SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30117.Seq
         (608 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X95325-1|CAA64631.1|  372|Homo sapiens DNA-binding protein protein.   107   3e-23
X72712-1|CAA51261.1|  372|Homo sapiens cold shock domain protein...   107   3e-23
M24069-1|AAA35749.1|  412|Homo sapiens protein ( Human DNA-bindi...   107   3e-23
L29071-1|AAA79243.1|  342|Homo sapiens DNA-binding protein A pro...   107   3e-23
BC021926-1|AAH21926.1|  372|Homo sapiens cold shock domain prote...   107   3e-23
BC015913-1|AAH15913.1|  303|Homo sapiens CSDA protein protein.        107   3e-23
BC015564-1|AAH15564.1|  372|Homo sapiens cold shock domain prote...   107   3e-23
BC008801-1|AAH08801.1|  372|Homo sapiens cold shock domain prote...   107   3e-23
AB209896-1|BAD93133.1|  134|Homo sapiens CSDA protein variant pr...   107   3e-23
BC009744-1|AAH09744.1|  303|Homo sapiens CSDA protein protein.        106   7e-23
M85234-1|AAA36569.1|  322|Homo sapiens nuclease sensitive elemen...   105   9e-23
M83234-1|AAA59949.1|  320|Homo sapiens DNA-binding protein protein.   105   9e-23
M24070-1|AAA35750.1|  364|Homo sapiens protein ( Human DNA-bindi...   105   9e-23
L28809-1|AAA20871.1|  324|Homo sapiens protein ( Homo sapiens db...   105   9e-23
BC106045-1|AAI06046.1|  324|Homo sapiens Y box binding protein 1...   105   9e-23
BC098435-1|AAH98435.1|  324|Homo sapiens Y box binding protein 1...   105   9e-23
BC090038-1|AAH90038.1|  324|Homo sapiens Y box binding protein 1...   105   9e-23
BC072014-1|AAH72014.1|  266|Homo sapiens YBX1 protein protein.        105   9e-23
BC071708-1|AAH71708.1|  324|Homo sapiens Y box binding protein 1...   105   9e-23
BC070084-1|AAH70084.1|  324|Homo sapiens Y box binding protein 1...   105   9e-23
BC065571-1|AAH65571.1|  324|Homo sapiens Y box binding protein 1...   105   9e-23
BC038384-1|AAH38384.1|  324|Homo sapiens Y box binding protein 1...   105   9e-23
BC018393-1|AAH18393.1|  267|Homo sapiens Unknown (protein for IM...   105   9e-23
BC015208-1|AAH15208.1|  324|Homo sapiens Y box binding protein 1...   105   9e-23
BC010430-1|AAH10430.1|  324|Homo sapiens Y box binding protein 1...   105   9e-23
BC002411-1|AAH02411.1|  324|Homo sapiens Y box binding protein 1...   105   9e-23
BC000064-1|AAH00064.1|  266|Homo sapiens YBX1 protein protein.        105   9e-23
J03827-1|AAA61308.1|  317|Homo sapiens NFYA protein.                  105   1e-22
BC047760-1|AAH47760.1|  364|Homo sapiens Y box binding protein 2...   102   9e-22
BC033800-1|AAH33800.1|  364|Homo sapiens Y box binding protein 2...   102   9e-22
AF096834-1|AAD30662.1|  364|Homo sapiens germ cell specific Y-bo...   102   9e-22
DQ120685-1|ABB92460.1|  319|Homo sapiens rcNSEP1 protein.              99   6e-21
AB208818-1|BAD92055.1|  268|Homo sapiens germ cell specific Y-bo...    91   2e-18
Z95329-1|CAI21661.2|  250|Homo sapiens lin-28 homolog B (C. eleg...    48   3e-05
DQ127228-1|AAZ38897.1|  250|Homo sapiens LIN28B protein.               48   3e-05
BC150538-1|AAI50539.1|  227|Homo sapiens Unknown (protein for IM...    48   3e-05
BC150537-1|AAI50538.1|  227|Homo sapiens Unknown (protein for IM...    48   3e-05
BC141960-1|AAI41961.1|  227|Homo sapiens LIN28B protein protein.       48   3e-05
BC127713-1|AAI27714.1|  227|Homo sapiens LIN28B protein protein.       48   3e-05
BC127712-1|AAI27713.1|  227|Homo sapiens LIN28B protein protein.       48   3e-05
AL135911-2|CAI20969.2|  250|Homo sapiens lin-28 homolog B (C. el...    48   3e-05
AK131411-1|BAD18558.1|  250|Homo sapiens protein ( Homo sapiens ...    48   3e-05
BC028566-1|AAH28566.1|  209|Homo sapiens LIN28 protein protein.        44   6e-04
AL513365-12|CAI21500.1|  209|Homo sapiens lin-28 homolog (C. ele...    44   6e-04
AK022519-1|BAB14075.1|  209|Homo sapiens protein ( Homo sapiens ...    44   6e-04
AF521099-1|AAM77751.1|  209|Homo sapiens RNA-binding protein LIN...    44   6e-04
Z74615-1|CAA98968.1| 1464|Homo sapiens prepro-alpha1(I) collagen...    31   4.2  
X98705-1|CAA67261.1| 1069|Homo sapiens collagen type I alpha 1 p...    31   4.2  
K01228-1|AAA51995.1| 1040|Homo sapiens COL1A1 protein.                 31   4.2  
BC036531-1|AAH36531.1| 1464|Homo sapiens collagen, type I, alpha...    31   4.2  
AF017178-1|AAB94054.2| 1461|Homo sapiens pro alpha 1(I) collagen...    31   4.2  
AB209597-1|BAD92834.1| 1467|Homo sapiens Collagen alpha 1 chain ...    31   4.2  
BC034571-1|AAH34571.1|  216|Homo sapiens PLA2G4D protein protein.      30   7.3  
AB090876-1|BAC67158.1|  818|Homo sapiens cytosolic phospholipase...    30   7.3  
J00112-1|AAA52291.1|   60|Homo sapiens pro-alpha-1 collagen type...    29   9.7  

>X95325-1|CAA64631.1|  372|Homo sapiens DNA-binding protein protein.
          Length = 372

 Score =  107 bits (257), Expect = 3e-23
 Identities = 52/71 (73%), Positives = 58/71 (81%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGP G PV+GS YAA
Sbjct: 113 KEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAA 172

Query: 432 DKRRGYHRQYF 464
           D+RR Y R Y+
Sbjct: 173 DRRR-YRRGYY 182



 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 23/29 (79%), Positives = 27/29 (93%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           V+A KV GTVKWFNV++GYGFINRNDTK+
Sbjct: 86  VLATKVLGTVKWFNVRNGYGFINRNDTKE 114


>X72712-1|CAA51261.1|  372|Homo sapiens cold shock domain protein A
           protein.
          Length = 372

 Score =  107 bits (257), Expect = 3e-23
 Identities = 52/71 (73%), Positives = 58/71 (81%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGP G PV+GS YAA
Sbjct: 113 KEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAA 172

Query: 432 DKRRGYHRQYF 464
           D+RR Y R Y+
Sbjct: 173 DRRR-YRRGYY 182



 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 23/29 (79%), Positives = 27/29 (93%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           V+A KV GTVKWFNV++GYGFINRNDTK+
Sbjct: 86  VLATKVLGTVKWFNVRNGYGFINRNDTKE 114


>M24069-1|AAA35749.1|  412|Homo sapiens protein ( Human DNA-binding
           protein A (dbpA) gene, 3' end. ).
          Length = 412

 Score =  107 bits (257), Expect = 3e-23
 Identities = 52/71 (73%), Positives = 58/71 (81%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGP G PV+GS YAA
Sbjct: 183 KEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAA 242

Query: 432 DKRRGYHRQYF 464
           D+RR Y R Y+
Sbjct: 243 DRRR-YRRGYY 252



 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 23/29 (79%), Positives = 27/29 (93%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           V+A KV GTVKWFNV++GYGFINRNDTK+
Sbjct: 156 VLATKVLGTVKWFNVRNGYGFINRNDTKE 184


>L29071-1|AAA79243.1|  342|Homo sapiens DNA-binding protein A
           protein.
          Length = 342

 Score =  107 bits (257), Expect = 3e-23
 Identities = 52/71 (73%), Positives = 58/71 (81%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGP G PV+GS YAA
Sbjct: 113 KEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAA 172

Query: 432 DKRRGYHRQYF 464
           D+RR Y R Y+
Sbjct: 173 DRRR-YRRGYY 182



 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 23/29 (79%), Positives = 27/29 (93%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           V+A KV GTVKWFNV++GYGFINRNDTK+
Sbjct: 86  VLATKVLGTVKWFNVRNGYGFINRNDTKE 114


>BC021926-1|AAH21926.1|  372|Homo sapiens cold shock domain protein
           A protein.
          Length = 372

 Score =  107 bits (257), Expect = 3e-23
 Identities = 52/71 (73%), Positives = 58/71 (81%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGP G PV+GS YAA
Sbjct: 113 KEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAA 172

Query: 432 DKRRGYHRQYF 464
           D+RR Y R Y+
Sbjct: 173 DRRR-YRRGYY 182



 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 23/29 (79%), Positives = 27/29 (93%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           V+A KV GTVKWFNV++GYGFINRNDTK+
Sbjct: 86  VLATKVLGTVKWFNVRNGYGFINRNDTKE 114


>BC015913-1|AAH15913.1|  303|Homo sapiens CSDA protein protein.
          Length = 303

 Score =  107 bits (257), Expect = 3e-23
 Identities = 52/71 (73%), Positives = 58/71 (81%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGP G PV+GS YAA
Sbjct: 113 KEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAA 172

Query: 432 DKRRGYHRQYF 464
           D+RR Y R Y+
Sbjct: 173 DRRR-YRRGYY 182



 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 23/29 (79%), Positives = 27/29 (93%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           V+A KV GTVKWFNV++GYGFINRNDTK+
Sbjct: 86  VLATKVLGTVKWFNVRNGYGFINRNDTKE 114


>BC015564-1|AAH15564.1|  372|Homo sapiens cold shock domain protein
           A protein.
          Length = 372

 Score =  107 bits (257), Expect = 3e-23
 Identities = 52/71 (73%), Positives = 58/71 (81%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGP G PV+GS YAA
Sbjct: 113 KEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAA 172

Query: 432 DKRRGYHRQYF 464
           D+RR Y R Y+
Sbjct: 173 DRRR-YRRGYY 182



 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 23/29 (79%), Positives = 27/29 (93%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           V+A KV GTVKWFNV++GYGFINRNDTK+
Sbjct: 86  VLATKVLGTVKWFNVRNGYGFINRNDTKE 114


>BC008801-1|AAH08801.1|  372|Homo sapiens cold shock domain protein
           A protein.
          Length = 372

 Score =  107 bits (257), Expect = 3e-23
 Identities = 52/71 (73%), Positives = 58/71 (81%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGP G PV+GS YAA
Sbjct: 113 KEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAA 172

Query: 432 DKRRGYHRQYF 464
           D+RR Y R Y+
Sbjct: 173 DRRR-YRRGYY 182



 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 23/29 (79%), Positives = 27/29 (93%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           V+A KV GTVKWFNV++GYGFINRNDTK+
Sbjct: 86  VLATKVLGTVKWFNVRNGYGFINRNDTKE 114


>AB209896-1|BAD93133.1|  134|Homo sapiens CSDA protein variant
           protein.
          Length = 134

 Score =  107 bits (257), Expect = 3e-23
 Identities = 52/71 (73%), Positives = 58/71 (81%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGP G PV+GS YAA
Sbjct: 46  KEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAA 105

Query: 432 DKRRGYHRQYF 464
           D+RR Y R Y+
Sbjct: 106 DRRR-YRRGYY 115



 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 23/29 (79%), Positives = 27/29 (93%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           V+A KV GTVKWFNV++GYGFINRNDTK+
Sbjct: 19  VLATKVLGTVKWFNVRNGYGFINRNDTKE 47


>BC009744-1|AAH09744.1|  303|Homo sapiens CSDA protein protein.
          Length = 303

 Score =  106 bits (254), Expect = 7e-23
 Identities = 51/71 (71%), Positives = 58/71 (81%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQTAI +NNPRK +RS+GDGE VEF VV GEKG EAA VTGP G PV+GS YAA
Sbjct: 113 KEDVFVHQTAIKKNNPRKYLRSLGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAA 172

Query: 432 DKRRGYHRQYF 464
           D+RR Y R Y+
Sbjct: 173 DRRR-YRRGYY 182



 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 23/29 (79%), Positives = 27/29 (93%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           V+A KV GTVKWFNV++GYGFINRNDTK+
Sbjct: 86  VLATKVLGTVKWFNVRNGYGFINRNDTKE 114


>M85234-1|AAA36569.1|  322|Homo sapiens nuclease sensitive element
           binding protein-1 protein.
          Length = 322

 Score =  105 bits (253), Expect = 9e-23
 Identities = 51/70 (72%), Positives = 58/70 (82%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGPGG PV+GS YAA
Sbjct: 80  KEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAA 139

Query: 432 DKRRGYHRQY 461
           D  R ++R+Y
Sbjct: 140 D--RNHYRRY 147



 Score = 56.8 bits (131), Expect = 6e-08
 Identities = 24/29 (82%), Positives = 27/29 (93%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           VIA KV GTVKWFNV++GYGFINRNDTK+
Sbjct: 53  VIATKVLGTVKWFNVRNGYGFINRNDTKE 81


>M83234-1|AAA59949.1|  320|Homo sapiens DNA-binding protein protein.
          Length = 320

 Score =  105 bits (253), Expect = 9e-23
 Identities = 51/70 (72%), Positives = 58/70 (82%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGPGG PV+GS YAA
Sbjct: 78  KEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAA 137

Query: 432 DKRRGYHRQY 461
           D  R ++R+Y
Sbjct: 138 D--RNHYRRY 145



 Score = 56.8 bits (131), Expect = 6e-08
 Identities = 24/29 (82%), Positives = 27/29 (93%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           VIA KV GTVKWFNV++GYGFINRNDTK+
Sbjct: 51  VIATKVLGTVKWFNVRNGYGFINRNDTKE 79


>M24070-1|AAA35750.1|  364|Homo sapiens protein ( Human DNA-binding
           protein B (dbpB) gene, 3' end. ).
          Length = 364

 Score =  105 bits (253), Expect = 9e-23
 Identities = 51/70 (72%), Positives = 58/70 (82%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGPGG PV+GS YAA
Sbjct: 121 KEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAA 180

Query: 432 DKRRGYHRQY 461
           D  R ++R+Y
Sbjct: 181 D--RNHYRRY 188



 Score = 56.8 bits (131), Expect = 6e-08
 Identities = 24/29 (82%), Positives = 27/29 (93%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           VIA KV GTVKWFNV++GYGFINRNDTK+
Sbjct: 94  VIATKVLGTVKWFNVRNGYGFINRNDTKE 122


>L28809-1|AAA20871.1|  324|Homo sapiens protein ( Homo sapiens
           dbpB-like protein mRNA, complete cds. ).
          Length = 324

 Score =  105 bits (253), Expect = 9e-23
 Identities = 51/70 (72%), Positives = 58/70 (82%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGPGG PV+GS YAA
Sbjct: 81  KEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAA 140

Query: 432 DKRRGYHRQY 461
           D  R ++R+Y
Sbjct: 141 D--RNHYRRY 148



 Score = 56.8 bits (131), Expect = 6e-08
 Identities = 24/29 (82%), Positives = 27/29 (93%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           VIA KV GTVKWFNV++GYGFINRNDTK+
Sbjct: 54  VIATKVLGTVKWFNVRNGYGFINRNDTKE 82


>BC106045-1|AAI06046.1|  324|Homo sapiens Y box binding protein 1
           protein.
          Length = 324

 Score =  105 bits (253), Expect = 9e-23
 Identities = 51/70 (72%), Positives = 58/70 (82%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGPGG PV+GS YAA
Sbjct: 81  KEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAA 140

Query: 432 DKRRGYHRQY 461
           D  R ++R+Y
Sbjct: 141 D--RNHYRRY 148



 Score = 56.8 bits (131), Expect = 6e-08
 Identities = 24/29 (82%), Positives = 27/29 (93%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           VIA KV GTVKWFNV++GYGFINRNDTK+
Sbjct: 54  VIATKVLGTVKWFNVRNGYGFINRNDTKE 82


>BC098435-1|AAH98435.1|  324|Homo sapiens Y box binding protein 1
           protein.
          Length = 324

 Score =  105 bits (253), Expect = 9e-23
 Identities = 51/70 (72%), Positives = 58/70 (82%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGPGG PV+GS YAA
Sbjct: 81  KEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAA 140

Query: 432 DKRRGYHRQY 461
           D  R ++R+Y
Sbjct: 141 D--RNHYRRY 148



 Score = 56.8 bits (131), Expect = 6e-08
 Identities = 24/29 (82%), Positives = 27/29 (93%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           VIA KV GTVKWFNV++GYGFINRNDTK+
Sbjct: 54  VIATKVLGTVKWFNVRNGYGFINRNDTKE 82


>BC090038-1|AAH90038.1|  324|Homo sapiens Y box binding protein 1
           protein.
          Length = 324

 Score =  105 bits (253), Expect = 9e-23
 Identities = 51/70 (72%), Positives = 58/70 (82%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGPGG PV+GS YAA
Sbjct: 81  KEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAA 140

Query: 432 DKRRGYHRQY 461
           D  R ++R+Y
Sbjct: 141 D--RNHYRRY 148



 Score = 56.8 bits (131), Expect = 6e-08
 Identities = 24/29 (82%), Positives = 27/29 (93%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           VIA KV GTVKWFNV++GYGFINRNDTK+
Sbjct: 54  VIATKVLGTVKWFNVRNGYGFINRNDTKE 82


>BC072014-1|AAH72014.1|  266|Homo sapiens YBX1 protein protein.
          Length = 266

 Score =  105 bits (253), Expect = 9e-23
 Identities = 51/70 (72%), Positives = 58/70 (82%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGPGG PV+GS YAA
Sbjct: 81  KEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAA 140

Query: 432 DKRRGYHRQY 461
           D  R ++R+Y
Sbjct: 141 D--RNHYRRY 148



 Score = 56.8 bits (131), Expect = 6e-08
 Identities = 24/29 (82%), Positives = 27/29 (93%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           VIA KV GTVKWFNV++GYGFINRNDTK+
Sbjct: 54  VIATKVLGTVKWFNVRNGYGFINRNDTKE 82


>BC071708-1|AAH71708.1|  324|Homo sapiens Y box binding protein 1
           protein.
          Length = 324

 Score =  105 bits (253), Expect = 9e-23
 Identities = 51/70 (72%), Positives = 58/70 (82%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGPGG PV+GS YAA
Sbjct: 81  KEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAA 140

Query: 432 DKRRGYHRQY 461
           D  R ++R+Y
Sbjct: 141 D--RNHYRRY 148



 Score = 56.8 bits (131), Expect = 6e-08
 Identities = 24/29 (82%), Positives = 27/29 (93%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           VIA KV GTVKWFNV++GYGFINRNDTK+
Sbjct: 54  VIATKVLGTVKWFNVRNGYGFINRNDTKE 82


>BC070084-1|AAH70084.1|  324|Homo sapiens Y box binding protein 1
           protein.
          Length = 324

 Score =  105 bits (253), Expect = 9e-23
 Identities = 51/70 (72%), Positives = 58/70 (82%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGPGG PV+GS YAA
Sbjct: 81  KEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAA 140

Query: 432 DKRRGYHRQY 461
           D  R ++R+Y
Sbjct: 141 D--RNHYRRY 148



 Score = 56.8 bits (131), Expect = 6e-08
 Identities = 24/29 (82%), Positives = 27/29 (93%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           VIA KV GTVKWFNV++GYGFINRNDTK+
Sbjct: 54  VIATKVLGTVKWFNVRNGYGFINRNDTKE 82


>BC065571-1|AAH65571.1|  324|Homo sapiens Y box binding protein 1
           protein.
          Length = 324

 Score =  105 bits (253), Expect = 9e-23
 Identities = 51/70 (72%), Positives = 58/70 (82%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGPGG PV+GS YAA
Sbjct: 81  KEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAA 140

Query: 432 DKRRGYHRQY 461
           D  R ++R+Y
Sbjct: 141 D--RNHYRRY 148



 Score = 56.8 bits (131), Expect = 6e-08
 Identities = 24/29 (82%), Positives = 27/29 (93%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           VIA KV GTVKWFNV++GYGFINRNDTK+
Sbjct: 54  VIATKVLGTVKWFNVRNGYGFINRNDTKE 82


>BC038384-1|AAH38384.1|  324|Homo sapiens Y box binding protein 1
           protein.
          Length = 324

 Score =  105 bits (253), Expect = 9e-23
 Identities = 51/70 (72%), Positives = 58/70 (82%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGPGG PV+GS YAA
Sbjct: 81  KEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAA 140

Query: 432 DKRRGYHRQY 461
           D  R ++R+Y
Sbjct: 141 D--RNHYRRY 148



 Score = 56.8 bits (131), Expect = 6e-08
 Identities = 24/29 (82%), Positives = 27/29 (93%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           VIA KV GTVKWFNV++GYGFINRNDTK+
Sbjct: 54  VIATKVLGTVKWFNVRNGYGFINRNDTKE 82


>BC018393-1|AAH18393.1|  267|Homo sapiens Unknown (protein for
           IMAGE:3882730) protein.
          Length = 267

 Score =  105 bits (253), Expect = 9e-23
 Identities = 51/70 (72%), Positives = 58/70 (82%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGPGG PV+GS YAA
Sbjct: 81  KEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAA 140

Query: 432 DKRRGYHRQY 461
           D  R ++R+Y
Sbjct: 141 D--RNHYRRY 148



 Score = 56.8 bits (131), Expect = 6e-08
 Identities = 24/29 (82%), Positives = 27/29 (93%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           VIA KV GTVKWFNV++GYGFINRNDTK+
Sbjct: 54  VIATKVLGTVKWFNVRNGYGFINRNDTKE 82


>BC015208-1|AAH15208.1|  324|Homo sapiens Y box binding protein 1
           protein.
          Length = 324

 Score =  105 bits (253), Expect = 9e-23
 Identities = 51/70 (72%), Positives = 58/70 (82%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGPGG PV+GS YAA
Sbjct: 81  KEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAA 140

Query: 432 DKRRGYHRQY 461
           D  R ++R+Y
Sbjct: 141 D--RNHYRRY 148



 Score = 56.8 bits (131), Expect = 6e-08
 Identities = 24/29 (82%), Positives = 27/29 (93%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           VIA KV GTVKWFNV++GYGFINRNDTK+
Sbjct: 54  VIATKVLGTVKWFNVRNGYGFINRNDTKE 82


>BC010430-1|AAH10430.1|  324|Homo sapiens Y box binding protein 1
           protein.
          Length = 324

 Score =  105 bits (253), Expect = 9e-23
 Identities = 51/70 (72%), Positives = 58/70 (82%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGPGG PV+GS YAA
Sbjct: 81  KEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAA 140

Query: 432 DKRRGYHRQY 461
           D  R ++R+Y
Sbjct: 141 D--RNHYRRY 148



 Score = 56.8 bits (131), Expect = 6e-08
 Identities = 24/29 (82%), Positives = 27/29 (93%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           VIA KV GTVKWFNV++GYGFINRNDTK+
Sbjct: 54  VIATKVLGTVKWFNVRNGYGFINRNDTKE 82


>BC002411-1|AAH02411.1|  324|Homo sapiens Y box binding protein 1
           protein.
          Length = 324

 Score =  105 bits (253), Expect = 9e-23
 Identities = 51/70 (72%), Positives = 58/70 (82%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGPGG PV+GS YAA
Sbjct: 81  KEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAA 140

Query: 432 DKRRGYHRQY 461
           D  R ++R+Y
Sbjct: 141 D--RNHYRRY 148



 Score = 56.8 bits (131), Expect = 6e-08
 Identities = 24/29 (82%), Positives = 27/29 (93%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           VIA KV GTVKWFNV++GYGFINRNDTK+
Sbjct: 54  VIATKVLGTVKWFNVRNGYGFINRNDTKE 82


>BC000064-1|AAH00064.1|  266|Homo sapiens YBX1 protein protein.
          Length = 266

 Score =  105 bits (253), Expect = 9e-23
 Identities = 51/70 (72%), Positives = 58/70 (82%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGPGG PV+GS YAA
Sbjct: 81  KEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAA 140

Query: 432 DKRRGYHRQY 461
           D  R ++R+Y
Sbjct: 141 D--RNHYRRY 148



 Score = 56.8 bits (131), Expect = 6e-08
 Identities = 24/29 (82%), Positives = 27/29 (93%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           VIA KV GTVKWFNV++GYGFINRNDTK+
Sbjct: 54  VIATKVLGTVKWFNVRNGYGFINRNDTKE 82


>J03827-1|AAA61308.1|  317|Homo sapiens NFYA protein.
          Length = 317

 Score =  105 bits (252), Expect = 1e-22
 Identities = 51/70 (72%), Positives = 58/70 (82%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQTAI +NNPRK +RSVGDGE VEF VV GEKG EAA VTGPGG PV+GS YAA
Sbjct: 81  KEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGEEAANVTGPGGVPVQGSKYAA 140

Query: 432 DKRRGYHRQY 461
           D  R ++R+Y
Sbjct: 141 D--RNHYRRY 148



 Score = 56.8 bits (131), Expect = 6e-08
 Identities = 24/29 (82%), Positives = 27/29 (93%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           VIA KV GTVKWFNV++GYGFINRNDTK+
Sbjct: 54  VIATKVLGTVKWFNVRNGYGFINRNDTKE 82


>BC047760-1|AAH47760.1|  364|Homo sapiens Y box binding protein 2
           protein.
          Length = 364

 Score =  102 bits (245), Expect = 9e-22
 Identities = 48/64 (75%), Positives = 53/64 (82%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQTAI RNNPRK +RSVGDGE VEF VV GEKG EA  VTGPGG PVKGS YA 
Sbjct: 116 KEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEATNVTGPGGVPVKGSRYAP 175

Query: 432 DKRR 443
           ++R+
Sbjct: 176 NRRK 179



 Score = 53.6 bits (123), Expect = 5e-07
 Identities = 22/29 (75%), Positives = 27/29 (93%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           V+A +V GTVKWFNV++GYGFINRNDTK+
Sbjct: 89  VLAIQVLGTVKWFNVRNGYGFINRNDTKE 117


>BC033800-1|AAH33800.1|  364|Homo sapiens Y box binding protein 2
           protein.
          Length = 364

 Score =  102 bits (245), Expect = 9e-22
 Identities = 48/64 (75%), Positives = 53/64 (82%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQTAI RNNPRK +RSVGDGE VEF VV GEKG EA  VTGPGG PVKGS YA 
Sbjct: 116 KEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEATNVTGPGGVPVKGSRYAP 175

Query: 432 DKRR 443
           ++R+
Sbjct: 176 NRRK 179



 Score = 53.6 bits (123), Expect = 5e-07
 Identities = 22/29 (75%), Positives = 27/29 (93%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           V+A +V GTVKWFNV++GYGFINRNDTK+
Sbjct: 89  VLAIQVLGTVKWFNVRNGYGFINRNDTKE 117


>AF096834-1|AAD30662.1|  364|Homo sapiens germ cell specific Y-box
           binding protein protein.
          Length = 364

 Score =  102 bits (245), Expect = 9e-22
 Identities = 48/64 (75%), Positives = 53/64 (82%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQTAI RNNPRK +RSVGDGE VEF VV GEKG EA  VTGPGG PVKGS YA 
Sbjct: 116 KEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEATNVTGPGGVPVKGSRYAP 175

Query: 432 DKRR 443
           ++R+
Sbjct: 176 NRRK 179



 Score = 53.6 bits (123), Expect = 5e-07
 Identities = 22/29 (75%), Positives = 27/29 (93%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           V+A +V GTVKWFNV++GYGFINRNDTK+
Sbjct: 89  VLAIQVLGTVKWFNVRNGYGFINRNDTKE 117


>DQ120685-1|ABB92460.1|  319|Homo sapiens rcNSEP1 protein.
          Length = 319

 Score =   99 bits (238), Expect = 6e-21
 Identities = 48/70 (68%), Positives = 56/70 (80%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVH TA  +NNPRK +RSVGDGE VEF VV GEKG +AA VTGPGG PV+GS YAA
Sbjct: 77  KEDVFVHHTAXKKNNPRKYLRSVGDGEXVEFDVVEGEKGAKAANVTGPGGVPVQGSKYAA 136

Query: 432 DKRRGYHRQY 461
           D  R ++R+Y
Sbjct: 137 D--RNHYRRY 144



 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 23/29 (79%), Positives = 27/29 (93%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           VIA KV GTVKWFNV++GYGFI+RNDTK+
Sbjct: 50  VIATKVLGTVKWFNVRNGYGFIHRNDTKE 78


>AB208818-1|BAD92055.1|  268|Homo sapiens germ cell specific Y-box
           binding protein variant protein.
          Length = 268

 Score = 91.5 bits (217), Expect = 2e-18
 Identities = 43/61 (70%), Positives = 49/61 (80%)
 Frame = +3

Query: 261 VFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAADKR 440
           +F +QTAI RNNPRK +RSVGDGE VEF VV GEKG EA  VTGPGG PVKGS YA ++R
Sbjct: 23  LFPNQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEATNVTGPGGVPVKGSRYAPNRR 82

Query: 441 R 443
           +
Sbjct: 83  K 83


>Z95329-1|CAI21661.2|  250|Homo sapiens lin-28 homolog B (C.
           elegans) protein.
          Length = 250

 Score = 47.6 bits (108), Expect = 3e-05
 Identities = 25/54 (46%), Positives = 31/54 (57%)
 Frame = +3

Query: 258 DVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGS 419
           DVFVHQ+ +      +  RS+ +GE VEF      KG E+  VTGPGG P  GS
Sbjct: 61  DVFVHQSKLFM----EGFRSLKEGEPVEFTFKKSSKGLESIRVTGPGGSPCLGS 110



 Score = 29.5 bits (63), Expect = 9.7
 Identities = 10/17 (58%), Positives = 14/17 (82%)
 Frame = +1

Query: 190 SGTVKWFNVKSGYGFIN 240
           +G  KWFNV+ G+GFI+
Sbjct: 31  TGHCKWFNVRMGFGFIS 47


>DQ127228-1|AAZ38897.1|  250|Homo sapiens LIN28B protein.
          Length = 250

 Score = 47.6 bits (108), Expect = 3e-05
 Identities = 25/54 (46%), Positives = 31/54 (57%)
 Frame = +3

Query: 258 DVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGS 419
           DVFVHQ+ +      +  RS+ +GE VEF      KG E+  VTGPGG P  GS
Sbjct: 61  DVFVHQSKLFM----EGFRSLKEGEPVEFTFKKSSKGLESIRVTGPGGSPCLGS 110



 Score = 29.5 bits (63), Expect = 9.7
 Identities = 10/17 (58%), Positives = 14/17 (82%)
 Frame = +1

Query: 190 SGTVKWFNVKSGYGFIN 240
           +G  KWFNV+ G+GFI+
Sbjct: 31  TGHCKWFNVRMGFGFIS 47


>BC150538-1|AAI50539.1|  227|Homo sapiens Unknown (protein for
           IMAGE:40127315) protein.
          Length = 227

 Score = 47.6 bits (108), Expect = 3e-05
 Identities = 25/54 (46%), Positives = 31/54 (57%)
 Frame = +3

Query: 258 DVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGS 419
           DVFVHQ+ +      +  RS+ +GE VEF      KG E+  VTGPGG P  GS
Sbjct: 38  DVFVHQSKLFM----EGFRSLKEGEPVEFTFKKSSKGLESIRVTGPGGSPCLGS 87



 Score = 29.5 bits (63), Expect = 9.7
 Identities = 10/17 (58%), Positives = 14/17 (82%)
 Frame = +1

Query: 190 SGTVKWFNVKSGYGFIN 240
           +G  KWFNV+ G+GFI+
Sbjct: 8   TGHCKWFNVRMGFGFIS 24


>BC150537-1|AAI50538.1|  227|Homo sapiens Unknown (protein for
           IMAGE:40127314) protein.
          Length = 227

 Score = 47.6 bits (108), Expect = 3e-05
 Identities = 25/54 (46%), Positives = 31/54 (57%)
 Frame = +3

Query: 258 DVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGS 419
           DVFVHQ+ +      +  RS+ +GE VEF      KG E+  VTGPGG P  GS
Sbjct: 38  DVFVHQSKLFM----EGFRSLKEGEPVEFTFKKSSKGLESIRVTGPGGSPCLGS 87



 Score = 29.5 bits (63), Expect = 9.7
 Identities = 10/17 (58%), Positives = 14/17 (82%)
 Frame = +1

Query: 190 SGTVKWFNVKSGYGFIN 240
           +G  KWFNV+ G+GFI+
Sbjct: 8   TGHCKWFNVRMGFGFIS 24


>BC141960-1|AAI41961.1|  227|Homo sapiens LIN28B protein protein.
          Length = 227

 Score = 47.6 bits (108), Expect = 3e-05
 Identities = 25/54 (46%), Positives = 31/54 (57%)
 Frame = +3

Query: 258 DVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGS 419
           DVFVHQ+ +      +  RS+ +GE VEF      KG E+  VTGPGG P  GS
Sbjct: 38  DVFVHQSKLFM----EGFRSLKEGEPVEFTFKKSSKGLESIRVTGPGGSPCLGS 87



 Score = 29.5 bits (63), Expect = 9.7
 Identities = 10/17 (58%), Positives = 14/17 (82%)
 Frame = +1

Query: 190 SGTVKWFNVKSGYGFIN 240
           +G  KWFNV+ G+GFI+
Sbjct: 8   TGHCKWFNVRMGFGFIS 24


>BC127713-1|AAI27714.1|  227|Homo sapiens LIN28B protein protein.
          Length = 227

 Score = 47.6 bits (108), Expect = 3e-05
 Identities = 25/54 (46%), Positives = 31/54 (57%)
 Frame = +3

Query: 258 DVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGS 419
           DVFVHQ+ +      +  RS+ +GE VEF      KG E+  VTGPGG P  GS
Sbjct: 38  DVFVHQSKLFM----EGFRSLKEGEPVEFTFKKSSKGLESIRVTGPGGSPCLGS 87



 Score = 29.5 bits (63), Expect = 9.7
 Identities = 10/17 (58%), Positives = 14/17 (82%)
 Frame = +1

Query: 190 SGTVKWFNVKSGYGFIN 240
           +G  KWFNV+ G+GFI+
Sbjct: 8   TGHCKWFNVRMGFGFIS 24


>BC127712-1|AAI27713.1|  227|Homo sapiens LIN28B protein protein.
          Length = 227

 Score = 47.6 bits (108), Expect = 3e-05
 Identities = 25/54 (46%), Positives = 31/54 (57%)
 Frame = +3

Query: 258 DVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGS 419
           DVFVHQ+ +      +  RS+ +GE VEF      KG E+  VTGPGG P  GS
Sbjct: 38  DVFVHQSKLFM----EGFRSLKEGEPVEFTFKKSSKGLESIRVTGPGGSPCLGS 87



 Score = 29.5 bits (63), Expect = 9.7
 Identities = 10/17 (58%), Positives = 14/17 (82%)
 Frame = +1

Query: 190 SGTVKWFNVKSGYGFIN 240
           +G  KWFNV+ G+GFI+
Sbjct: 8   TGHCKWFNVRMGFGFIS 24


>AL135911-2|CAI20969.2|  250|Homo sapiens lin-28 homolog B (C.
           elegans) protein.
          Length = 250

 Score = 47.6 bits (108), Expect = 3e-05
 Identities = 25/54 (46%), Positives = 31/54 (57%)
 Frame = +3

Query: 258 DVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGS 419
           DVFVHQ+ +      +  RS+ +GE VEF      KG E+  VTGPGG P  GS
Sbjct: 61  DVFVHQSKLFM----EGFRSLKEGEPVEFTFKKSSKGLESIRVTGPGGSPCLGS 110



 Score = 29.5 bits (63), Expect = 9.7
 Identities = 10/17 (58%), Positives = 14/17 (82%)
 Frame = +1

Query: 190 SGTVKWFNVKSGYGFIN 240
           +G  KWFNV+ G+GFI+
Sbjct: 31  TGHCKWFNVRMGFGFIS 47


>AK131411-1|BAD18558.1|  250|Homo sapiens protein ( Homo sapiens
           cDNA FLJ16517 fis, clone NT2RI3007167. ).
          Length = 250

 Score = 47.6 bits (108), Expect = 3e-05
 Identities = 25/54 (46%), Positives = 31/54 (57%)
 Frame = +3

Query: 258 DVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGS 419
           DVFVHQ+ +      +  RS+ +GE VEF      KG E+  VTGPGG P  GS
Sbjct: 61  DVFVHQSKLFM----EGFRSLKEGEPVEFTFKKSSKGLESIRVTGPGGSPCLGS 110



 Score = 29.5 bits (63), Expect = 9.7
 Identities = 10/17 (58%), Positives = 14/17 (82%)
 Frame = +1

Query: 190 SGTVKWFNVKSGYGFIN 240
           +G  KWFNV+ G+GFI+
Sbjct: 31  TGHCKWFNVRMGFGFIS 47


>BC028566-1|AAH28566.1|  209|Homo sapiens LIN28 protein protein.
          Length = 209

 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 23/48 (47%), Positives = 29/48 (60%)
 Frame = +3

Query: 258 DVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGG 401
           DVFVHQ+ +      +  RS+ +GEAVEF      KG E+  VTGPGG
Sbjct: 71  DVFVHQSKLHM----EGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGG 114


>AL513365-12|CAI21500.1|  209|Homo sapiens lin-28 homolog (C.
           elegans) protein.
          Length = 209

 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 23/48 (47%), Positives = 29/48 (60%)
 Frame = +3

Query: 258 DVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGG 401
           DVFVHQ+ +      +  RS+ +GEAVEF      KG E+  VTGPGG
Sbjct: 71  DVFVHQSKLHM----EGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGG 114


>AK022519-1|BAB14075.1|  209|Homo sapiens protein ( Homo sapiens
           cDNA FLJ12457 fis, clone NT2RM1000666, weakly similar to
           DNA-BINDING PROTEIN A. ).
          Length = 209

 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 23/48 (47%), Positives = 29/48 (60%)
 Frame = +3

Query: 258 DVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGG 401
           DVFVHQ+ +      +  RS+ +GEAVEF      KG E+  VTGPGG
Sbjct: 71  DVFVHQSKLHM----EGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGG 114


>AF521099-1|AAM77751.1|  209|Homo sapiens RNA-binding protein LIN-28
           protein.
          Length = 209

 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 23/48 (47%), Positives = 29/48 (60%)
 Frame = +3

Query: 258 DVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGG 401
           DVFVHQ+ +      +  RS+ +GEAVEF      KG E+  VTGPGG
Sbjct: 71  DVFVHQSKLHM----EGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGG 114


>Z74615-1|CAA98968.1| 1464|Homo sapiens prepro-alpha1(I) collagen
            protein.
          Length = 1464

 Score = 30.7 bits (66), Expect = 4.2
 Identities = 15/30 (50%), Positives = 17/30 (56%)
 Frame = +3

Query: 357  GEKGFEAAGVTGPGGEPVKGSPYAADKRRG 446
            GE+GF   G+ GP GEP K  P  A   RG
Sbjct: 968  GERGFP--GLPGPSGEPGKQGPSGASGERG 995


>X98705-1|CAA67261.1| 1069|Homo sapiens collagen type I alpha 1
            protein.
          Length = 1069

 Score = 30.7 bits (66), Expect = 4.2
 Identities = 15/30 (50%), Positives = 17/30 (56%)
 Frame = +3

Query: 357  GEKGFEAAGVTGPGGEPVKGSPYAADKRRG 446
            GE+GF   G+ GP GEP K  P  A   RG
Sbjct: 968  GERGFP--GLPGPSGEPGKQGPSGASGERG 995


>K01228-1|AAA51995.1| 1040|Homo sapiens COL1A1 protein.
          Length = 1040

 Score = 30.7 bits (66), Expect = 4.2
 Identities = 15/30 (50%), Positives = 17/30 (56%)
 Frame = +3

Query: 357 GEKGFEAAGVTGPGGEPVKGSPYAADKRRG 446
           GE+GF   G+ GP GEP K  P  A   RG
Sbjct: 544 GERGFP--GLPGPSGEPGKQGPSGASGERG 571


>BC036531-1|AAH36531.1| 1464|Homo sapiens collagen, type I, alpha 1
            protein.
          Length = 1464

 Score = 30.7 bits (66), Expect = 4.2
 Identities = 15/30 (50%), Positives = 17/30 (56%)
 Frame = +3

Query: 357  GEKGFEAAGVTGPGGEPVKGSPYAADKRRG 446
            GE+GF   G+ GP GEP K  P  A   RG
Sbjct: 968  GERGFP--GLPGPSGEPGKQGPSGASGERG 995


>AF017178-1|AAB94054.2| 1461|Homo sapiens pro alpha 1(I) collagen
            protein.
          Length = 1461

 Score = 30.7 bits (66), Expect = 4.2
 Identities = 15/30 (50%), Positives = 17/30 (56%)
 Frame = +3

Query: 357  GEKGFEAAGVTGPGGEPVKGSPYAADKRRG 446
            GE+GF   G+ GP GEP K  P  A   RG
Sbjct: 965  GERGFP--GLPGPSGEPGKQGPSGASGERG 992


>AB209597-1|BAD92834.1| 1467|Homo sapiens Collagen alpha 1 chain
            precursor variant protein.
          Length = 1467

 Score = 30.7 bits (66), Expect = 4.2
 Identities = 15/30 (50%), Positives = 17/30 (56%)
 Frame = +3

Query: 357  GEKGFEAAGVTGPGGEPVKGSPYAADKRRG 446
            GE+GF   G+ GP GEP K  P  A   RG
Sbjct: 971  GERGFP--GLPGPSGEPGKQGPSGASGERG 998


>BC034571-1|AAH34571.1|  216|Homo sapiens PLA2G4D protein protein.
          Length = 216

 Score = 29.9 bits (64), Expect = 7.3
 Identities = 23/78 (29%), Positives = 32/78 (41%), Gaps = 7/78 (8%)
 Frame = -1

Query: 539 WAGVHDVLILPAWSSFTASSATL-------TREILAVVATALVCSIR*AFYWLTTGTSNT 381
           W+ +  + +L AW   T+S  +        TR +     T    S R    WL  GT+  
Sbjct: 20  WSNIFSLNLLDAWYDLTSSGESWKQHIKDKTRSLEKEPLTTSGTSSRLEASWLQPGTALA 79

Query: 380 SCFKAFLPGNHGKLHRLS 327
             FK FL G    LH+ S
Sbjct: 80  QAFKGFLTGR--PLHQRS 95


>AB090876-1|BAC67158.1|  818|Homo sapiens cytosolic phospholipase A2
           delta protein.
          Length = 818

 Score = 29.9 bits (64), Expect = 7.3
 Identities = 23/78 (29%), Positives = 32/78 (41%), Gaps = 7/78 (8%)
 Frame = -1

Query: 539 WAGVHDVLILPAWSSFTASSATL-------TREILAVVATALVCSIR*AFYWLTTGTSNT 381
           W+ +  + +L AW   T+S  +        TR +     T    S R    WL  GT+  
Sbjct: 527 WSNIFSLNLLDAWYDLTSSGESWKQHIKDKTRSLEKEPLTTSGTSSRLEASWLQPGTALA 586

Query: 380 SCFKAFLPGNHGKLHRLS 327
             FK FL G    LH+ S
Sbjct: 587 QAFKGFLTGR--PLHQRS 602


>J00112-1|AAA52291.1|   60|Homo sapiens pro-alpha-1 collagen type 1
           protein.
          Length = 60

 Score = 29.5 bits (63), Expect = 9.7
 Identities = 15/30 (50%), Positives = 16/30 (53%)
 Frame = +3

Query: 357 GEKGFEAAGVTGPGGEPVKGSPYAADKRRG 446
           GE+GF   G  GP GEP K  P  A   RG
Sbjct: 4   GERGFP--GPLGPSGEPGKQGPSGASGERG 31


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 76,337,383
Number of Sequences: 237096
Number of extensions: 1310959
Number of successful extensions: 4203
Number of sequences better than 10.0: 55
Number of HSP's better than 10.0 without gapping: 3935
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4201
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 6466646650
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -