +L    L    A    +L    A     +   NLL   
Sbjct: 306 GFTGNDLVAITSALNTLASYGYNLNTLGLGLSQAAATGALAAAAASANPAAAAANLLATY 365

Query: 127 ASLLLRCLSTDSGTAGSFLLSS 62
           AS      ST  GTAG+F L S
Sbjct: 366 ASEASASGSTAGGTAGTFALGS 387


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 89,753,122
Number of Sequences: 237096
Number of extensions: 1856149
Number of successful extensions: 3681
Number of sequences better than 10.0: 20
Number of HSP's better than 10.0 without gapping: 3491
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3652
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 7591280850
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -